(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE430

ASPNC_1.PE430        Location/Qualifiers
FT   CDS_pept        join(1065585..1065598,1065667..1065799)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878868"
FT                   /orf_name="An01g04510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36987.1"
FT                   /db_xref="UniParc:UPI0000EF9E8F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J0"
FT                   /transl_table=1
FT                   /translation="MPVGSRASSPATLAYSPTFSLQSARGTGRNSVAAGFFPTSVPPDW
FT                   VAG"
     atgcctgtcg gaagccgggc ttcttctccg gccacccttg cttactcacc tacctttagt        60
     ctgcagagcg cgcgcgggac aggaaggaat agcgtggcag ctggattctt tccaacgtct       120
     gtgccccccg actgggtcgc agggtag                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page