(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE60

ASPNC_1.PE60         Location/Qualifiers
FT   CDS_pept        join(164378..164425,164478..165590,165653..165985)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000166635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959390"
FT                   /orf_name="An01g00680"
FT                   /product="Catalytic activity: Benzoate + NADPH + O2  "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK32612.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324782"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0000EF9F4C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H0"
FT                   /transl_table=1
FT                   /translation="MALNVTTYATIVTVLLLPVLLAIKRLYFHPLSRYDGPRLWALTRL
FT                   PYMLAFRSGRLAHDIKRFHDIYGDTVRVGPDEVSFLDPDCIKDIYSRRPNNPHYKALPK
FT                   DPIRQKPPQPGQPGDILDVEDDDHSRIRKAYAPAFSTQALNAQKPLVTSYVCKMVAQLK
FT                   SRANSTDPSKRIVDLQRWVTYCTFDIICSLSFGEDFGCLDNDNYHEWVGMVVNSVKGKV
FT                   QIAAFRFYPWLFNYLVKSLPKSAQLMVKRHQAMTNEKVQKRLHTAVDRPDFFSYLLKSK
FT                   NELTEPEMEINAATFIFAGSHTLQSSLTGILFHLLKNPEALARVAEEVRSSFPDEEDLD
FT                   ANKLSKLPLLDAAIKEGIRLTAPVPLGITRLVPRGGHTVCGQYFPEGSKVAYNLWAAGV
FT                   SPRNFADPTKFHLERWLNPDEGRFANDRRSAIQPFLQGPRDCIGQNLARLEMSLVIGYL
FT                   VYHFDFVLPNGREALGEWEDQETYAVWMKSPLMVELVAR"
     atggcgctca acgttactac atacgcgacc atcgtgacag tcctgctgct gcctgttctc        60
     ctagcaataa aacggctcta cttccatcct ctctcccgct acgatggccc acggctctgg       120
     gcgctgacgc gactccctta catgctcgcc tttcggtcgg gtcggcttgc tcacgacatc       180
     aaaagattcc acgatattta tggcgatact gttcgtgtgg gcccggatga ggtgtcattc       240
     ttggatcccg attgcataaa agacatatac agccgtcgtc ccaataaccc acattacaag       300
     gcgctaccca aggatccaat ccgccaaaag cctccacaac ctggacagcc tggcgacatt       360
     cttgatgtgg aagacgatga ccactcgcgt attcgaaaag catatgcccc cgcgtttagt       420
     acacaggccc taaacgccca aaagccactg gtaacgtcat atgtctgcaa aatggtcgcc       480
     cagttgaagt cccgggccaa tagcacggac ccatctaaga gaatagttga ccttcagcgt       540
     tgggtcacgt actgcacgtt cgacatcatc tgctcactga gcttcggtga agactttggc       600
     tgcctggaca atgataatta ccacgaatgg gtcgggatgg tagtcaactc tgtgaaaggc       660
     aaagtgcaga ttgcggcttt ccgcttttat ccatggctct tcaactacct agtcaagagt       720
     ttacccaaat ccgcccaatt gatggtaaaa aggcatcagg ccatgactaa tgagaaggtc       780
     caaaagcgcc tacatacagc agtagaccga ccggatttct tctcatacct tctcaaatcg       840
     aagaacgagc tcacagagcc cgagatggag attaacgcgg ctacctttat cttcgcagga       900
     agccatacac ttcaatcctc tctcacgggg atcctgttcc acttactcaa gaaccctgaa       960
     gcccttgccc gggtagcaga agaggttcgg agtagtttcc ctgatgagga ggatctggat      1020
     gcgaataagc tatcgaaact gccactcttg gacgcagcca ttaaggaggg tatacgacta      1080
     accgcgcctg tgccgttggg aataacgaga cttgtaccca ggggaggaca taccgtgtgt      1140
     ggacaatatt ttcccgaggg tagcaaagta gcatacaatt tatgggctgc gggcgtgtct      1200
     ccccgaaact ttgccgaccc taccaagttc catttggagc gttggctgaa ccccgatgag      1260
     ggtcgcttcg caaacgaccg gcgctctgct atacaaccat tcttgcaggg gccgcgggac      1320
     tgtattggtc agaatttggc acggttggag atgtcgctcg taataggata cctggtttat      1380
     cacttcgact tcgtgttgcc gaatggacga gaggctctcg gtgaatggga agatcaagag      1440
     acctatgctg tttggatgaa gtcgcccctt atggtggagt tggttgcacg ttga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page