(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE50

ASPNC_1.PE50         Location/Qualifiers
FT   CDS_pept        join(complement(141971..142179),complement(141666..141888))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874705"
FT                   /orf_name="An01g00560"
FT                   /product="Function: Sec11 from S. cerevisiae is a subunit
FT                   of the microsomal signal peptidase "
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43444.1"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG564658"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI0000EF9F42"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G0"
FT                   /transl_table=1
FT                   /translation="MWKGLSVLTNSPSPIVVVLSGSMEPAFQRGDLLFLRNTQPTLNVG
FT                   EIVVYQVKDKDIPIVHRVVRQFGEGSEAKLLTKGDNNIADDTELYARGQDYLDRDDVVG
FT                   SVFGYIPFVGYVTILLSEHPWLKTAMLGVMGLLVLLQRE"
     atgtggaaag gcctctcggt cctcacaaac tcccccagcc cgatagtagt cgtcctcagt        60
     ggctccatgg agcccgcttt ccagcgcgga gatctcctct tcctccggaa tacgcaacct       120
     acactgaacg tcggagagat cgtggtgtat caggtgaagg ataaggatat cccgattgtg       180
     catagagtgg tgaggcagtt tggtgaggga tccgaagcca aactcctcac gaaaggcgac       240
     aacaatatcg cggatgatac ggaactctat gcgcgcggac aagattacct tgatcgggac       300
     gatgttgtgg gaagcgtgtt tgggtacatt ccattcgtgg ggtacgtgac gattcttctg       360
     tcggagcatc cgtggttgaa gacggccatg ttgggggtta tggggttgtt ggtgcttttg       420
     caaagggaat aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page