(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE44

ASPNC_1.PE44         Location/Qualifiers
FT   CDS_pept        join(complement(122862..123009),complement(122641..122765))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959387"
FT                   /orf_name="An01g00500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43438.1"
FT                   /db_xref="UniParc:UPI0000EF9F26"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F4"
FT                   /transl_table=1
FT                   /translation="MDRSATSRNTGSSGHAANGAHSDLPDLATYQAQWAKIHDDTVRQI
FT                   NEALAIPFKLAINDEYPEKLAISGVYRNSVDSDFLFGICLLFRLG"
     atggaccgaa gtgctaccag cagaaacact ggctcaagtg gccatgccgc taatggcgct        60
     cactccgatt taccggacct ggctacttat caagcacaat gggccaaaat ccatgatgat       120
     actgtgcgcc agatcaacga agccctagca attcccttca agctagcgat aaatgatgag       180
     tatccggaga aattggcgat atcgggtgtt tatcggaact ctgttgattc tgactttttg       240
     ttcggcatct gcttgctttt tcgcttggga tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page