(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE84

ASPNC_1.PE84         Location/Qualifiers
FT   CDS_pept        219994..220749
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875702"
FT                   /orf_name="An01g00920"
FT                   /product="Similarity to hypothetical lysogenic protein
FT                   CAD54907.1 - Bacteriophage P2-EC58 "
FT                   /protein_id="CAK43470.1"
FT                   /db_xref="UniParc:UPI0000EF9D4C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J4"
FT                   /transl_table=1
FT                   /translation="MSAGITAIVTLHSDRLKRHSESEKLVAEYRDPLLLASMELQSRLY
FT                   NILEQDFLCYYENKARRDLVDVYTAFLIGQFFSWTYILRRQVQFLRFSSNKSNQKLSRA
FT                   IEAIQKSFSTDMYGKDDSDFMLWRGEQLAIGEIMTVSDDGELFCLQYSQFIQKFKSADA
FT                   PFKDYFNPITEGITALVNRRSTHHPSQHLPAGRLRRVQHFILDLIDVLDPHYLGKASAR
FT                   SQRVYSAPCCDCSECRREAGSYGTDSGTS"
     atgtcagcag ggatcacagc catagtcaca cttcatagtg accgattgaa acggcactcc        60
     gagtcggaaa aattagtggc ggaatatcgt gatccccttt tgctggcatc gatggaactg       120
     caatcgagac tctacaacat tctcgagcaa gactttctct gctactatga gaacaaagct       180
     cggagagact tggttgatgt ctacactgca tttttgattg gccagttttt ttcttggaca       240
     tatatccttc gtcggcaagt ccaattcctt cgtttttcat caaacaaaag caaccagaaa       300
     ctctcacgtg ccatcgaagc tattcagaag tcattcagca ccgatatgta cggaaaggat       360
     gatagtgact tcatgctatg gcgcggggag caattggcca ttggggagat aatgactgtc       420
     tctgatgatg gagagctttt ttgcttacaa tattcacaat ttatccaaaa gttcaagtct       480
     gcagatgctc cttttaagga ctacttcaat cctatcacag aaggaattac tgcacttgtg       540
     aacagaagat ctacccatca tccctctcag catctacctg caggtagatt gcgtcgtgtg       600
     cagcatttta tcctggatct aattgatgtt ttggaccctc actacttggg aaaagcgtcc       660
     gcaaggagcc aacgagttta ctctgcacca tgctgtgatt gttcggaatg ccgaagggaa       720
     gctggatcgt atgggacaga ttctggtact tcctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page