(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE462

ASPNC_1.PE462        Location/Qualifiers
FT   CDS_pept        join(1158507..1158636,1158818..1159055,1159108..1159197,
FT                   1159297..1159360)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111332"
FT                   /orf_name="An01g04850"
FT                   /product="Similarity to hypothetical protein BAB09566.1 -
FT                   Arabidopsis thaliana"
FT                   /protein_id="CAK37019.1"
FT                   /db_xref="UniParc:UPI0000EF9EE2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M2"
FT                   /transl_table=1
FT                   /translation="MQQKYDRSHGILRFPLFGIAHQCGRVAFCLFIGCSPGAWPSQPAI
FT                   QSKVLVSSPRRYRPAVILSGGNGWGQLEKLKLTILDYGITSTIRLPSIHQNLALGAICS
FT                   IGYNVAAIGRSRLITLCSIGVGTGKGGNNKLRQMFKTIGSRSSCSHLCRSPPPSIGVSE
FT                   KIFQASIFPA"
     atgcaacaga agtatgatag atctcatgga atcctcaggt tccccctttt cgggattgcc        60
     catcaatgtg gcagagtggc cttctgcctc ttcattggct gttcgcctgg agcatggccc       120
     tcccagccag ccatacagag taaagtgctc gtcagctcac cgcgccggta ccgtcccgct       180
     gtcatactaa gcggtgggaa tggatggggt caactcgaga agctaaagtt aaccatccta       240
     gactatggga ttactagtac tattcgcctg ccatccatcc accaaaacct tgccctcgga       300
     gctatttgtt cgatcggata caacgttgct gcgattgggc gatctaggct gatcactctg       360
     tgctcgattg gtgtgggaac tgggaagggg gggaacaata aacttcgtca aatgttcaag       420
     acgatcggat ccagatcatc gtgcagtcat ctctgcaggt caccaccacc ctccatcggc       480
     gtctccgaga aaatcttcca ggcttctatt ttccctgcct ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page