(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE455

ASPNC_1.PE455        Location/Qualifiers
FT   CDS_pept        complement(1137725..1139395)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878881"
FT                   /orf_name="An01g04770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37012.1"
FT                   /db_xref="UniParc:UPI0000EF9EDB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L5"
FT                   /transl_table=1
FT                   /translation="MAEQFNKLVDTIGGLSLADRSTSHCSNPTQTLVKTIWELVKSCQS
FT                   TSANAAHVGTVIEGTQTPSGQDIARLSSLRKEAVALEQITKNLSDATENYIIAYIISLA
FT                   GPWTLEQKMLLHFSDEVRRIIRNVLDDANTDDCSVVRKILENCYDQSLRASGTLHPAEY
FT                   FDSLEEASLEEPYDPDFESEEYYEHENRLAIDDSYAETLRVQCERRAEREQQQREEWIG
FT                   FWVRALGQCPDEPTTLFYSPANSLLNSHLAEVPRYLFRAFDDASSGWSDNHIVASAESR
FT                   AAISERSRTDLLSRSRGEITRMLYSHLKKSLFGAEDTDNLMSWSSSLMFVIQYAIWRCN
FT                   KRRCDPSEVKICMVDTRKFPRGQFARDKSLLRAYRDAPELDENRRRFFDFRLEDPYYDN
FT                   GEYLSQGVLHHAGRSSVVSLEQLIHAGLYDLYPEFRDPASRNLWTNRVGSLRLAWSNEH
FT                   TTTQLDIRSAVKVARECFNNYFNALDIALVLLSFKERKLRTPATKAPQQQRNSHDFGPV
FT                   EVQRYTTIIEDMMAKARGIPIALRGFTADSQLEEIFECS"
     atggctgaac agttcaacaa gcttgttgat acaatcggtg gattgagcct tgccgataga        60
     tcaacctctc actgctcgaa cccaactcaa accctcgtga agacgatttg ggagctggta       120
     aaatcgtgcc aatccacttc agcaaacgca gcacatgttg ggaccgtgat cgaaggcaca       180
     cagaccccta gcggccagga tattgcaaga ctgagctcct tgagaaaaga agccgttgcc       240
     ctcgagcaga tcacgaagaa cctcagcgat gccactgaga attacatcat agcgtacatt       300
     atatcgctgg ctggtccatg gacgctggag cagaaaatgt tactgcattt tagtgatgaa       360
     gtgaggcgca tcattcgcaa tgtgcttgac gatgccaaca ccgacgactg cagcgttgtg       420
     cgaaagattt tggaaaactg ctatgaccag tctcttcgtg cctctgggac tctgcacccc       480
     gctgagtact ttgattctct agaggaagct agtctcgaag agccgtatga tcctgacttc       540
     gaaagcgagg aatactacga gcatgaaaat cgacttgcta tcgacgatag ctatgctgag       600
     accttgcgcg tgcaatgcga gcgcagagct gagagagagc agcagcaaag ggaagaatgg       660
     atcgggtttt gggttcgtgc actgggtcaa tgtcctgatg agcccaccac gctattctat       720
     tcgccagcaa atagtcttct caattctcat ctggcagagg taccgcgata cttgtttcga       780
     gcgtttgacg acgcaagctc tggctggagt gacaaccata ttgtagcttc tgctgagagc       840
     cgagccgcaa tatcagagcg cagcagaaca gatctcctct cgcggtcgag aggggaaata       900
     acacgaatgc tatacagtca tctcaaaaaa tctttgtttg gagctgagga caccgacaac       960
     ttaatgtcgt ggagtagttc tttgatgttt gtcattcaat acgcgatttg gagatgcaac      1020
     aaacgtcggt gtgacccctc cgaggtcaaa atatgcatgg ttgacacgag gaagttccct      1080
     cgtggacagt tcgcccggga caagtcgcta cttcgggcgt atcgtgatgc tcctgaactt      1140
     gatgagaata ggcggaggtt ctttgatttt cgtttagagg acccatatta tgacaatgga      1200
     gagtatctgt cgcaaggggt attgcatcat gctgggcggt ctagtgtggt gtctctggaa      1260
     cagctcattc acgcgggatt atatgatctt tatcctgaat ttcgggatcc tgcttcgagg      1320
     aacttatgga cgaaccgtgt tgggtctctt cgtttagcat ggtccaatga gcatacaaca      1380
     acccagcttg acatacgaag tgcagtcaaa gtggccagag agtgcttcaa taattatttc      1440
     aatgcgcttg atatagcatt ggtgctatta tcattcaaag agcgcaagct ccgcacccca      1500
     gcaacaaaag caccccagca gcagagaaac tcccatgact ttggtccagt cgaggttcaa      1560
     cgatacacga caataataga agatatgatg gcgaaagccc gaggcattcc gattgcttta      1620
     cgagggttca cagcggacag ccagcttgaa gaaattttcg aatgctcata g               1671
//

If you have problems or comments...

PBIL Back to PBIL home page