(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE417

ASPNC_1.PE417        Location/Qualifiers
FT   CDS_pept        join(1028410..1028549,1028641..1028715,1028928..1028974,
FT                   1029311..1029592,1029720..1029792,1029923..1030274)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111069"
FT                   /orf_name="An01g04390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36974.1"
FT                   /db_xref="UniParc:UPI0000EF9E71"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H7"
FT                   /transl_table=1
FT                   /translation="MLTLFRLAQSRPFVRNLLLWKQNDVFTSEPDRALHRGGLGCRINI
FT                   DGWMLWGSDATASMASTPHMAPFPHSRCLAQCVAHEYLLRVIATFSCAVTGYIRSTYQA
FT                   DQQVLTDPWFAHLFFCQPIFIGDDAVLFRDPDPERRPITPRYFNPAFSGLRVSASRGLE
FT                   SSIFLVAADTSRWASPVRRIRTSVAFAKNEQVNGPGTGWTKKKASLCFPQFLMLVFSLL
FT                   QLPDNTSRHVPGEKKELCGSVPRQVTPSLTRNPLVAGPVGSLPTMGHQPEPGSLDCLHS
FT                   HSQGISQHEWPPESGPPYSVLVESAFLAPKLSLSRGLEALP"
     atgttgacat tgtttcgttt ggcacagtct aggccttttg ttcgcaatct actgctttgg        60
     aagcaaaacg acgtcttcac atctgagcca gacagagcgc tccacagagg tggactcgga       120
     tgtagaatca acatcgacgg atggatgctt tggggctctg atgcaactgc aagtatggcg       180
     tcaactcctc acatggcacc gttcccacat tcccgatgct tagcccaatg tgttgctcat       240
     gaatacttgc taagagtcat cgccactttc tcttgcgcag tcactggtta tattcggtct       300
     acgtatcaag cagatcagca agtgctcacc gatccgtggt ttgctcacct ttttttctgc       360
     cagccgatct tcatcggcga cgacgccgtc ttgtttcggg acccagaccc ggagcgaaga       420
     ccgataactc cgaggtattt caatcccgca ttttctggct tacgagtaag tgcttcgagg       480
     ggtctcgaat caagcatctt ccttgttgct gctgatactt ctcggtgggc cagtccagtg       540
     cgcagaattc gaaccagcgt tgcattcgcc aagaatgagc aggtcaacgg accaggtaca       600
     ggatggacta aaaagaaggc gtccctttgc tttccccaat ttctcatgct cgtgttctca       660
     cttctccaac tccccgacaa cacatcaaga catgttcctg gggaaaagaa agagctctgt       720
     ggctccgtcc ctcggcaagt gactccatcg cttacccgga acccgctcgt tgctggtcca       780
     gtaggctctc ttcccacaat ggggcatcag ccagagcctg gttcacttga ctgtctccat       840
     tcccactccc aggggatcag tcaacatgaa tggccacctg agagtggacc cccctactca       900
     gtcttggttg agtctgcttt tctagctccc aagcttagtc ttagccgggg cttggaggca       960
     ctaccttaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page