(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE440

ASPNC_1.PE440        Location/Qualifiers
FT   CDS_pept        join(complement(1095281..1095445),
FT                   complement(1093500..1095152))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878875"
FT                   /orf_name="An01g04620"
FT                   /product="Function: the DnaJ-domain is part of a chaperone "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAK36997.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0000EF9EAF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K0"
FT                   /transl_table=1
FT                   /translation="MYSAARVTNYYSILGISHNSTLKDINSAYKKLALKHHPDKQGTGS
FT                   ADVSNDEFQKIQEAIETLRDPIRKQEHDDSLRRAGYYFHSTPFASDDEYEDWEKGTWRP
FT                   TSGKRYCDLTDPMELYKYKYGHSVHMDPFAPESLVEKARVEIEIRVGEQLKREAEAAEA
FT                   AAAAGGMRSGNGDDEGEEDEGVEDDGGVLFEKPQHFQDILEYLRNQEAASVEKRKMAMK
FT                   ANVDKDEERLRNGEDEEEFEHDEKEFARGYGNEYCWRSQEAGPDVPREWHENFYYNEEE
FT                   AAYYGGDEDEGEGEGDEEEDDEDDEEDDEEEDDNRRGENQNDDFEDEDEDDEQPQGPGA
FT                   GAPTQHHGNSYDVDRYDDDGYYHSDEEDDCYDDGGHNNGADIYFFKFSHTASEQPASSC
FT                   SDSTEYVTAKCARESDDESVLDEAGGVCVTHYMSNKPQPTDSSIFSPSSINLPSSPSVM
FT                   PLLTSPSIKLNATANINNGDPLLFHFYSKLDDPGNSYTSQDFVFELTGMVFDMYCGWLE
FT                   CVRLTFPEAKPLTKEQQDTSACLHLGGWEKRFGRDKCKGCHLRQPLYMLNCPGCGIEKC
FT                   VGCRLTAAAAVGKGVGDLLEGWDVTALGW"
     atgtattccg ctgcacgcgt gaccaactac tactcgatcc tgggtatctc tcataactca        60
     actctaaagg acatcaacag cgcgtacaag aagctcgcac tgaagcatca cccggacaag       120
     caaggcaccg gcagtgcaga tgtctctaac gacgagttcc agaagatcca agaagccatc       180
     gaaaccctcc gcgatcccat ccggaagcaa gagcacgacg atagccttcg tcgagctgga       240
     tactatttcc attcaacccc gtttgcatct gacgacgagt acgaagactg ggaaaaagga       300
     acttggagac ctacgagcgg gaagcgctac tgcgatctca ccgatcctat ggaactgtac       360
     aagtacaagt acggccatag tgttcatatg gatccattcg ctcctgagtc tctggtagag       420
     aaagctcgcg tggagattga gataagagta ggtgaacagt tgaagagaga ggcggaggcc       480
     gcggaagctg ctgcggctgc gggtggtatg agaagtggga atggagatga tgaaggtgag       540
     gaagatgaag gagttgagga cgacggtggc gttctatttg agaaacccca gcattttcag       600
     gacatcctgg agtatcttcg caatcaggaa gctgccagtg tggaaaagag aaagatggcg       660
     atgaaggcta atgtcgataa ggatgaggag aggctgagga acggggagga cgaagaagag       720
     ttcgaacatg atgagaaaga gtttgctcgt ggctacggca atgaatattg ctggagatcc       780
     caagaggctg ggcccgatgt tcccagagag tggcacgaaa acttttacta caacgaagaa       840
     gaggccgcct actacggtgg agatgaggat gaaggtgagg gtgaaggcga tgaggaggaa       900
     gatgatgagg atgacgaaga agatgacgaa gaagaagatg acaaccgccg tggagagaac       960
     cagaatgacg attttgagga cgaggacgaa gatgatgagc agccccaagg cccaggagca      1020
     ggagcaccta ctcagcacca cggcaattcc tatgatgtgg atcgctacga cgatgacggg      1080
     tactatcact ccgatgagga ggacgattgc tacgacgatg gcggccataa caatggagca      1140
     gacatttatt tcttcaaatt ctctcacact gcgagcgaac agcctgcctc gagctgctct      1200
     gacagcaccg agtacgtgac cgccaaatgt gctagagaat cggatgatga atctgtcctg      1260
     gacgaagctg gcggtgtctg tgtcactcat tatatgagca acaagcccca gccaaccgac      1320
     tcaagcatct tctcacccag ttctataaat cttccttcct ccccctctgt catgccctta      1380
     ctcacctccc cctccatcaa actcaacgcg accgctaaca tcaacaacgg cgacccgctc      1440
     ctcttccact tctactcaaa actcgacgac ccaggcaaca gctatacaag ccaggacttc      1500
     gttttcgagc taactggcat ggtcttcgac atgtactgcg gttggctaga atgtgtccgc      1560
     ctcacgttcc cggaggcgaa gccgctcacc aaggagcagc aagacacatc ggcttgcctc      1620
     cacctgggcg gttgggagaa gagatttggc cgggacaagt gtaaagggtg ccatcttcga      1680
     cagccgcttt acatgcttaa ttgccctgga tgtgggattg agaagtgtgt ggggtgtagg      1740
     ttgactgctg ctgctgctgt gggtaagggg gtgggggatt tgctggaggg atgggatgtt      1800
     actgcgctgg gctggtag                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page