(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE77

ASPNC_1.PE77         Location/Qualifiers
FT   CDS_pept        join(199947..200369,200419..200533,200628..201020,
FT                   201084..201437,201508..201911)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875699"
FT                   /orf_name="An01g00850"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43463.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9F78"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I7"
FT                   /transl_table=1
FT                   /translation="MVVSQSVVGRTNAEKPHGLMGMLKNPYVFMTCAFASLGCIMYGYD
FT                   QGVMSPVLVMENFENHFPYFMGSTVQGWLVASLELGAWAGALFNGYLADRISRKYSMMV
FT                   AVVIFTLGSSLQAGAQKPSYFFAGRIVGGIGIGMFSQVIPLYQAEIAPPELRGSLVSLQ
FT                   QLSITIGTSIAFWLDYGIANPYLADGTYNAAQNHGHTCLGQKTIAWRLPLALQILFAWI
FT                   LFFGMFFFPFSPRWLMSKHREEEATAALSKLRRLPPNDPLLRAEILEIKAAVLFDEESE
FT                   AEAIRQGGKLAPWKMLFAPNMFKRLVLGCGAMIFQQFTGINAVLYYAPQIFSSFGFSST
FT                   KQTLLATGVTGILQIIFTLPAVLLLDKFGRKTFLITGAVGMFCCHIVVAIVEGLYEDNW
FT                   NLNMGLDKPQGWVAIAFIWLFAVNFAYSWGPVTWVLAQEIFPNSTRSRGVSIVASTNWM
FT                   FNFVIGLTTKDMLKSMKYGTYIFFAIFSALGGLFIWKFAPETKDKTLEELDIFFGGGMD
FT                   SIAEADRQRMERIYDSLGLSGVKEVGDLVVEKEKGEITGEVVEMS"
     atggtggtca gtcaatcagt cgttggtcgt accaacgccg agaagcctca tggcttgatg        60
     ggcatgctca agaatcccta tgtttttatg acatgtgcgt tcgcctccct gggttgtatc       120
     atgtatggat atgatcaggg tgtcatgagc cccgtcctgg tcatggaaaa ctttgagaac       180
     cattttccgt acttcatggg ctcaaccgtt cagggttggc tggtcgcttc tttggaactg       240
     ggtgcctggg ctggtgcact gttcaatggt taccttgcgg atcgcatttc tcgcaagtac       300
     tctatgatgg tggctgtggt gattttcact ctgggctcta gtcttcaggc tggcgcccag       360
     aagccgtcgt acttctttgc tggtcgtatc gttggcggta tcggcattgg aatgttcagt       420
     caggttattc cactctatca agctgagatt gcgcctccag agctgagagg ctcgctggtg       480
     tctctgcaac aactgtctat caccatcggc acatcaatcg ccttctggct ggattatggc       540
     atcgctaacc cctacctcgc cgatggcacc tacaacgctg cgcagaacca cggacacact       600
     tgcttgggac agaagaccat cgcgtggcgc ctgcccctcg ccctgcagat tttgtttgcc       660
     tggatcctgt tcttcggaat gttcttcttc cccttctctc ctcgctggct gatgtccaag       720
     caccgcgaag aagaagcgac ggccgcactc tccaagctca gaagactgcc gcccaatgat       780
     ccccttttgc gcgctgagat cctcgaaatc aaggctgctg ttctttttga tgaggaatct       840
     gaggctgaag ccatccgtca gggtggcaag cttgctccct ggaagatgct ttttgctccg       900
     aacatgttca agcgtcttgt tctgggctgt ggagccatga tcttccaaca attcaccgga       960
     atcaatgctg tcctttacta cgcccctcag atcttctcat ctttcggttt ctcctccact      1020
     aaacaaaccc tcctggccac cggtgtcacc ggtatcctgc agatcatctt caccctgcct      1080
     gcggtgctcc tgctcgataa atttggtcgt aagaccttcc tgattaccgg agccgtcggc      1140
     atgttctgct gtcacattgt ggtcgccatc gtggagggtc tgtacgaaga taactggaac      1200
     ctgaacatgg gtctggataa gccccaggga tgggtcgcaa tcgcgttcat ctggctgttt      1260
     gctgtcaact tcgcctactc ttggggtccc gtcacatggg tccttgccca ggaaatcttc      1320
     cccaacagca ctcgctcccg cggtgtctcc atcgtcgcct cgaccaactg gatgttcaac      1380
     ttcgtcattg gtctgaccac caaggacatg ctgaagtcca tgaagtacgg tacttatatc      1440
     ttctttgcca tcttcagtgc tctgggtgga cttttcatct ggaagttcgc ccccgaaact      1500
     aaggataaga cgctcgagga actggatatc ttcttcggtg gcggtatgga tagtattgcc      1560
     gaggcggatc gtcagcgcat ggagagaatc tatgatagtc tgggattgag tggtgttaag      1620
     gaggtcggcg atttggtggt ggagaaggag aagggagaga tcacgggtga ggttgtggag      1680
     atgtcgtag                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page