(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE425

ASPNC_1.PE425        Location/Qualifiers
FT   CDS_pept        join(1048867..1048879,1049019..1049216,1049355..1049471,
FT                   1049745..1049794,1050012..1050128)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878864"
FT                   /orf_name="An01g04460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36982.1"
FT                   /db_xref="UniParc:UPI0000EF9E79"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I5"
FT                   /transl_table=1
FT                   /translation="MVRPVNHFSEIEGKEKRGIKYEISRSWWWWSWGNQGEKGPKDQRV
FT                   RKLEIREDVKRGDTGDVKGTVDGAEMVVVRNQAKGREKTEKEEKEEDGRGEEKRKKTLE
FT                   TRGRREALRHGRLASSSSDPIEDGDDLTMQSTPPTSDGGCLGAEQINPGLDTYFVTRVE
FT                   S"
     atggttcgac cggtgaacca cttctcggaa atcgagggga aggagaaacg gggaataaaa        60
     tatgaaatca gtagatcgtg gtggtggtgg tcgtggggaa atcaagggga aaagggaccc       120
     aaggatcaga gagtgagaaa gttggagata agagaggatg tcaagagagg agacacgggt       180
     gatgtcaaag gaacagtgga tggagcagaa atggtggtgg tgaggaacca agcaaaaggg       240
     agagagaaga ccgagaagga agagaaagaa gaggacggga gaggtgagga gaagaggaag       300
     aagaccttag agactagagg gagaagagaa gctctgcggc acggcaggct tgcgtcgtcg       360
     tcgtcagatc caattgaaga tggggacgat ctgaccatgc aatcgactcc tccgactagt       420
     gacgggggtt gcctcggagc tgaacagatt aatcccggac tagatactta ctttgttact       480
     agagtcgagt cttga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page