(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE75

ASPNC_1.PE75         Location/Qualifiers
FT   CDS_pept        join(complement(197901..198002),complement(197782..197850))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959657"
FT                   /orf_name="An01g00830"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAK43461.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR003340"
FT                   /db_xref="UniParc:UPI0000EF9F76"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I5"
FT                   /transl_table=1
FT                   /translation="MTVVNSKATVMEWKAKLTAKIELDSQSLESGMDHGQWLQYAKQSG
FT                   SDDGQFLTFLL"
     atgactgtgg ttaatagtaa ggcaacagtc atggagtgga aggcgaagtt gacggcaaag        60
     attgagttgg acagtcagtc gctagagagt ggaatggacc acggtcaatg gctacagtac       120
     gcgaagcaat caggaagtga tgatggacag tttttgactt ttctactcta a                171
//

If you have problems or comments...

PBIL Back to PBIL home page