(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE6

ASPNC_1.PE6          Location/Qualifiers
FT   CDS_pept        join(12561..13089,13163..18111,18171..18281)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959384"
FT                   /orf_name="An01g00060"
FT                   /product="Catalytic activity: Acetyl-CoA + n Malonyl-CoA +
FT                   2n NADPH "
FT                   /function="fatty-acyl-CoA synthase activity"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK36857.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004321"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG325769"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR021186"
FT                   /db_xref="UniParc:UPI0000EF9EBD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B6"
FT                   /transl_table=1
FT                   /translation="MRPEIEQELAHTLLVELLAYQFASPVRWIETQDVILAEKRTERIV
FT                   EIGPADTLGGMARRTLASKYEAYDAATSVQRQILCYNKDAKEIYYDVDPVEEEEAQPSA
FT                   EAAASAPAAAPAGAPAVAAAPAAAPPPSAGPAAAIEDAPVTAVDVLRTLVAQKLKKSLS
FT                   DVPLSKAIKDLVGGKSTLQNEILGDLGKEFGSTPEKPEDTPLDELGASMQATFNGQLGK
FT                   QSSSLIARLVSSKMPGGFNITAVRKYLETRWGLGSGRQDGVLLLALTMEPPSRIGSEAE
FT                   AKSYLDDVANKYAASAGISLSAPAAGGDSGAGGGGMLMDPAAIDALTKDQRALFKQQLE
FT                   IIARYLKMDLRAGQKAYITSQESQKTLQAQLDLWQAEHGDFYASGIEPAFDALKARVYD
FT                   SSWNWARQDALSMYYDIIFGRLKVVDREIVSQCIRIMNRSNPLLLEFMQYHIDNCPTDR
FT                   GETYQLAKELGEQLIENCKEVLGVAPVYKDVAVPTGPQTTVDARGNIGYKEVPRASARK
FT                   LEHYVKQMAEGGPISEYSNRTKVQNDLRSVYKLIRRQHRLSKSSQLQFNALYKEVIRAL
FT                   SMNENQIMPQENGSGKKTGRNGVKRNGSPRAGKVETIPFLHLKKKSEHGWDYNKKLTGI
FT                   YLDVLESAARSGLTFQGKNVLMTGAGAGSIGAEVLQGLISGGAKVVVTTSRYSREVTEY
FT                   YQAMYARYGGRGSQLVVVPFNQGSKQDVEALVDYIYDSKKGLGWDLDFVVPFAAIPENG
FT                   REIDSIDSKSELAHRIMLTNLLRLLGCIKTQKQSNGFETRPAQVILPLSPNHGTFGNDG
FT                   LYSESKLALETLFNRWYSENWNNYLTICGAVIGWTRGTGLMSGNNMVAEGVEKLGVRTF
FT                   SQQEMAFNLLGLMAPAIVNLCQLDPVWADLNGGLQFIPDLKDLMTKLRTEIMETSDVRQ
FT                   AVIKETAIENKVVNGEDSEVLYKRVIAEPRANIKFQFPNLPNWEEDVKPLNDNLKGMVN
FT                   LDKVVVVTGFSEVGPWGNSRTRWEMEAYGKFSLEGCVEMAWIMGLIKHHNGPLKGKAYS
FT                   GWVDAKSGEPVDDKDVKPKYEKFILEHSGIRLIEPELFKGYDPKKKQLLQEIVIQEDLD
FT                   PFEASKETAEEFKREHGEKVEIFELPESGEYTVRLKKGATLLIPKALQFDRLVAGQIPT
FT                   GWDAKRYGIPDDIIEQVDPVTLFVLVCTAESLLSAGITDPYEFYKYVHLSEVGNCIGSG
FT                   IGGTHALRGMYKDRYLDKPLQKDILQESFINTMSAWVNMLLLSSTGPIKTPVGACATAV
FT                   ESVDIGYETIVEGKARVCFVGGFDDFQEEGSYEFANMKATSNAEDEFAHGRTPQEMSRP
FT                   TTTTRAGFMESQGCGMQLIMSAQLALDMGVPIYGIIALTTTATDKIGRSVPAPGQGVLT
FT                   TARENPGKFPSPLLDIKYRRRQLDLRKKQIKEWQESELLYLQEEAEAMKAQASDDSFDV
FT                   SGYLQERAQHIEREAIRQEKDAQYSLGNNFWKQDSRIAPLRGALATWGLTVDDIGVASF
FT                   HGTSTVANDKNESDVICQQMKHLGRKKGNALLGIFQKYLTGHPKGAAGAWMFNGCLQVL
FT                   ESGLVPGNRNADNVDKVMEKFDYIVYPSRSIQTDGINAFSVTSFGFGQKGAQVIGIHPK
FT                   YLYATLDRAQYQTYKAKVEARQKKAYRFFHNGLINNSIFVAKDKAPYEDAQQSKVFLNP
FT                   DYRVAADKKTSQLKFPAQPPKANDKGLESTKTMIESLAKANASEDSKVGVDVENIESFN
FT                   IENETFIERNFTASEQEYCQKAASPRSSFAGRWSAKEAVFKALGVSSKGAGAPLKDIEI
FT                   SSDSTGAPVVNLHGAAAEAAKQAGVKQVSVSISHSDTQAVAVAVSKF"
     atgcggcccg aaatcgagca ggagctggct cacactttgc tggttgaact tctggcctat        60
     cagtttgctt caccagtgag atggattgag acccaggatg ttatactcgc agagaagagg       120
     acagagcgaa ttgtggaaat cggtcccgca gacacgttgg gtggcatggc gagacggacc       180
     ctcgcatcaa aatatgaggc atacgatgct gctacttccg tgcagcgtca aatactttgc       240
     tacaacaagg atgcaaagga gatctattat gatgtcgatc ccgtagagga ggaagaagcg       300
     caaccatcgg cagaggctgc ggccagtgcc cctgctgctg cccctgctgg tgctcctgcc       360
     gtcgcagctg ctcccgcagc tgctcctcca cctagtgccg gccctgcagc agcaatcgag       420
     gacgcaccgg ttacggctgt ggatgtgctg aggactctgg tcgcgcagaa gttgaagaag       480
     agcttgtccg atgtgccctt gagtaaagcc atcaaagatc tggttggcgg taaatccact       540
     ctgcagaacg agattctagg agatctcgga aaggaattcg gttcgacacc cgagaaaccg       600
     gaagacacac ctctagacga gctaggcgca tctatgcagg cgacattcaa tggacaactt       660
     ggcaagcagt cttcatccct tattgctcgt ctggtctcgt cgaagatgcc cggtggcttc       720
     aacattaccg cagttcgcaa ataccttgag acgagatggg gtttgggatc tggtcgtcaa       780
     gatggcgtcc ttctccttgc tctcaccatg gagccaccct cccgtattgg ctctgaggct       840
     gaggccaagt cgtacctcga tgatgttgcc aacaaatacg ctgccagcgc gggcatcagc       900
     ctctcggcac cggcagctgg tggtgatagc ggggcaggtg gtggcggcat gctcatggat       960
     ccggctgcga ttgatgcctt gaccaaggac cagcgggcat tgttcaagca gcagctggag      1020
     ataattgcgc gttacttgaa gatggaccta cgcgctggtc aaaaggctta catcacttcc      1080
     caggagtctc agaaaacatt gcaagcacag ctggaccttt ggcaagctga gcatggcgat      1140
     ttctatgcct ctggtatcga gccggctttc gatgccctga aagcacgcgt gtatgattct      1200
     tcctggaatt gggcacgcca ggatgctttg agcatgtact acgacattat tttcggcaga      1260
     ctcaaagttg tggatcgtga aattgtgagc cagtgtattc gtattatgaa ccgttcaaac      1320
     ccactgcttc ttgagttcat gcagtaccac attgacaact gccctaccga taggggcgag      1380
     acatatcagt tggccaagga acttggtgag cagcttatcg aaaactgcaa ggaagtcttg      1440
     ggtgtcgccc ctgtgtacaa ggatgtcgcc gtgcctaccg gaccccagac tactgtcgat      1500
     gccagaggaa acatcgggta caaggaggtt ccccgggcta gcgctcgcaa gttggaacac      1560
     tacgtgaagc aaatggcgga gggtggcccc atctctgagt acagcaaccg cacgaaggtt      1620
     cagaatgatc ttcgcagcgt ctacaagttg atccgcagac agcatcgctt gtccaagtcg      1680
     tcgcaacttc agttcaatgc tctctacaag gaagttattc gtgctctcag catgaatgag      1740
     aaccagatca tgccccaaga gaatgggtct ggcaagaaga ccggcaggaa tggtgtcaag      1800
     cgcaacggta gcccccgcgc aggcaaagtg gagaccatcc ccttcttgca tctcaagaag      1860
     aagtccgaac acggttggga ttacaacaag aaactcaccg gtatttacct ggacgtactg      1920
     gaatctgctg cacggtcagg tctcaccttc caaggcaaga acgtcttgat gactggcgca      1980
     ggcgcaggtt ccattggagc ggaagtgctg cagggcctga ttagtggtgg tgccaaggtg      2040
     gttgtcacga caagccgata ctctcgtgag gtcactgagt actaccaggc catgtatgcc      2100
     cgctatggtg gccgtggctc acagcttgtt gtggtgcctt tcaaccaagg tagcaagcaa      2160
     gatgtggaag cacttgtcga ctatatttac gactcaaaga agggtctcgg ctgggacttg      2220
     gacttcgttg ttccatttgc cgccattcct gagaatggac gtgaaatcga ctccattgac      2280
     tcgaagtctg aactggctca ccgcatcatg ttgacaaacc tcttgcgact tttgggttgt      2340
     atcaagacgc agaagcagag caacggtttt gaaacccgtc ccgctcaagt catcctcccc      2400
     ttgtctccta accatggtac attcggaaac gatggtcttt actctgagtc taagctggct      2460
     ttggaaacac tcttcaaccg ctggtattct gagaactgga acaactatct gaccatttgt      2520
     ggtgccgtaa ttgggtggac ccggggtaca ggtctcatga gcggcaacaa catggttgct      2580
     gaaggtgttg agaagctcgg tgtccggaca ttttcccagc aagagatggc tttcaacttg      2640
     cttggtctca tggcgcctgc gattgtcaat ttgtgtcagc ttgaccctgt ctgggccgac      2700
     cttaatggcg gtctccaatt catccctgat ctgaaagacc tcatgacgaa gcttcgcacg      2760
     gaaatcatgg agacaagcga tgttcgccag gcagtcatca aagagactgc aatcgaaaac      2820
     aaggtcgtca atggagagga tagtgaagtc ctctataaac gagtgattgc tgagcctcgt      2880
     gccaacatca agttccagtt ccctaatctg cctaactggg aggaagatgt gaagccgctc      2940
     aacgacaacc tgaaaggcat ggtcaacctg gacaaggtcg ttgtcgtcac cggattttcg      3000
     gaggtcggac cctggggtaa ctctcgcacg cgctgggaga tggaggctta tggcaagttc      3060
     tcccttgaag gatgtgtcga gatggcttgg atcatgggcc ttatcaagca ccacaacggt      3120
     ccattgaagg gtaaggccta ctcaggatgg gtcgacgcga agtctgggga gcctgtggat      3180
     gataaggatg tgaagccgaa gtacgagaag ttcatccttg aacattccgg tatccggctt      3240
     attgagccgg aattgttcaa gggctatgac cctaagaaga agcagctgct tcaggaaatt      3300
     gtcatccagg aagacttgga tccgtttgaa gcttcgaagg agacagcaga ggaattcaag      3360
     cgtgagcatg gcgaaaaggt ggagatcttt gaattgccgg agtctggcga gtacactgtg      3420
     cgtctgaaga agggagccac tctcttgatc ccgaaggccc ttcagttcga ccgccttgtt      3480
     gctggtcaga tccctactgg ctgggatgct aagagatacg gtattcctga cgatatcatc      3540
     gaacaagttg atccagtcac gttgttcgtc cttgtctgca ctgctgagtc tttgctttca      3600
     gctggtatta ccgatccgta tgagttctac aagtacgttc acttgtctga ggtcggaaac      3660
     tgcattggct cgggtatcgg tggtacccac gcgttgcggg gaatgtacaa ggaccgctac      3720
     ctggacaagc ctcttcagaa ggacattctg caggaatcct tcatcaacac gatgagtgcc      3780
     tgggtcaaca tgcttctctt gtcctccact ggcccgatca agactccagt tggtgcatgc      3840
     gccactgcag tcgaatctgt tgacattggt tacgagacga ttgtggaagg aaaggctcgc      3900
     gtctgctttg ttggaggatt cgatgatttc caagaagaag ggtcttatga attcgccaac      3960
     atgaaggcga ccagcaatgc cgaagatgag tttgcccatg gtcgcacccc gcaagaaatg      4020
     tcgcggccca ccactaccac tcgtgctgga tttatggagt ctcagggttg cggtatgcaa      4080
     ctcattatga gtgcccagct tgctctggac atgggtgtgc cgatctatgg tattattgct      4140
     ctgacaacca cggctactga caagatcggt cgctctgttc ccgctcccgg tcaaggagtt      4200
     cttaccaccg ctcgcgagaa ccctggcaag ttcccatctc ctttgctgga catcaagtac      4260
     cgtcgccgtc agcttgatct gcgtaagaag cagatcaagg aatggcaaga atccgagttg      4320
     ctgtacctcc aagaagaagc cgaggctatg aaagcccagg cctctgatga ttctttcgac      4380
     gtctccggtt acctccagga gcgcgctcaa cacattgaac gcgaagcaat ccgccaggag      4440
     aaggatgccc aatacagcct tggaaacaac ttctggaagc aggattcccg tatcgctcct      4500
     ctccgtggtg ctctcgccac ctggggtctg actgttgatg atatcggcgt tgcctccttc      4560
     cacggtactt ctactgtcgc taatgacaag aatgaatcgg acgtcatttg ccagcagatg      4620
     aagcacctgg gtcggaagaa gggcaacgcc cttttgggta tcttccagaa atatctcacc      4680
     ggacatccca agggtgctgc tggtgcctgg atgttcaacg gctgtctaca ggttcttgaa      4740
     agtggtctgg ttcctggcaa ccgcaacgct gataacgtgg acaaggtgat ggagaaattt      4800
     gactacatcg tttacccgag ccgcagcatc cagactgacg gtatcaatgc cttctccgtc      4860
     acttcattcg gtttcggcca gaagggtgca caggttatcg gtattcaccc caagtacctc      4920
     tacgcaaccc tggatcgggc acagtaccag acctacaagg ccaaggtcga ggcgagacag      4980
     aagaaggcat accgcttctt ccacaacggg ctgatcaaca acagcatctt cgtcgctaag      5040
     gacaaggctc cttacgaaga tgcccagcaa agcaaggttt tcctcaaccc tgattaccgt      5100
     gtggctgccg acaagaagac ttcgcaactc aagttccctg ctcagccccc aaaggctaat      5160
     gacaaaggac ttgagagcac aaagactatg atcgagtcgc tggcaaaggc caatgcttct      5220
     gaagactcga aggtcggtgt ggacgtggag aacatcgaaa gtttcaacat cgaaaatgaa      5280
     accttcattg aacggaattt caccgcaagc gagcaagaat actgccaaaa ggcagcgtct      5340
     cctcgatcat cctttgcagg ccggtggagt gccaaggagg ctgttttcaa ggccttgggt      5400
     gtcagcagca agggcgcagg tgcccccctt aaggacattg agatctcaag tgattcaacc      5460
     ggggcgcccg tcgtcaacct tcacggtgct gcagctgaag ctgccaagca ggctggcgtc      5520
     aaacaggtca gcgtcagcat tagccacagt gatacccagg cagtcgcggt cgcggtctcc      5580
     aaattttaa                                                              5589
//

If you have problems or comments...

PBIL Back to PBIL home page