(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE53

ASPNC_1.PE53         Location/Qualifiers
FT   CDS_pept        join(149971..150650,150735..150783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234452" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874706"
FT                   /orf_name="An01g00610"
FT                   /product="Similarity to hypothetical protein BAC69773.1 -
FT                   Streptomyces avermitilis"
FT                   /protein_id="CAK43447.1"
FT                   /db_xref="HOGENOM:HBG654853"
FT                   /db_xref="InterPro:IPR019268"
FT                   /db_xref="UniParc:UPI0000EF9F45"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G3"
FT                   /transl_table=1
FT                   /translation="MTIPHYGVWIAQPTRYTAQTEEEDPKSPHIYLYFKDDSSSSKDYE
FT                   AAINVKSTGKDSRLVYWFDRSFSHPITEQLSNLDEGFHLLKSYSHRSRRHQESSSKLKG
FT                   LDFIRTKGLVNIESGAVLSEADTGPHNAVLEALEPILNDAISKKATVYIFGSSYGSGIH
FT                   DVHMNQGSAPSYENGIYEDGALLFSFGDGHWEAVFLAFASQEIPTDDKGEPEEGSKTLA
FT                   SILGQMLLREAVTFGTRFIA"
     atgaccatcc ctcactacgg cgtctggatc gcccaaccaa cccgctacac cgcccaaacc        60
     gaagaagaag atcccaagtc ccctcacatc tacctctact tcaaagacga ttcctcctcc       120
     agcaaggact acgaagccgc catcaacgtc aaatccaccg gcaaagactc tcgtctcgta       180
     tactggttcg accggagctt cagccacccg atcaccgagc agctttctaa tctcgatgag       240
     ggcttccacc tcctcaaatc ctattcccac cgcagtcgtc gacaccaaga atcctcctcc       300
     aagctgaagg gcttggactt catccgcaca aagggtcttg tgaatatcga gtcgggtgcg       360
     gtcctctctg aggccgacac cgggccgcac aatgctgtgc tcgaggcatt ggagcctatt       420
     ctcaatgatg cgatcagtaa gaaagcaacg gtgtatatct ttgggtcgtc gtatgggtca       480
     gggatccatg atgttcatat gaatcagggg agtgcgccgt catatgagaa tggaatttat       540
     gaggatgggg cgttgttgtt tagtttcggg gatgggcatt gggaggcggt gtttttggcg       600
     tttgcgtcgc aggagattcc gacggatgat aagggggagc ccgaggaggg gagtaagact       660
     ttggctagta ttctgggtca aatgttactg cgagaggcag tgacattcgg tactaggttc       720
     attgcctaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page