(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE8

ASPNC_1.PE8          Location/Qualifiers
FT   CDS_pept        join(complement(22133..22367),complement(21259..22046))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874680"
FT                   /orf_name="An01g00080"
FT                   /product="Similarity to hypothetical membrane protein
FT                   YOR228c - Saccharomyces cerevisiae "
FT                   /protein_id="CAK36859.1"
FT                   /db_xref="HOGENOM:HBG330174"
FT                   /db_xref="InterPro:IPR012472"
FT                   /db_xref="UniParc:UPI0000EF9EBF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B8"
FT                   /transl_table=1
FT                   /translation="MAASKESMPSKPEDIETRSIFSMQELDPSPVQDEFPDLESGDYFP
FT                   REPSPPSAREPIAGGGRFSSLKLGLRGHSWDSWLSAFQRYSTYPPTLFFALHWANTSLI
FT                   PLATRSVPDSESFLLLTRPVYQSPGLEHLVLTAPVLIHIASGIALRNIRSARRARLYGA
FT                   ETRSQRHSLTFWPRMSLQARLGYSLVPLLGVHVLVNRITPLMVDGGSSGVGLGYVAHGF
FT                   ARAPALWNLYYLLFVAVGVWHFVGGWAAWMGWRVTTVRKERDRKKGSLEGYLGASESEQ
FT                   RLRRQRKMWWTVNGIAAVGASIWLAGALGIIGRTGQGYGWEAKGWNEIYSQVPVIGSWL
FT                   "
     atggctgcct cgaaagaaag catgccatcc aaaccagagg atatcgaaac gcgctccata        60
     ttttcaatgc aagagttaga cccatcacca gtacaagatg agtttccaga ccttgaatct       120
     ggtgactact tccccagaga accaagtccg ccatcggcac gcgagcccat cgccgggggt       180
     ggtcggttct cgtcgctcaa gttaggcctt cgcggacata gttgggattc ctggttatct       240
     gcgttccaac gatactcgac gtatccaccg accctattct ttgcattgca ttgggccaat       300
     acctctctca tccctctggc tactcgatct gtgcccgaca gcgagagctt cctgcttctc       360
     accagacccg tctatcaatc tccgggcctc gaacatctcg ttctgaccgc gcctgttctg       420
     attcatattg cgtctggaat tgctttgcgc aacatccgct ccgcacggcg ggctcgactc       480
     tatggcgccg agacaaggtc acagagacac tccttgacgt tttggcctcg gatgagcctc       540
     caagctcggt taggatattc cttagttccg ttactcggcg tccatgtgct cgtcaaccgc       600
     atcactccgt tgatggttga tgggggaagc tcgggagtcg ggctgggtta tgtggcccac       660
     ggctttgcac gggcccccgc actctggaat ctgtactatt tgttattcgt cgccgttggg       720
     gtgtggcact tcgtcggcgg ctgggctgca tggatgggct ggagagtgac aacggtccgg       780
     aaggaacgtg accgaaagaa aggctcccta gagggttatc tgggagcctc ggaaagtgag       840
     caacgactcc gccgacagag gaagatgtgg tggacggtca acggcattgc cgcggtggga       900
     gcatccatat ggcttgcagg tgccctggga atcatcgggc gtacggggca gggttatggc       960
     tgggaggcca agggatggaa tgagatctac agccaggtcc ccgttattgg gtcctggctc      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page