(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE58

ASPNC_1.PE58         Location/Qualifiers
FT   CDS_pept        join(159669..160056,160111..160430,160569..160748,
FT                   160813..160857)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110318"
FT                   /orf_name="An01g00660"
FT                   /product="Similarity to hypothetical protein rfeF -
FT                   Aspergillus nidulans"
FT                   /protein_id="CAK32610.1"
FT                   /db_xref="HOGENOM:HBG330065"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniParc:UPI0000EF9F4A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G8"
FT                   /transl_table=1
FT                   /translation="MDPEWGDESEASTVGDEQEDTINEIVAEVIDQFLTEFSRQLGIRQ
FT                   PEDSSPPRSLEPKVPETEEEYREYVWSYIENKLRSYYQPGDQYVEEIVKSAAVRARSLT
FT                   QKYELKAETTPKLAIMALYDFVILCDDSKSMRKDRGTRIRALEETCQRVAEIASAVHEQ
FT                   DVYLRFLNNAEDRHLNKLSPNEIQGQMKKIKYSGLTRLGTVLRTKIVEPLIYDPVINGL
FT                   SAKPVITIVVTDGRPAGAVFLISRVGNDANAETFLSNLKMNEELQEMLYCCQDQLDERR
FT                   EVFRRAGKDGRYSSYLIELFVAALDSQAR"
     atggatccgg aatggggcga tgagtctgaa gcctcaactg tcggcgacga gcaggaggat        60
     actatcaatg agattgtcgc cgaagttatc gatcagtttc tcacggaatt tagccgacaa       120
     ctcgggattc gacaaccgga agactcgtca ccgccacgtt cattggagcc caaggtgccc       180
     gagactgagg aagagtatcg agaatatgtc tggagttaca ttgagaataa actccgttcg       240
     tattatcaac cgggtgacca atacgtggaa gagatagtga aaagtgcagc tgtccgcgcc       300
     aggagtctca cacagaagta tgagttgaaa gctgaaacca cgccaaagtt ggccattatg       360
     gccttatatg actttgtgat actttgcgac gatagcaagt cgatgagaaa agacaggggc       420
     actcgcatac gggctctcga agaaacttgt caacgtgttg ctgaaatcgc tagcgctgta       480
     cacgaacagg acgtgtatct ccggtttcta aacaatgcag aagatcggca tttaaacaag       540
     ttgtctccta atgagatcca aggtcaaatg aagaagataa agtattctgg gttgaccaga       600
     ctgggaactg tgctcagaac caaaatcgtt gagcctctca tttacgatcc tgtgataaat       660
     ggcctgtctg cgaagccagt gattactatt gtcgtaaccg atggacgtcc agctggtgcg       720
     gtgtttctca tctcccgagt tggcaatgat gccaatgcag agacattcct gagtaatctc       780
     aagatgaatg aggaactaca agagatgctc tattgttgcc aggaccagct ggatgagcga       840
     cgggaagtat tccgtagagc tggcaaagat ggtcgatact cttcgtatct tattgaatta       900
     tttgtcgccg cactagatag ccaggctaga tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page