(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE450

ASPNC_1.PE450        Location/Qualifiers
FT   CDS_pept        join(1120003..1120192,1120245..1120795,1120847..1121608)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111331"
FT                   /orf_name="An01g04720"
FT                   /product="Complex: eukaryotic DNA primase is a heterodimer
FT                   of a large subunit"
FT                   /EC_number="2.7.7.-"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="CAK37007.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="HOGENOM:HBG617734"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniParc:UPI0000EF9EB9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L0"
FT                   /transl_table=1
FT                   /translation="MIRQDFRRIDPKRRATLDHKKKQFATPVFKQQDYPHRLNFYEVPP
FT                   TDEITLEQFEQWAIDRLKVLAEIEACSYRNKSPAETEAHITPHLQKYLPLSSNTSSSNG
FT                   AADQRLKNERQKDHYSHFILRLAFSATEELRRRFVRAETMLFRFRFQRDDTRERRAFIE
FT                   SLNLDWEPVDDEEKQRLAEQLLAASPGLRRIDDETWYKVDWEKVPELVERRAVFLSKGK
FT                   AYVPGREQLSMIIAEFTARLERALELTSRALPRLDEDDRLTPILNHLSKNFGSAESVYT
FT                   ENEGFVDGAPITANNIDRLSQHFPLCMRSLHMNLRKNNHLKHYGRLQYTLFLKGIGLSL
FT                   EECIVFWRQGFKGLTDDEFNSRYKYNIRHAYGDVGGDQNRRGRGYPPYSCQKILGDSNP
FT                   GVGQTHGCPYRHFSVDNLIGLLQSTGVNDRDVLRGVREDVEKMRFHIACNRVFEHTHKA
FT                   DIKRVKEDGTWNQTDLDTIVHPNTYFKRSYLLKQMGKAPKNA"
     atgatccggc aagacttccg cagaattgac ccgaagagaa gggcaaccct cgaccacaaa        60
     aagaaacaat tcgcgacccc ggtcttcaag caacaggact atccgcatcg cttaaacttc       120
     tatgaggtcc ccccgaccga cgagatcact ctcgaacaat ttgagcaatg ggctattgat       180
     cgattgaaag tcttggctga gattgaagcc tgttcttatc gaaacaagtc gccggcagag       240
     accgaagcgc atatcactcc tcacctccag aaatatctcc ctctatcctc caacacatcc       300
     tcctctaacg gcgctgcgga tcaacgattg aagaatgaac gccagaaaga tcactattct       360
     cactttattc tacgcctggc attctcggcc acagaggaac tccgtcggcg tttcgtgaga       420
     gcagagacta tgcttttcag gttccgcttc caacgcgacg acaccagaga acgccgcgcc       480
     ttcatcgaga gccttaatct ggactgggag cctgtggatg atgaggaaaa acagagactg       540
     gcggaacaat tactcgccgc ttccccgggt ctacgtcgca ttgatgatga gacctggtac       600
     aaggtggact gggagaaagt cccggagttg gtagagagac gggctgtttt cctatccaag       660
     gggaaagcat atgtgcccgg tagggagcaa ttgagcatga tcatagcaga atttacggct       720
     cgattggagc gcgctcttga gctcacaagt cgggcgttgc cgcgcttgga tgaagatgat       780
     cgcctcactc caattttgaa tcacctctcg aagaactttg gaagtgccga gtcggtatac       840
     acggaaaacg agggatttgt tgatggcgcc ccgatcactg cgaacaacat cgatcgacta       900
     tctcagcatt tcccactatg catgcgcagt cttcacatga acctacgcaa gaacaaccac       960
     ttgaagcact acggacgact gcaatatacc ctcttcctca aaggaattgg gctgtcgctg      1020
     gaagagtgca ttgttttctg gcgccaaggc ttcaaagggc tcactgacga cgaattcaac      1080
     tcgcggtaca agtacaatat ccgccacgct tacggcgatg tgggcggtga tcagaaccgc      1140
     agaggccggg gataccctcc gtactcctgc cagaagatct tgggtgactc gaatccggga      1200
     gtcggacaga cccatggctg tccgtaccgc cacttctctg tcgataactt gatcggtctt      1260
     cttcagtcca caggagtcaa tgacagagac gtcctacgtg gagtgcgaga ggatgttgag      1320
     aagatgcgtt tccatattgc ttgcaacagg gtcttcgaac atacccacaa agcagatatc      1380
     aagagagtga aggaagacgg tacatggaac caaactgacc tcgacaccat cgtgcacccc      1440
     aatacctact tcaagcgcag ctatctcttg aagcaaatgg ggaaggcacc aaagaatgcc      1500
     taa                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page