(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE68

ASPNC_1.PE68         Location/Qualifiers
FT   CDS_pept        complement(186071..186286)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959392"
FT                   /orf_name="An01g00760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43454.1"
FT                   /db_xref="UniParc:UPI0000EF9F70"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H8"
FT                   /transl_table=1
FT                   /translation="MSDRTGSTNNNNNNNKKSGGSGGAQITEAQASFITTPRNINQLNT
FT                   WGQSARNRRQGNKEESDSKGPSDSSR"
     atgtctgaca gaaccggctc caccaacaac aacaataaca acaacaagaa atctggaggt        60
     agtggtggtg ctcagatcac tgaagcgcaa gctagcttca tcaccacccc aaggaacatt       120
     aaccagctga atacctgggg ccaatctgcc aggaacagac gtcagggaaa caaagaagaa       180
     tccgacagca agggaccatc tgactcttcc agatag                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page