(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE97

ASPNC_1.PE97         Location/Qualifiers
FT   CDS_pept        join(complement(248608..248908),complement(248200..248528))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875707"
FT                   /orf_name="An01g01060"
FT                   /product="Complex: Forms a heterodimer with the spU2AF59
FT                   large subunit"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43483.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG525917"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EF9D6F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K7"
FT                   /transl_table=1
FT                   /translation="MANYLASIFGTEQDKVNCSFYYKIGACRHGDRCSRKHVKPSYSQT
FT                   ILMPNMYQNPAYDPKSKMNPSQLQNHFDAFYEDVWCEMCKYGELEELVVCDNNNDHLIG
FT                   NVYARFKYEEDAQAACDALNSRWYAARPIYCELSPVTDFREACCRLNSGEGCVRGGFCN
FT                   FIHRKDPSNELDRDLRLSTKKWLKERGRDARSVSRSPSPEPTRRRY"
     atggccaact atctcgcctc catcttcggt acagagcagg acaaggtcaa ctgctccttc        60
     tactacaaaa tcggagcttg cagacatggc gaccgctgct ctcgaaagca cgttaagccg       120
     tcatactctc agacgatcct gatgccgaac atgtaccaga atcccgcgta cgacccgaag       180
     agcaagatga accccagtca gctacagaac cactttgatg ctttctacga ggatgtgtgg       240
     tgcgagatgt gcaagtacgg cgagttggag gaattggttg tctgcgataa caacaatgac       300
     cacctcattg gaaacgtcta cgcgcgcttc aaatacgaag aagatgccca ggccgcctgc       360
     gacgctttga attcacggtg gtacgcggca cgacctatat attgtgaatt atcaccggtt       420
     acagattttc gagaagcttg ttgtcggtta aatagcggcg aggggtgtgt acgtggtgga       480
     ttctgcaact tcattcatcg gaaggacccc agcaatgaat tggatcggga tcttcgtctc       540
     agtacgaaga agtggctgaa ggagcgtggc agggatgcga gaagtgtcag ccgcagtcct       600
     agtccggagc cgacccggag gaggtactag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page