(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE467

ASPNC_1.PE467        Location/Qualifiers
FT   CDS_pept        join(1170822..1170965,1171038..1172321)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212188" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654555"
FT                   /orf_name="An01g04900"
FT                   /product="Similarity to hypothetical protein CAC18296.1 -
FT                   Neurospora crassa"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK37024.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG329984"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR019416"
FT                   /db_xref="UniParc:UPI0000EF9EE7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M7"
FT                   /transl_table=1
FT                   /translation="MEVASAQQPSLQLDASNAAPVADTMDASMDIDMDIDLGPLPEAEP
FT                   IETEQTLVATTAVQDGSIDPLNEEAQYEKVHIRGVDELTTDNIKQFAVEHFALEEPSRV
FT                   EWIDDTSANILYSSPEVGLQALSAFTQVSEEEDASALPALRLRSAKLLSTHPDSVLQVR
FT                   SAVKADRKKPRAHEASRFYLMHPEHDPRERLRREFADRRRSGGGDVSDGDYRRRRFDGR
FT                   ELQRRRDRDAGESFSANMYDDTVPASRDRSSDRSRERRGRRGGRDLFPQEEGRLSGRLR
FT                   NRSASPGRDTLMEGGYAEDDRQDRRRFRDRSPQLGRRNEGKELFPSSGAKSSDANAREL
FT                   FPNRTAKELFPQKVSNHRRSDAIDGADETADLFSRRISVPLVDGSQDQQPARRKRDIEL
FT                   FPETTETSGLNIRGAARQDQGMSIRGAANGISIKGRGASVRELFPNKYGSNAGKELFSD
FT                   KIEGRGGPRRRAEDMFS"
     atggaggtag ctagcgcgca acagccttct cttcaactag acgcctccaa cgctgccccg        60
     gttgctgaca caatggacgc ctccatggat attgacatgg acattgatct tggacccctt       120
     ccagaagcag aaccaattga gactgaacaa actctcgtgg caacgactgc tgttcaagat       180
     ggatccatcg accctcttaa tgaggaggca cagtatgaaa aggttcatat acgcggtgta       240
     gatgagttga cgacagacaa catcaaacaa ttcgctgtcg aacacttcgc ccttgaggag       300
     ccaagccgcg ttgaatggat cgatgacaca tcagcgaaca tcctatactc ttcgccggag       360
     gttggtcttc aagctctgtc agcatttacg caggttagcg aggaggagga tgcatccgcg       420
     ttgcctgctc tacggttgcg atccgcgaag ctcctctcta cccaccccga ctctgtgctc       480
     caggttaggt cagctgtcaa agcggatcgc aaaaagcctc gtgcgcacga agccagtcgg       540
     ttttacctca tgcaccctga acatgaccct cgggaacgct tgcgacgaga atttgcagat       600
     aggcgacgct cgggaggtgg agacgtcagt gacggggatt atagacgaag acggtttgat       660
     ggtcgagaac tgcaacgtcg gagagaccgt gatgcaggcg agagcttcag tgccaatatg       720
     tatgatgaca cggtgcctgc cagccgcgac cgctcgtcgg accgcagtcg cgaaaggcgg       780
     ggaagacgag gggggcgcga tctattccca caggaagaag gacgattgtc tggtcgcctt       840
     cgcaaccgta gcgcgtcacc cggtcgagat acactgatgg aaggcgggta tgctgaggac       900
     gatcggcagg atcgcagacg gttccgcgac cggtcgcccc agctcggtcg ccgcaatgaa       960
     ggcaaggagc tcttcccatc ctcgggagcc aaaagcagcg atgcaaatgc gcgggagctc      1020
     ttcccgaacc gaacagccaa ggaactcttt cctcaaaaag ttagcaatca tcgccgttca      1080
     gacgcgatcg atggcgcaga tgagacggca gatctcttct cgcggaggat ttcagtgcct      1140
     cttgttgatg gcagccaaga ccaacaacct gcgcgccgaa agcgcgacat tgagcttttc      1200
     cctgagacga ccgagacaag cggtctcaac atccgcgggg cagcaaggca ggatcaggga      1260
     atgtcgattc gtggtgcggc aaatggcatc tcaatcaaag gacggggcgc gtctgttcgt      1320
     gaactgttcc ctaataaata cggttccaac gcaggcaagg agttgttttc cgataagatt      1380
     gaggggcgag gaggaccacg acgcagggcg gaggacatgt ttagctga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page