(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE428

ASPNC_1.PE428        Location/Qualifiers
FT   CDS_pept        join(complement(1062648..1062897),
FT                   complement(1062262..1062398))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878867"
FT                   /orf_name="An01g04490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36985.1"
FT                   /db_xref="UniParc:UPI0000EF9E8D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I8"
FT                   /transl_table=1
FT                   /translation="MDRRSKLKDGEKGESGTMFQPRSPSGWPPAHCRVASAADVVNALR
FT                   LRDFIHDVAAAVAAANTIDQLPYPKKLILLDKDSAHIRFFPHMNKKTILRKETARRRTS
FT                   DRFLSCPADPAPGYDADAVSVVLD"
     atggaccgtc ggtccaaact caaagacggt gaaaaaggcg agtccggtac catgtttcaa        60
     cctcgatcgc cttctggctg gccacctgct cactgtcggg tcgcctctgc tgctgatgtg       120
     gtaaatgctc tccgcctacg agatttcata catgatgttg ctgctgctgt tgctgctgct       180
     aataccatag atcaactgcc atatccaaag aaactaatac ttttggacaa agattctgct       240
     cacattcgct ttttccccca tatgaacaaa aagactatac taaggaaaga aactgcgaga       300
     agaagaacct cggatcgttt cttgtcttgt ccagccgacc ctgctcctgg ctacgatgct       360
     gacgccgttt ccgttgtcct agactga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page