(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE459

ASPNC_1.PE459        Location/Qualifiers
FT   CDS_pept        join(1146084..1146163,1146248..1146355,1146470..1146570,
FT                   1146991..1147190,1147272..1147322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960444"
FT                   /orf_name="An01g04820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37016.1"
FT                   /db_xref="UniParc:UPI0000EF9EDF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L9"
FT                   /transl_table=1
FT                   /translation="MVDGAELSYFAPLSPPRPIRIYAHTNAPSPRGLAGTPYVEGVCAL
FT                   GAVPGRIAYLVGGPPPPFIPGGTHPVDKYLSMVSESWCALAESQSHSNWESGGYPNPNL
FT                   AKSIIDHPLTSHTEILRHPIMWWESAQISTSRLCCANLVLLVASGSTLFQGGGVAAFSL
FT                   VGGVVVVVMTLPYYWG"
     atggtggatg gagctgagct gagctacttc gcccccctct ctcctcctcg cccaatacgg        60
     atttacgccc atacaaacgc cccatctcca cgtggtttag caggaactcc ttacgtagaa       120
     ggggtttgtg cattgggcgc tgtccctggt cgtattgcgt atttggttgg cggccctcct       180
     ccccccttta taccgggagg gacccaccca gttgacaaat acttgtcaat ggtgtcggaa       240
     agctggtgtg ccttggctga atcgcagtcg cactcaaatt gggaaagtgg cgggtaccct       300
     aatcctaacc tggccaagtc gatcatcgat cacccactca cctcccacac cgagatcctc       360
     cgacatccaa tcatgtggtg ggaatcggct caaatctcaa cgtcgagact gtgctgcgct       420
     aacttagttc tgctggtggc cagtggttcc actctgttcc aggggggtgg tgtcgctgcc       480
     tttagtctag tcggcggcgt cgtcgtcgtc gtcatgaccc tgccgtacta ttggggttaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page