(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE469

ASPNC_1.PE469        Location/Qualifiers
FT   CDS_pept        join(complement(1175510..1175516),
FT                   complement(1175323..1175374),complement(1174943..1175045),
FT                   complement(1174834..1174869))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960446"
FT                   /orf_name="An01g04920"
FT                   /product="Complex: S. cerevisiae L29 is part of the 60S
FT                   subunit of the ribosome"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK37026.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG627477"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniParc:UPI0000EF9EE9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M9"
FT                   /transl_table=1
FT                   /translation="MAKSKNASQHHNSQKAHRNGIKKPKTHRYPSLKGVDPKFRRNHRH
FT                   ALHGTAKALKERKEGKREIA"
     atggcgaagt ccaagaacgc gtctcagcac cacaacagcc agaaggctca ccgtaacggt        60
     atcaagaagc ccaagaccca ccgttacccc tccctcaagg gtgtcgaccc caagttccgc       120
     cgcaaccaca gacacgccct tcacggaacc gctaaggctc tgaaggagcg caaggagggc       180
     aagcgcgaga tcgcataa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page