(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE51

ASPNC_1.PE51         Location/Qualifiers
FT   CDS_pept        complement(142634..143836)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653515"
FT                   /orf_name="An01g00570"
FT                   /product="Similarity to hypothetical protein -Campylobacter
FT                   jejuni"
FT                   /protein_id="CAK43445.1"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="UniParc:UPI0000EF9F43"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G1"
FT                   /transl_table=1
FT                   /translation="MEYPSKQYPVPAGVHIIPEHLLDLRPDSEVDYDLLHPRPVTDEKN
FT                   IWLFWHSGYSTMHPYTKRNVRAWHRRFSKAGWIVRVVDRHPSSPLNIANFIDVNDSNNF
FT                   PQAFAEGTISGTYAKQHTSDLVRLPLLLKYGGIYADVGLIQIGDVDRLWRETVGNPDSR
FT                   FEVLSYNAGDVDERSLTNYFLMSRRDNPLFKRCHRLLLKLWEGNTSTEGMHQSPLLKDL
FT                   PLLTGTGNMTEQQCRELTDYIIQGQVMTLVMGLVDKEDNWDGPKYVAEHVYGIEFMQGS
FT                   QLINDMTAWDGRKAFELMSLSLPKEGEEETAEQKQAREIVEACLKKSFGFKLAHGYILE
FT                   VMNVTLGSLWREHEGSDNVPGTYAHWLRHAIVHWSQDALPPTQPYTALEPIKRGPLLRA
FT                   E"
     atggaatatc ccagcaaaca ataccccgta ccagcagggg tacacataat cccagaacac        60
     ctcctggacc tccgcccaga ctccgaagtc gactatgacc tcctccaccc ccgacccgtc       120
     acagacgaga agaacatttg gcttttctgg cacagcggct actccaccat gcacccatat       180
     accaagcgaa acgtgcgcgc atggcaccgg cgcttctcca aagccggatg gattgtgcgt       240
     gtcgtcgacc gccatccgtc ctccccgctc aacatagcca actttatcga cgtcaatgat       300
     tcgaacaact ttcctcaagc attcgccgaa ggcaccatca gtggcactta cgcaaagcag       360
     cacacatccg atctcgttcg cttacctcta cttctcaagt acggtggtat ctatgccgac       420
     gttggactaa tccagatcgg cgacgtggat cgactgtggc gcgagacggt cggaaatccc       480
     gactcgcggt tcgaggttct ctcctacaat gctggcgatg tcgacgagcg cagtctcacc       540
     aactactttc tcatgtcgag gcgtgataat ccgctattca agcgatgcca ccgtctactg       600
     ttgaagttat gggagggaaa tacgagtacg gaaggaatgc atcaaagccc gctgttgaag       660
     gatttgccgc tcctcactgg aaccggtaat atgacagagc agcagtgcag agagctgacg       720
     gactatatta tccaggggca ggtgatgact ctggttatgg ggttagtgga taaagaagat       780
     aactgggatg gaccgaaata tgtcgcggaa catgtctatg gcattgagtt catgcaggga       840
     tcgcagctga tcaatgacat gactgcatgg gacggtcgga aggcgtttga gctcatgtca       900
     ttgtcccttc ccaaggaggg cgaggaggaa accgcagagc agaagcaggc tagggagatc       960
     gtcgaggctt gcctgaagaa aagtttcggg ttcaagctcg cgcacggata tattttggag      1020
     gtaatgaatg tgacactcgg gtcgctgtgg agggaacatg agggatcaga taatgtgccc      1080
     gggacgtatg cgcattggct caggcatgca atcgtgcact ggagtcagga tgcgcttccg      1140
     ccgacacagc cgtacacggc acttgagccg attaagaggg gaccgctatt gcgggcagag      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page