(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE98

ASPNC_1.PE98         Location/Qualifiers
FT   CDS_pept        join(complement(250223..250677),complement(249343..250169),
FT                   complement(249120..249205))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806403"
FT                   /orf_name="An01g01070"
FT                   /product="Similarity to hypothetical protein BAB09014.1 -
FT                   Arabidopsis thaliana"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAK43484.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG324141"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI0000EF9D70"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K8"
FT                   /transl_table=1
FT                   /translation="MPTVILGGGIIGSSIAYYLSQSQPQEEIHVIESASELFCSASGYA
FT                   AGFLAKDWFAPSLAPLGELSFNLHESLAAEHGGRQKWGYMKGVALSLGSVSNKGGARGD
FT                   DWLRAGTSRAETAAGTSQYGEPQVPEWLTQQQGAKVEQISDKDTTGQVDPLRLCRFLMD
FT                   SCTSRGVKLHCPTKASSLVRNEAGTITGVRIVNLNTKSESTIPCTNLVVCAGPWTPQVF
FT                   RDLFPFSKVALPIYPLAGYSLVLHSPRHTLEHEQKKYHGETHALFTTWPPSCGFSPELF
FT                   SREGREIYIAGLNTKTIPLPERADDSHNSVDQKEMDRLKAASVRLLGKLAEGKTESSDE
FT                   TPNLNDLKIVREGLCFRPASDRGTPFVGRIDDSLLGEGIKTATGSRKGGVFVASGHGPW
FT                   GISLALGTGKVIADLVEGVQPAVDISGLAQKFTTKKELSKVHAEDGRLRHQKLLRD"
     atgccaaccg tcattcttgg aggaggtatc attggctcct caattgccta ttacctctct        60
     caaagtcaac cgcaagaaga aattcatgtc attgaatcgg catccgagct gttctgctct       120
     gcctctggct atgctgctgg cttcttagct aaggattggt ttgcgccttc tctcgcgcca       180
     ttgggcgagc tgtcattcaa tttacacgag tcccttgctg ctgagcacgg aggacggcag       240
     aaatggggtt atatgaaagg tgtggcgctg agcttaggct ctgtgagcaa caaaggaggt       300
     gctcgtggcg atgattggct tcgtgcaggt accagtcgcg cagagacggc tgcaggcaca       360
     agccagtacg gggaacctca ggtcccagaa tggttgacgc agcagcaggg ggcgaaggta       420
     gagcagatca gtgataagga tacgactggt caagttgatc ccttgaggtt gtgcaggttc       480
     ctcatggaca gctgcacgtc acgaggtgtc aagctccact gtccaacaaa ggcttcatca       540
     cttgtcagga atgaggccgg taccattacc ggcgtcagaa ttgtgaactt gaatacgaaa       600
     tccgaatcta ctatcccctg tacgaatcta gttgtctgcg ctggaccgtg gacaccgcag       660
     gtcttccgtg acctgttccc gttctccaaa gttgcactcc ctatatatcc gctcgctggg       720
     tattctttgg tacttcactc cccaagacat actctggaac acgagcagaa aaagtatcat       780
     ggtgagaccc atgctttgtt cacgacatgg ccaccatcct gcggctttag cccggaattg       840
     ttctctcggg aagggagaga aatctacatt gcgggtttga ataccaagac aatcccactt       900
     ccggaacgag cagacgactc ccataattca gtggaccaaa aggagatgga tagactgaag       960
     gcagcgtctg ttcgcctgct tgggaagctt gccgagggca aaacggaatc aagtgacgaa      1020
     accccgaacc tgaacgacct gaagatagtc cgtgaaggcc tttgtttccg tcctgcttca      1080
     gatcgtggca caccttttgt ggggagaatt gacgacagct tgttgggaga gggcatcaag      1140
     accgccacag gaagcaggaa gggtggggta tttgtcgctt cgggccacgg tccttggggc      1200
     atctcgcttg ctcttggaac tggaaaggtt attgccgatc tggtggaagg ggttcagcct      1260
     gcagtagata tcagcgggct ggcccaaaag ttcactacga agaaagagct gagtaaggta      1320
     catgctgaag atggacgcct caggcaccag aagcttctcc gagattag                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page