(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE438

ASPNC_1.PE438        Location/Qualifiers
FT   CDS_pept        join(complement(1091082..1091234),
FT                   complement(1091013..1091020),complement(1089714..1090947))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654549"
FT                   /gene_name="prpA"
FT                   /orf_name="An01g04600"
FT                   /product="PDI related protein A prpA-Aspergillus niger "
FT                   /EC_number="5.3.4.1"
FT                   /function="protein disulfide isomerase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAK36995.1"
FT                   /db_xref="GO:0003756"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG329960"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000006BCA8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J8"
FT                   /transl_table=1
FT                   /translation="MLQPSSALLFVTSLLAALPVNADGLYTKKSPVLQVNQKNYDQLIA
FT                   NSNHTSIVEFYAPWCGHCQNLKPAYEKAATNLDGLAKVAAVNCDYDDNKPFCGRMGVQG
FT                   FPTLKIVTPGKKPGKPRVEDYKGARSAKAIVEAVVDRIPNHVKRATDKDLDTWLAQDEE
FT                   SPKAILFTEKGTTSPLLRALAIDFLGSIQVAQVRNKETEAVEKFGITEFPTFVLLPGGG
FT                   QDPIVYDGELKKKPMVEFLSQAAAPNPDPAPKGSTAPRDNNKKKSTEPSPDSKIVSDEA
FT                   KPASVPIPAPPIGTLPTAEALEAACLMPKSGTCVLALLPEPSEPDAELPAPAKDALLSL
FT                   AEISHKHAVRKSKLFPFYSVPAINSGAKTLRAGLGLPEDNSVEIVAVNGRRGWWRRYDS
FT                   VEGAEYGQERVEAWIDAIRLGEGEKQKLPDGVVVEEVVEEKVEEKVEEVVEEPVEEKPA
FT                   VDHDEL"
     atgctgcagc ccagctctgc gttgcttttc gtcacgtcgc ttctggcggc gttgcccgtc        60
     aacgccgatg gattgtatac gaagaagtcc cccgtcttgc aggtcaacca gaagaactac       120
     gaccagctca ttgcaaactc caatcacact tcgatcgtag aattctacgc tccctggtgc       180
     ggccactgcc agaacctaaa gcccgcctac gaaaaagccg caactaatct cgacggcctg       240
     gccaaagtcg ccgccgtcaa ttgcgactat gacgacaaca aacccttctg cggccgcatg       300
     ggcgtccagg gcttccctac cctcaagatc gtcacccccg gcaagaaacc cggcaagccc       360
     cgcgtggaag actacaaggg cgcacgaagt gccaaagcga ttgtcgaggc agtcgtcgac       420
     cggattccca accatgtgaa gcgcgcaaca gacaaggacc ttgacacttg gctcgcgcag       480
     gatgaggaat cccccaaggc catcctcttc acggagaaag gcaccaccag cccactcctc       540
     cgcgccctgg ccatcgactt cctcggctcc atccaagtcg ctcaagtccg caacaaggaa       600
     accgaagccg tcgagaaatt cggcatcacc gagttcccaa ccttcgtcct actcccagga       660
     ggcggccaag accccatcgt ctacgacggc gaactgaaga agaagcccat ggtcgaattc       720
     ctcagccaag ccgctgctcc taacccggat cctgctccca agggctcgac cgcgccccgc       780
     gataacaaca agaagaaatc caccgaacct tctccagact ccaagattgt ctcggacgag       840
     gccaaacccg ccagtgtgcc cattccggct ccccccattg gtaccctgcc cactgcggaa       900
     gccctcgagg ctgcttgtct gatgccgaaa tccggtacct gtgtgctggc tctcctccct       960
     gaaccgagtg agccggacgc agagctcccg gctccggcca aggacgccct cctcagtctc      1020
     gctgagatct cgcacaagca cgcagtccgt aagagcaagc tcttcccgtt ctacagtgtc      1080
     ccggctatca atagcggagc taagaccctc cgcgctgggc ttggtctgcc tgaggataac      1140
     tcggtggaga tcgttgctgt gaatggacgc cgtggctggt ggcgccggta tgactcggtt      1200
     gagggcgcag agtacggcca ggagcgtgtc gaggcttgga ttgatgcgat caggctgggt      1260
     gagggtgaga agcagaagtt gcctgatggc gttgtcgttg aagaggtagt tgaggagaag      1320
     gtcgaagaga aggtcgagga agtggttgaa gaacccgtcg aggagaagcc ggcggtcgac      1380
     cacgacgaat tgtaa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page