(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE470

ASPNC_1.PE470        Location/Qualifiers
FT   CDS_pept        join(1176609..1176740,1176817..1176839,1176932..1177062,
FT                   1177173..1177261,1177326..1177415,1177471..1177503)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216023" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878886"
FT                   /orf_name="An01g04930"
FT                   /EC_number="3.6.3.14"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAK37027.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG663981"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="UniParc:UPI0000EF9EEA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N0"
FT                   /transl_table=1
FT                   /translation="MSSLRFARSAFRARPSALRVPLQRRGYAEAVSDKIKLSLTLPHQS
FT                   IFKSTGVVQVNIPAESGEMGVLANHVPSIEQLKPGLVEIVEEGGASKKFFLSGGFAVVQ
FT                   PDSQLSINAVEGFPLEEFSIDNVRSQIAEAQKIANGSGSEQDIAEAKIELEVLESLQAV
FT                   LK"
     atgagctctc tccgcttcgc tcgctctgcc ttcagggccc gtccctccgc tctccgcgtt        60
     cctctccagc gcagaggtta cgccgaggct gtgtcggaca agatcaagct ttccctgacc       120
     cttcctcacc agtctatctt caagtcgacc ggcgttgtcc aggtcaacat ccccgccgaa       180
     tccggagaga tgggtgttct cgccaaccac gtcccctcca ttgagcagct caagcccggt       240
     ctcgttgaga tcgttgagga gggtggtgcc agcaagaagt tcttcctgtc tggtggtttc       300
     gccgttgtcc agcccgactc ccagctgagc atcaacgccg tcgagggttt ccctctcgag       360
     gaattcagca ttgacaacgt ccgttcccag atcgccgagg cccagaagat tgccaacgga       420
     agcggcagcg agcaggatat tgctgaggcc aagattgagc ttgaggtgct ggagagcctg       480
     caggccgtcc tcaaatag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page