(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE453

ASPNC_1.PE453        Location/Qualifiers
FT   CDS_pept        join(complement(1128697..1128869),
FT                   complement(1128589..1128655))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654551"
FT                   /orf_name="An01g04750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37010.1"
FT                   /db_xref="UniParc:UPI0000EF9ED9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L3"
FT                   /transl_table=1
FT                   /translation="MRIHRREAETSGHKPKASIILQPWRHPEAEKKIPTKTHAASDQVE
FT                   KMAESLPLDKYLRARCRYKRDDCQWDSDRLPSLL"
     atgcgtatac atcgccgcga ggctgagaca tctggccaca agcccaaggc cagcatcatt        60
     ctgcagccct ggaggcatcc agaggctgaa aagaaaatcc caactaagac gcatgccgcg       120
     tccgatcagg tggaaaagat ggccgaatca ttgccactgg ataaatatct cagagcgcgg       180
     tgccgttata aaagagatga ctgtcaatgg gattctgata ggttgccttc tctcttgtga       240
//

If you have problems or comments...

PBIL Back to PBIL home page