(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE45

ASPNC_1.PE45         Location/Qualifiers
FT   CDS_pept        join(complement(126986..128114),complement(126619..126907),
FT                   complement(126484..126562),complement(126203..126418),
FT                   complement(125838..125891))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110316"
FT                   /orf_name="An01g00510"
FT                   /product="Catalytic activity: hydroxylation of n-alkanes at
FT                   the terminal position"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, reduced flavin or flavoprotein as one donor, and
FT                   incorporation of one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43439.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016712"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397671"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002402"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000EF9F3E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F5"
FT                   /transl_table=1
FT                   /translation="MAFDKVDHPVITIATVILVLWYTTTYLQRKWTHRRIIKANNCQPP
FT                   PSYPQKDPIFGLDILFEQIKYSKKHKILERAIERFKLYGNTFTQRRFTPFIITCEPENI
FT                   KTVLSLRFKDYGLAGRIDAMGPLLGHGIFTTDGEHWAQSRAMVRPNFAKEQVAHLDIFE
FT                   ELVNELISLIPTEGRTVDLQELFFELTIDSATEFLFGHSVHSLQKRRTGARDSTEQDFA
FT                   SAFNYAQKAIVADLRLGRLKYLRRDRKVGECIRTCHELVEQFVDSAMRVREQSSEQKAL
FT                   PVGDSHDAKEKQKYLFLHGLAQQTGDRRRIRDELINILLAGRDTTASLLSNLFFMLAKN
FT                   PRIWNKLREEIAFLEGRAPSYEQLRNLTYVRYCLNESLRLHPVVPANLRFANTDTVLPR
FT                   GGGPDGKSPVFVPKGCTVAYNVYALHRREDIFGPDANEFRPERWAEIRPGWEYLPFNGG
FT                   PRICVGQQYALTEAGAVGGGLCTDTLFEEWDEGGIELVRVCYMDGGIEDSVAASVTSEG
FT                   ESGASWSRDSARVPDSDGRQFHVRQDSVAWKCPTCAAAQKSLNLMQPPIAYSSLGLPGD
FT                   VHYATEGSSQDP"
     atggcttttg acaaagttga tcatcctgtt ataacgattg cgacggtcat tctcgttctt        60
     tggtatacca caacctacct gcagcggaaa tggacgcacc gtcgtatcat aaaagcgaac       120
     aattgccagc cgccgccatc ttatcctcag aaggacccta tcttcggtct cgacattctg       180
     tttgagcaga ttaagtattc caagaaacat aagattctcg agcgggcaat cgagcgattc       240
     aagctatacg gcaacacttt tacacagcgt cgattcaccc ctttcatcat aacatgcgag       300
     ccggagaata taaagacagt tttgtccctc cgattcaagg attatggctt agcaggccgc       360
     atcgatgcaa tgggtccact tttgggccat ggcatcttca ccaccgatgg cgagcactgg       420
     gcccagtcgc gtgccatggt ccgtccaaat ttcgcgaaag agcaagtcgc gcacttggat       480
     atctttgagg aactagtgaa cgaactgata tcgctgattc caaccgaggg cagaacggtc       540
     gatctacagg agctattctt cgagcttacg atcgactctg caacggaatt cctcttcggg       600
     cacagcgtgc acagccttca gaagcggcgg actggggccc gtgacagtac agaacaggac       660
     tttgccagcg ctttcaatta tgcacaaaag gctattgtgg cagatctacg ccttggtaga       720
     cttaaatatc tccgccgcga ccgcaaagta ggagagtgca tccgaacctg ccatgaactg       780
     gtggagcagt tcgtcgacag cgcaatgaga gtgcgagagc agtccagcga gcagaaagcg       840
     ctccccgtag gggacagtca tgacgcaaag gagaagcaga aatatttatt tctgcatggt       900
     ttagcccagc aaacggggga ccgcaggcgt atccgcgacg agctaataaa tatcctcctg       960
     gccgggcgag ataccacggc gtccctattg agcaacttgt tctttatgct agcaaagaac      1020
     cctcgcatct ggaacaaatt gcgcgaagag attgccttct tagaaggccg tgcgccgtcg      1080
     tacgagcaac tgcgtaatct gacatatgtg agatattgcc tgaatgaatc tcttcgcctc      1140
     caccctgttg ttccagcaaa cttgcgcttt gcgaacacgg atacagtact tccccgcggt      1200
     ggcggaccag acggcaagtc gcctgttttc gtgccaaagg gctgcacagt cgcctataat      1260
     gtctatgctc ttcaccgtcg tgaggacatt ttcggcccgg atgcaaacga gttccggcct      1320
     gaacgttggg ctgagatccg tccagggtgg gagtacctgc cattcaatgg gggaccacgc      1380
     atctgcgttg gtcaacagta tgcactaacg gaggcagggg cagtgggtgg agggctatgc      1440
     actgacactt tgttcgagga atgggacgaa ggtggcattg agctagttcg tgtctgttat      1500
     atggatggtg gaattgagga ctcggtagct gccagtgtca caagcgaagg agagtcaggc      1560
     gccagttggt cacgagattc cgcccgggta cctgactcgg acggaaggca gttccatgtc      1620
     aggcaggact ctgtagcatg gaagtgtccg acatgtgccg cagcccagaa gagccttaac      1680
     ctaatgcagc cgcctattgc gtatagtagc cttggccttc ctggtgacgt ccattacgcc      1740
     accgaaggct cttcccaaga tccctga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page