(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_10

ID   ASPNC_10; SV 2; linear; genomic DNA; GRV; FUN; 1734209 BP.
XX
AC   AM270993_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Aspergillus niger (strain CBS 513.88 / FGSC A1513) chromosome 1R,
DE   complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus niger (strain CBS 513.88 / FGSC A1513)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Aspergillus.
XX
RN   [1]
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A.E., van den Berg M., Breestraat S., Caddick M.
RA   X., Contreras R., Cornell M., Coutinho P.M., Danchin E.G.J., Debets A.J.
RA   M., Dekker P., van Dijck P.W.M., van Dijk A., Dijkhuizen L., Driessen A.J.
RA   M., d'Enfert C., Geysens S., Goosen C., Groot G.S.P., de Groot P.W.J.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.T.W.,
RA   van den Hondel C.A.M.J.J., van der Heijden R.T.J.M., van der Kaaij R.M.,
RA   Klis F.M., Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X., van
RA   der Maarel M.J.E.C., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N.M.E., Ram A.F.J., Rinas
RA   U., Roubos J.A., Sagt C.M.J., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J.J., Wedler H., Woesten H.A.B., Zeng
RA   A.-P., van Ooyen A.J.J., Visser J., Stam H.
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88.";
RL   Nat. Biotechnol. 25:221-231(2007).
XX
CC   This Genome Reviews entry was created from entry AM270993.2 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1734209
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88 = FGSC A1513"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 1R"
FT                   /db_xref="taxon:425011"
FT   CDS_pept        join(810..839,894..1161,1232..1554)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117169"
FT                   /gene_name="srgA"
FT                   /orf_name="An14g00010"
FT                   /product="Secretion related GTPase srgA-Aspergillus niger "
FT                   /EC_number="3.1.5.-"
FT                   /EC_number="3.1.5.1"
FT                   /function="GTP binding"
FT                   /function="dGTPase activity"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="CAK41800.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0008832"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000006AD6A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2A0"
FT                   /transl_table=1
FT                   /translation="MAGTRNYDFLIKLLLIGDSGVGKSCCLLRFSEDSFTPSFITTIGI
FT                   DFKIRTIELDGKRVKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDERSFQNIRTW
FT                   FSNVEQHASEGVHKILIGNKCDWEEKRAVSTEQGQQLANELGIPFLEVSAKNNINIEKA
FT                   FYDLASDIKKGMDTSKSEQVGSQGVSIDQQGSGLNGSAGGKCC"
FT   CDS_pept        join(2854..3610,3680..4380,4430..5158)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901820"
FT                   /orf_name="An14g00020"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAK41801.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniParc:UPI0000EFC92B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2A1"
FT                   /transl_table=1
FT                   /translation="MSEPRAFTVRPLSKQTRSDHRDAFRVYLSSSSLAFLKLRAGDVCN
FT                   ISLAGGPSKTAIAWNATENIQNTVVQTSRTLQECYGIKIGEKITICRVDGPLNKIDTVS
FT                   IIECSDSDRIAKYGAIPPSDLIHWSWSLELPLLKCDGIAVGLVFELELRSQRRSFRVAD
FT                   ISSQDGSTTCTLFRFAESSEIIMGEDLKKPLERGTSNIQVRPTGLGGMDRQIESINESL
FT                   ADFNPCLVNLVMPSFYEHSRGILLYGPKGTAFGRNIGDAESKLRNVFQEAMRCQPSAIL
FT                   IDQVEFIAPRRTSLDSQSLASVLCECIDATKNAFILIVAATRHPNDVDDALRTPHRLAT
FT                   EIELHIPTAHDRAQILRAICGGPSPALSDTLIDMIAEKTHGYVGADLFALLQLISRKAR
FT                   QRQMSEFELRVSDERTPSDNAVEGPITQEPGTAIHIKDVDVLSALQETRPTAMREVFLE
FT                   TPKVRWSDIGGQHEIKRRLQKAVERPLKHPERMRRLNLTSKKGVLLYGPPGCSKTLTVK
FT                   ALATEAGLNFLAVKGAEILSMYVGESERALREIFRKARSARPSIIFFDEIDAIASKRGT
FT                   SSQGGVNVLTTLLNEMDGIEELKSVLVIAATNKPEVIDPALMRPGRLDNILYIGPPDYE
FT                   ARKEILDIWFRKSVINPEVEVDVLAMKTDGYSGAEIVSICETAGDAALDAEEETGQAQD
FT                   IRWEHFEYALKQVKRQITAAVVEAYEQWGDSVDI"
FT   CDS_pept        join(5668..5982,6039..6144,6198..6700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901821"
FT                   /orf_name="An14g00030"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK41802.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EFC92C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2A2"
FT                   /transl_table=1
FT                   /translation="MPERYTRGRSRARLPSYSEFDRAPSLQRSLSPHSESRFNTTPRTR
FT                   SVERGAVRRNAHRSRSWSRSSSHNQAPSRSRSRSETPRRYRKKDYSRTPSPSADASRSS
FT                   KIVIEKLTKNVTESHLREIFGGFGDIQSLDLPMNKAFMTNRGTAYILYHDPADAEAAIA
FT                   HMHEAQLDGAMLNVSIVLPRRAFSRSPPPVQHSRGSFGRPGHGRGPPSDSRAPRSPPPA
FT                   RRYRRSRHMERHDIYRPRSLSRSRSPRRSRSLSSKSLSNSPPPRRTHSRMDSSQRRRRR
FT                   SPSYSSYGYSSRSDRDRSMSPRRDHH"
FT   CDS_pept        join(complement(15268..15853),complement(14593..15218),
FT                   complement(14231..14535),complement(13781..14176),
FT                   complement(13577..13729),complement(13420..13516),
FT                   complement(12860..13339),complement(12563..12805),
FT                   complement(11276..12505),complement(10671..11211),
FT                   complement(10140..10620),complement(9751..10054),
FT                   complement(9599..9696),complement(9443..9535),
FT                   complement(9227..9388),complement(9029..9125),
FT                   complement(8786..8986),complement(8446..8728),
FT                   complement(8198..8395),complement(8004..8128),
FT                   complement(7866..7948),complement(7687..7809),
FT                   complement(7550..7637),complement(7403..7487),
FT                   complement(7233..7351),complement(7037..7183),
FT                   complement(6947..6988))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901822"
FT                   /orf_name="An14g00040"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /protein_id="CAK41803.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG324449"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012993"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI0000EFC92D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2A3"
FT                   /transl_table=1
FT                   /translation="MATNKRKESRLPIPGIADWNPAEPVSSTLAANLVPHLSSQGDGTP
FT                   GLTKEAFSQLRHELLEGKYSHLQLNDSITDVKKLICIVLKAGLEPCIRDDRSELQGQLL
FT                   DCLDIVQNAVDKAPLALLEMPEPELLGKDAAAPLYSCLVVWLVHLFSTWDSEPVEDRIG
FT                   GILASIFNAPHNNTRLWSSFVGITALIQACTTELLSALEAYQSRAQLTHVASSSVVNPK
FT                   QLCTLDLDRLGLRCASFKKLIRLESCAQAVRLCLNLLISAINAYVSYNIPSKRQNLAWL
FT                   SNGYRRLWKLTVLWHCKSDVKDVTSQIPTFSRFLRFIKRFCDHVPYTSPKQRLACIFLH
FT                   IFAETLALEILNQASDLQLSLSQAIDSFTNAFTSEKDIMRSMRATILPVKSKLALFNSF
FT                   DTCLQAAIESSLVHCPIVYNSLDAKDAEAAFCSGNIPEMAAVHGFPGSGHSSSSRVGAV
FT                   QMAKRRCLPRLDADRESRNVAQRLIAKSLKLLRCDQSGTLGDLSCAVATSYIGLSEQDK
FT                   LSLLCVLCTIPCALSGNLTDIKNVDSEDSFTCRICDPKCRDLKSESNSQTVKSDELCQI
FT                   LDHIISNLSRTANLRIAATVALRRTLMHTSESAHMQLTSSVFGEFCLNSLRSSVRELRL
FT                   TTGHSITSFVRRNLDHETRRSNFIVILDWLQNLSQKQETPLHETCILTLCHLAQFSNDE
FT                   EMNIILLRLVEYLGHSNPFIGAVAYTELAGLAQHLSVTPAALFRPFWRTLSVTVVRNFQ
FT                   SRPYMAEQLCDLLGMKVDDFLRLTETYVLPYLVLARKRDVIIRVGATYKDAKTPFDICS
FT                   EKNNLASILAFLLSQPSPNLEESVMSALSEVDSAFRGRTLAELLRIEPILIACDLLKGL
FT                   GDLGEDKGKRFLRALHHLAILVPRKSGPTPRRANLIGYFVEEHVLGIITQFAHAVNDFQ
FT                   IRQPLIEKKRNIAAIGEMIKVARGHISSALPQICACLRAALEIQELCNNAFIVWRVLIS
FT                   SLQEEEVEPLIDQTLSIVIRYWDMFHEDTRKQACELVEYIMQSHYELVRDIFNTMPSLA
FT                   SIPILYKHEATLNSMKETMDVRSHFLAFIRRCQSDTATVVEQSLRELVPYLSQNEEFIH
FT                   RSVLSEIPDPVVAQLARSLLDCCVKFNTSSDVITKLSAECLGLIGCLDPNRVDTVKEKK
FT                   GILVLSNFDSMEETFDFILFFLQNVLVETFLSASNTRAQGFLAYAMQNLLRFCGLDSAV
FT                   ANRSRDFRADEKYQRWLELPETVRNILAPFLTSKYTVTIGTLNTNCSYPLFTAGLTHGN
FT                   WLRSFVQDLLQAGNGDNAKLVFSVCSRIVKGQDISIASFLLPFAVLNRTVSGSAKEKED
FT                   LRCELVNVLSHPLPDTHDYVYENIILCSQSIFEVLDYLSRWLQGKKKQINGLRNHSHPS
FT                   NRAHKGASRDALLDTYYSQAKAVEILLSSIPPEVISKRAVECKSFSRALFHWEQYIRQW
FT                   KNQHSKQGGAVVEPLYQRLQDIYSRIDEPDGIEGISSHLHVLNIDQQVLEHRKAGRWAT
FT                   AQSWYELQLEKEPNNSEAQWNLLACLKESGQQDAILTRFEILKANSSSRKFLPFAVEAT
FT                   WITSNWGKLNEYLQQLSQLGRGEFNIEIGLALNAFRHGKYTEFWEHMEALRLSVAKSLT
FT                   ANSVVSLQSCHDSILKLHTLHEVESIARAKIKDCGSSDSRSKLPDILDRRLDILGGYIS
FT                   DKQYLLGLRRATMELTNEFTDSDIAAAWLTSARLSRKSNFTNQAYQSMLHAARLNDRSA
FT                   TIEHARLLWKDGHHRKAIQTLEGAIAANEFSSETTSSQERTSSLITNNGEHENLLLARA
FT                   HLLLAKWTDRAGQTQSDAIVQRYREAIKLHPRWEKAHYYLGKHYNKILDLEKAKPLGRE
FT                   AQIYLSGEASKLVVDNYLRSLAHGNKYVFQSLPKILTLWLEHASTVDQPFDPKRGDNED
FT                   FQKHTLNQRKKSLDDMHTQLRKYVNRIPAALRQLFTILPQVVARICHPNTTVYDLLTKI
FT                   VARAVNSFPQQGLWTVLAVVKSSSKDRASRGISCLQKITEVNKKLKNQPLSDMRGMINQ
FT                   GQKFSEEMLRLCIARIEDKVARVSLRDLKFSHKVAPCRLVVPFQAMLTPTLPASHKPEY
FT                   LKGFRAFPRDPTTIEAIMDDVQVLNSLQKPRRIGIRGSDGKMYNILCKPKDDLRKDQRL
FT                   MEFNNMINRLFKKDVESSKRRMYIKTYAVTPLNEECGLIEWVDNLRALRDIVIKLLRER
FT                   GIAPNYNEIRHDLNEACSDNSKLHLFTTRILAKFPPVLYEWFIEMFPEAGSWFAARIRY
FT                   TRSCAVMSMVGHVLGLGDRHGENILFEEGTGGVLHVDFNCLFDKGLTFDIPELVPFRLT
FT                   QNMVDAFGVYGYNGPFRKTCEISLGLLRHNEDALMTVLETFLHDPTTDFIGKKKRRTHV
FT                   NAPETPAGVLENVRNKLRGLLPGESVPLSVDGHVDELIVQATDRSFKTLALVLGGP"
FT   CDS_pept        join(16538..16615,16672..16780,16874..17018,17105..17302,
FT                   17414..17663)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000085051" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966135"
FT                   /orf_name="An14g00050"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK41804.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI0000EFC92E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2A4"
FT                   /transl_table=1
FT                   /translation="MSGDMPSESLESNSEHAYFMKQALLMGEKALETGETPVGCVLVYD
FT                   KKIVGFGMNDTNKSMNVVPFKADQTVFVKSEPIAGLLRVQDMPSLLPSKKCLRLILGQR
FT                   CVRQTSMFGGTGSILSLHAEFVLAFPWTYTPDAKLIYASRSIDPSYPVQGGLFHKEAIM
FT                   LLRRFYIQENEKGRKSSLHPLHPEQGQLVLGRTATQSRKLKAAKHLRSRVEAIEVKSSG
FT                   GELKNMFHLNFALLQELNVQYRARANETSTRRSFYHH"
FT   CDS_pept        join(complement(18439..18498),complement(18357..18373),
FT                   complement(18098..18303),complement(17838..18040),
FT                   complement(17675..17755))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901823"
FT                   /orf_name="An14g00060"
FT                   /product="Catalytic activity: NADH + ubiquinone  "
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41805.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG398231"
FT                   /db_xref="InterPro:IPR019721"
FT                   /db_xref="UniParc:UPI0000EFC92F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2A5"
FT                   /transl_table=1
FT                   /translation="MATDHKSILVPPKRANTDYPLIDSDPHLRRVFGYARPSDYAVGGG
FT                   MAAASPLAFWIMERVSPSHVGRGGFAPVMRLATAIGLIGGLHVVYQRSCNRFYGFTENS
FT                   READMDMKEMVDKVKKGESLYGTSKVSSYLQGVAARNSRYSELFIHVLPWFNLVNHDQH
FT                   GVDTAKYYQQAERELEAERLKQASS"
FT   CDS_pept        join(18952..19107,19313..19879)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234964" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812971"
FT                   /orf_name="An14g00070"
FT                   /product="Similarity to hypothetical protein SPBC30D10.04 -
FT                   Schizosaccharomyces pombe"
FT                   /biological_process="cell cycle"
FT                   /biological_process="replication fork protection "
FT                   /biological_process="response to DNA damage stimulus "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK41806.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006974"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0048478"
FT                   /db_xref="InterPro:IPR012923"
FT                   /db_xref="UniParc:UPI0000EFC930"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2A6"
FT                   /transl_table=1
FT                   /translation="MEKDVGYSNPSMDQDDTLFDYDAGLEGTLQDIAVDPKRDEPIAAP
FT                   VLGLDEKSPRDHCVANCFSKFSDAARLLNFYQLWLDDLFPRAKFADGLAMIEKLGHSKR
FT                   LQTMRREWIDEEKPRLSAADSEDAQQAKSSSPHTRDNSMPIGHLEKANAIIGRGDNVAQ
FT                   APPTQGLGEPSSLLLGGILQQEDLFVSDDESVPREIIEEGAHENNDDDDDDELEALLRE
FT                   HEDGFIGNNNLAGSDIRA"
FT   CDS_pept        join(complement(21229..22122),complement(20342..21169))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170207" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901824"
FT                   /orf_name="An14g00080"
FT                   /protein_id="CAK41807.1"
FT                   /db_xref="HOGENOM:HBG593714"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI0000EFC931"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2A7"
FT                   /transl_table=1
FT                   /translation="MPPKKSAPKPAAASAATAKGKRATSTTTTTTKAATKATTKATTRT
FT                   TTKANKTTATTTTARKVPIDKRETPSKPKKTTKRQPVKSTTATKGGTVDNLASKKHEAE
FT                   PARREKRKAEVIDEAPARDLKKARVAKPRVTKLKPKVVINHAPTTRLNVYVCGEGSSGE
FT                   LGLGSAKNAVDVKRPRLNANLPADRVGAVQVAVGGMHCVALTYDNRILTWGVNDQGALG
FT                   RDTAWDGGYKDIDEANNGSDSESDDDIALNPYESTPTAIPSEAFPKDTVFVQVAAGDSS
FT                   SFALTDDGQVYGWGTFRSNDGILGFDAANKVQHTPSLIPSLKKIKHLACGDNHVLALND
FT                   KGAVLSWGSGQQNQLGRRIIERNRLNGLQPREFGLPKNIVHIGCGAFHSFAVHQSGKVY
FT                   AWGLNSFGETGIRAGAGDDEAAIVHPTVVDSLSGKAVTQICGGAHHSLAIANDGECLVW
FT                   GRLDGYQTGLKIDSLAEDAVIKDERGRPRILIDPKAVPGVKAIAVAAGSDHSLVIDVEG
FT                   RPWSWGFSATYQTGQGTPDDIEVATVIENTAVRGKKLNWAGGGGQFSVFTEPAALA"
FT   CDS_pept        complement(22875..24830)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170218" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812972"
FT                   /orf_name="An14g00090"
FT                   /product="Catalytic activity: catalyzes the reduction of 2 "
FT                   /EC_number="1.1.1.193"
FT                   /function="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="CAK41808.1"
FT                   /db_xref="GO:0008703"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327808"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="UniParc:UPI0000EFC932"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2A8"
FT                   /transl_table=1
FT                   /translation="MEHDHSDASYTSTKSLSPDSGSGSSHADASNRAKGGLEEATLNGR
FT                   MVTFYENDNNRNHNDNTTPTEPILRDAVLETDHFSGTAAGSARPEESDVQGPIQLGSDH
FT                   NSASDHIPREPDADDPGRDSRSRDSSSATNHNLINNPPNLARIRQVMFECKDPIEISLE
FT                   EFETYWPFIDNVWVKQRSNSSKEGHCTTDYYMCRLRRPTHRTSETRPLPEGKRPRKKRV
FT                   REGGICNFQIKVVKFEGAYSTVTIARTPGSSQVHSHDLDYIDRVKRNSGLMEFARREAI
FT                   KGYLPSSIFTKFQEEPEKLIEAGGKFCTVTDVRNVSAKWRIQNPDVKLVAHEGYEYHKG
FT                   HGIVRMRAADGISNTPGDKLLSNAAIHSSLPPDTLSFPQFPLEFLEPYLPKHNDRRQFP
FT                   HVTLSYASSMDSKISLLPGMQTVLSGPEAKLMTHYLRSRHDAILIGVGTVLADNPGLNC
FT                   RLEGAGGFGGLGRMWQPRPVVVDPTGRWPVHPDCRMLRTAVEGKGKAPWVVVSPGARID
FT                   PQKLMMLKGYGGDYLRIMEYNQNWRLRWEAILRALASEGIKSVMIEGGGTVLSELLNPE
FT                   YTEFIDSIIVTVAPTYLGSGGVSVSPDSKRDQEGKPNAALNPRDVKWTPLGQNVIMCGR
FT                   IRVAPPAESPATNVES"
FT   CDS_pept        join(complement(28305..28801),complement(27917..28230),
FT                   complement(27578..27811),complement(26552..27445),
FT                   complement(25778..26493),complement(25392..25718))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812973"
FT                   /orf_name="An14g00100"
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAK41809.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG327363"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniParc:UPI0000EFC933"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2A9"
FT                   /transl_table=1
FT                   /translation="MLIVLIWIASTVDVRRLLDKHKRHQPLNPLMTSTNTGSLFGGGGL
FT                   GAATQSSSLFGNPSGTPGLAGGTSFAKQSQAQQQPTSSSVFGQDQTQTNAPQSSSQATQ
FT                   PAFFNSLLERGKKRPISAIAQNGNFEELPSLQLGLDDIRRKARELGAGGSKEFQPHVPH
FT                   SKAHYLLAASGVSPGHALRDLKALDPQASVATPLREQDSFDPDNQKFLKNIQQRGRQVM
FT                   INESLARTQRDFDSFLEEKVDMDWEEQRRKIFQHFGLAQKDDGAGDVREKSVIGIPGTG
FT                   TASIRLFEDSIERNEGASGHSDLRFLREKMGYYADKVRLLNSARLQTRAFPVLHEFSDV
FT                   EGHAGGDVTLVERHFAQDYLDDSPNSRRAVSLRKRIVEGSRSFLEKLFYDDVENVITKN
FT                   PREAQLGGIPTVTNKIRAYIRLRAARKDLAPDGTELQMVGQDYCWILIFYLLRCGFVTE
FT                   AAEYVSQDPGFRSLDHKFVTYMTTYAQNRRLPRDLQQKINGEYQQRSRNAPDNTVDPYR
FT                   MACYKIIGRCELGRRRLDGINQSVEDWMWLQFSMAREDDRAEEIAGDVFGLEDIQADIT
FT                   EIGQRVFGKGQEGPGGYGTFFFLQILGGMFEQAVSYLGSYAPITAVHFAIALAYYGILR
FT                   VSDFYTSGEEILSFTVKQYPQINFGYLITQYTREFRTGYVEAAIDYFTLLCLNADLPGA
FT                   LGKSQASVCHEALREFILETRDFAKLLGDIRSDGSRIKGLIEQRISLIKLVDQDEFLKT
FT                   ITLQAAAIADDKGLITDAVLLYHLAEDYDRVIDIINRALSDAVAVELGGPALKLQPLRP
FT                   RTDDHELEAGGSLSLTTVDNPVVLARNMIGLYNANAMYYQRIRQVNRDACGLLLRMMEA
FT                   KLEVEAAKWTPALDAINDLSILPLRARGAVPYIRSAAQAFSSFPPIISHNVGHVIMWCI
FT                   TCIGHERERLNSGTYENEIRQGLADELLVMAKDLMIFSGMVKYKLPPKVYETLARAGAE
FT                   IGAY"
FT   CDS_pept        join(29188..29511,29577..29744)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901825"
FT                   /orf_name="An14g00110"
FT                   /product="Similarity to hypothetical protein YJL003w -
FT                   Saccharomyces cerevisiae"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="CAK41810.1"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="InterPro:IPR020164"
FT                   /db_xref="UniParc:UPI0000EFC934"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B0"
FT                   /transl_table=1
FT                   /translation="MPVFQAKTFRRATTASSTLGERIGAAYRAHLTKRPFLLFGLPFIM
FT                   IIVAGSFALTPAAALRYERYDRKVKQLSQEEAINLGLKGPDGDEGIKRNPRRRIIGDER
FT                   EEYYLIQYHCYSGSWPKILMIGSKREYNASKANPMGNSEMRHACFNNNPDMVHYLVVAT
FT                   "
FT   CDS_pept        join(30179..30228,30319..30427,30726..30787,30853..31171,
FT                   31234..31431)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901826"
FT                   /orf_name="An14g00120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41811.1"
FT                   /db_xref="UniParc:UPI0000EFC935"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B1"
FT                   /transl_table=1
FT                   /translation="MREGPRLSHWLICLDLGQLAVTLYGPHYVFRLFWTVATRAKSAGY
FT                   FVKALLPPGKECWGYDGLATPFPVPGGSDLCHQPITSYPENDVVPSGFLTSPFALPRSL
FT                   SRLLAPNPPTCLNDGCGSVISAISLCPPLSSSQVFHWLRILLCWKYELWAPSVRRGIPA
FT                   TAALVKRTRLLMPFGISDTAISSEPPENLLFARPITQCDYHRLQLFLYLPLRIYPFRPS
FT                   SQPDPSKTGWRRVTSQAYALIQA"
FT   sig_peptide     join(30179..30228,30319..30325)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B1 "
FT   mat_peptide     join(30326..30427,30726..30787,30853..31171,31234..31428)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B1 "
FT   CDS_pept        join(31696..33126,33211..33936)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966136"
FT                   /orf_name="An14g00130"
FT                   /EC_number="3.1.3.48"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAK41812.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG327383"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI0000EFC5D5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B2"
FT                   /transl_table=1
FT                   /translation="MSAMTGTRSPTSPWPPECQNLQLEGSSTPSALFALRESQMSPLGH
FT                   GINPHNSVSDRSGPNYFSISVESPGNPRRSREAISYTQPPVSSPKAQLLSKNKAFDDYV
FT                   GLPKTGTVADDEHRESPVFRLSWNPSLQRRSPMPSRQDASPLKQTSAHGCGVSVERCAE
FT                   LLESSRRDVMLLDVRPYAHFAKGSIKGSLNLCIPTTLLKRPSFDTQKLTNTFTNESEKQ
FT                   IFAGWRRCRYIIVYDAATSDMKDASPLMNVLKKFTAEGWSGEGLILLGGFRAFSSRFPT
FT                   FVQGQQVPVSDTPAGRPSRMHIDLPSVAPVAGGCALPESSHAAIPFFGNIRQHMDLIGG
FT                   VGQIPLQVPHSFSESKKRLLPPWLREVSESTDKGRKVSEKFLSLEKKELERMKKALSYE
FT                   KSADASTIGGSSETFRVAGIEKGTKNRYNDIYPFDHSRVRLQNVSPGGCDYVNANHMKA
FT                   AYSGKHYIATQAPVPDTFNDFWRVVWEQDVRLVVSLTAEVERGHVKCHPYWESGNYGPC
FT                   QVNNFSQKFIYLDAQDPQPTDMELDKPEDSGSPYIIVRHFGLSHSSFPFQPLREVTQLQ
FT                   YPHWPDFGTTSQPTHLLKLIEQCDKVIAATTGPHPGSRDGHANSRPVLVHCSAGCGRTG
FT                   TFCTVDSVLDILKRQRSAAHASGGNPNQWTHTDNVDLIEKTVDDFRTQRPSMVQNLSQF
FT                   VLCYESVLEWTVAQMGKEQDIGGC"
FT   CDS_pept        join(34709..35507,35577..36454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660182"
FT                   /orf_name="An14g00140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41813.1"
FT                   /db_xref="UniParc:UPI0000EFC5D6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B3"
FT                   /transl_table=1
FT                   /translation="MILNLPPELIQLVLQKCSTPAFLEAAFSCRTVYEIASTCREVLVH
FT                   HLRRTPGLVNRDLSSLSSKGLFRLLTKNAFQQLYGAQYHANRVTYEFGNDVLDVKASTF
FT                   ASFDHQTLALVARGWEKVYLFHIDHGHLRPLSEVNLPCNHPGKGEVLKTAFDGSGGLYV
FT                   LQRFVPAMDATDTNANHPFIKQAMQSNINGMHYLSYHSLDSPGEPVRVCTFPDHVNYKP
FT                   LALAAMQGGSFVISWQHNHDYSENEVVLYTTSVDPHSSAKSDVIDVTYDSCVLLEGTRQ
FT                   GFEGDRFTQSRNTQGRLLPGKGPVVGLAFNDRSSQLLYRYRAQALYGSFQKIDILPFPT
FT                   QSVLYENSCPVQFSDSLTLLFSIGIPFSGTHETRVQNGLLRCHWKYLSFGIATHREEDW
FT                   TVACLLRSEAVCRASNCEHILHLERGRRLPDWTIVARLRGFENSNTSLGCIVAASRLGT
FT                   RIAVANWKTVYIWALEPGAVIEQNATGFYPDSSWPPGVEVVDLEPVSISLGAVCFQLRF
FT                   GLGENDLVAITDRGLVYCDLNPSGSSHRTTYQLRMGIEPGS"
FT   CDS_pept        join(complement(37289..37848),complement(37149..37212))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901827"
FT                   /orf_name="An14g00150"
FT                   /product="Similarity: the ORF shows strong similarity to
FT                   EST an_3574 from Aspergillus niger. "
FT                   /protein_id="CAK41814.1"
FT                   /db_xref="HOGENOM:HBG327395"
FT                   /db_xref="UniParc:UPI0000EFC5D7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B4"
FT                   /transl_table=1
FT                   /translation="MRPFYFNLLPALSLFSLSAATTTSSQPLSAEILCWPVASPEPSVL
FT                   AHVSYDSATLQPELTFPSTNIVAACGDHEPQDESNDLIRLGLYTSTSTNTKQWVGTLVS
FT                   RSSLIGGETDRPTLRLHVGPSNKIYYVDLLSSTSSISSSTPVSPKLELLSNQAGPRPHL
FT                   NQPIVLGPDGKNTEEVVEKTIFQKYWWVFLIITFLAMSGGGENQ"
FT   mat_peptide     join(complement(37289..37773),complement(37152..37212))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B4 "
FT   sig_peptide     complement(37774..37848)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B4 "
FT   CDS_pept        join(39008..39229,39312..39872,39969..41024)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000222136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966137"
FT                   /orf_name="An14g00160"
FT                   /EC_number="2.7.1.47"
FT                   /function="D-ribulokinase activity"
FT                   /protein_id="CAK41815.1"
FT                   /db_xref="GO:0019150"
FT                   /db_xref="HOGENOM:HBG294587"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI0000EFC5D8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B5"
FT                   /transl_table=1
FT                   /translation="MASIPQMPYRRPSRQGSRQASIDTRDEIQVRVDHYIGIDVGTGSA
FT                   RACIIDSKGDIVGLASENIGLWQPQQGYYEQSTNDIWRCICVAVQRAISQHNIDPETVR
FT                   GIGFDATCSLSVFSNVTNEPISVTGPNFNSDRNVILWLDHRPVDETERINATNHNLLRY
FT                   VGGKMSIEMEIPKVLWLKNNMPKELFDQCKFFDLADALTYIATGAEQRSFCSVVCKQGY
FT                   VPVGVDGSVKGWQEDFLNEIGLEDLSEDNFKRMGGVDGVNGDYLSAGELVGTLCEKAAS
FT                   ELGLPPGIAIGSGVIDAYAGWIGTVGAKVDLESEQLSSDIAKNDKAQAFSRLAAVAGTS
FT                   TCHLAMSPDPIFVPGVWGPYRDTIQPGYWMAEGGQSATGELLKHVIETHPAFNQALSIA
FT                   ESYNANIYEYLNEHLKELAHDQKAPSISYLGRHVFFYGDLWGNRSPIADPGMTGSMIGI
FT                   TSDKSVDGLAVHYYATLEFIALQTRQIVETMNKAGHRITSIFMSGSQCQNDILVKLIAS
FT                   ACDMPVLIPRYIHAAVCHGAAMLGAKAASADAEGKTEDLWSIMDRMSKPGKKVVPTTDE
FT                   TEKALLNAKYKVFLEQCYKQQEYRALVDQAVASWTS"
FT   CDS_pept        join(complement(44924..45062),complement(43027..44867),
FT                   complement(42030..42962),complement(41804..41967),
FT                   complement(41484..41719),complement(41331..41416))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170275" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901828"
FT                   /orf_name="An14g00170"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK41816.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG398302"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniParc:UPI0000EFC5D9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B6"
FT                   /transl_table=1
FT                   /translation="MSNNEEREDQGPSHPIDPVESSNVDNEDMSSAARRQRNATQSRRN
FT                   YGTLDSPARMDLDPRLEESQPESSSRMPTSQSTSTPPLQSDRPRKPSVTRRMSSKRQVP
FT                   HKGQEFSTEDDVQEVEEDIALQHASNPQSSPRIRPLRKQSSTLRRRINARMNSPLIQPE
FT                   TENESEEGIGLPDPGAEIEPSAEQSESGSPDSNDNNEEDEAETSDAESFTLKDRQQAIN
FT                   ETHPFGIRLWKPALYKKSRSVEKTAEGDIHSSPGGRVGNLLFLTNLLWTVFFGWWLALA
FT                   ALTGAIACFVFAYSPSALEYGRVFSGLSWYLIYPFGSFVRLDTDENYAEEDEGEGRSIS
FT                   EYEQWQNGDLEHGRLFFGPRRNRSLVGRRRNSIDSASEQDSLLGRTQRGSPRESPLSHP
FT                   KRRLFGRGEWTLGRVVFFVFFYFLVGPLMLLVSLLCWLLVFWIPMGRVTIILFDHLRRH
FT                   PLALSYHSDTTYTRLSPGSSSSVLLCTYRAAGLRYWKYTVGGTNIFLINLLGVVLFVIF
FT                   DYFLLSETLGLQSAITHPGLIFTLALVSIIPLAYFIGQAVASISAQSSMGMGAAVNAFF
FT                   STVVEVYLYCVALTEGKGQLVEGSIIGSIFAGILFLPGLSMCFGAIKRKTQRFNVKSAG
FT                   VTSTMLMFAVIAAFGPTLFYQIYGSHELNCRLCVTTVGTEDSDCRRCYFSQTPAVNDSF
FT                   FRKAVQPYSWFAAIFLFLSYVIGLWFTLRTHAALIWATEVEEKKAVALANEQAAYEARH
FT                   GDFPHIPAGSTGGSITKGSVRDSQLYKRILGQSLKQVGLSDNPNDHNAQSDSTSSLQGK
FT                   STTPYLVPPRTEGDDSNPRLRKFTGLSNEDNEDLVRQVTEVAATAAAVAARDAARTRKP
FT                   VAQQASTRQATKSPADQVKTLLEESEDIGLEPGHTSGGHDAPNWSKTRSSIILLGATIL
FT                   YAVIAEILVNTVDVVLESVDIDEKFLGITLFALVPNTTEFLNAISFAMNGNIALSMEIG
FT                   SAYALQVCLLQIPALVLFSALYARVIDPSELLSHTFNLIFPQWDMVSVILCVFLLSYVH
FT                   GEGKSNYFKGSILVLTYLVVVIGFYLSGYSNLETMGVDRFDTLALGSSPVEKYYTIGEG
FT                   SKSVHPKVEADNFAEGYACITGPAF"
FT   CDS_pept        join(46230..46464,46553..47228,47305..47563)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117170"
FT                   /orf_name="An14g00180"
FT                   /product="Complex: RPT6 is a protein of the 19S particle "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK41817.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0000EFC5DA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B7"
FT                   /transl_table=1
FT                   /translation="MALDNYYRNKIESMKLEIIQGQAVLRRLEAQRNDYNSRVRLLREE
FT                   LGLLQQPGSYVGEVVKVMSTKKVLVKVHPEGKYVVDIADGVDISKLTVGKRVALLSDSY
FT                   KLEKMLPSSVDPLVSLMMVEKVPDSTYDMIGGLDQQIKEIKEVIELGLKHPELFESLGI
FT                   AQPKGVLLYGPPGTGKTLLARAVAHHTDCRFIRVSGSELVQKYIGEGSRMVRELFVMAR
FT                   EHAPSIIFMDEIDSIGSSRIDSAGSGDSEVQRTMLELLNQLDGFEPTKNIKIIMATNRL
FT                   DILDPALLRPGRIDRKIEFPPPSVEARADILRIHSRSMNLTRGINLTKIAEKMNGCSGA
FT                   ELKGVCTEAGMYALRERRVHVTQEDFDLATAKILNKHDDKEVAVSKLFK"
FT   CDS_pept        join(51811..53427,53510..53532,53588..53680,53745..53781)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170286" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660183"
FT                   /orf_name="An14g00190"
FT                   /product="Similarity to hypothetical protein At2g17590 -
FT                   Arabidopsis thaliana"
FT                   /protein_id="CAK41818.1"
FT                   /db_xref="HOGENOM:HBG327417"
FT                   /db_xref="UniParc:UPI0000EFC5DB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B8"
FT                   /transl_table=1
FT                   /translation="MSSGELWSTLVTAIDPGSTKAMPIILQSTIDLLETELAKARAALH
FT                   EIQPTASSLFTKRDELALGAVAAYRQNLIDRAPDFFYGASRLTPKELGLVPAVREVQAD
FT                   DEDDDHVKTASKQHLQPVQPVAPKRATLADVLSNSLILDHMAPYLSTPSLLALASTSRQ
FT                   VRSSIVDTPYIFRHLDLTQCRGAKPGSTSDSVEQAWSGERAEDSVVEDEFYSAPLRSIF
FT                   ASLQRQSLLQDVRTLVLDGLSVPAGLVAEIILTDRFNVNILSIRECRHLNERKLMQVLT
FT                   HAVRPSRPKGTPRVKGIYHFTPLHQSRAVVRSRYRDWWSSRCGSQSSCITPGSENESAT
FT                   TELAEIATQQQDAWYHPSGQLFKQSIEDGWAETIKQCEGIIAFDAVLCRGPRHDVDLSP
FT                   PMPEGQGVSQPEGRPPLEPKLATVALGPRGCDGCHTSPEGPTFWGQSPDENLPLLTPPP
FT                   LHSSSAVKAKRPVLIPDEQPSLIARCTDCLTDRWCHRCNKWFCEDCLPHPERVRNNLSP
FT                   HQTAFRNPQSSPSSTEQSEDRETAGNAVPRVLSARRNASERAKAAVVNIVLSIMRAVRR
FT                   RCAIGAMPVPGIG"
FT   sig_peptide     51811..51873
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B8 "
FT   mat_peptide     join(51874..53427,53510..53532,53588..53680,53745..53778)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B8 "
FT   CDS_pept        54413..56740
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812974"
FT                   /orf_name="An14g00200"
FT                   /product="Similarities to several ubiquitin fusion-
FT                   degradation 1-like proteins"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAK41819.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG327424"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniParc:UPI0000EFC5DC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2B9"
FT                   /transl_table=1
FT                   /translation="MTGNQGSLRWSSQLTVAPAQQIPKLSGDKIILPPSALEQLLAAAP
FT                   LQEVTSSGPARPYTNTFDPFNPHTFAAESQARERAVDRQQQLPHPLTFRIVNPQNDRVV
FT                   YAGVREFSAPENEIGLSTFLRGALGIDGTRQPSPHGGDGNDGDVTDNAPAAPTTVTVHA
FT                   QQLPKGTYVRLRPLEAGYDPGNWKALLEQQLRDNYTTLTSGEVLTVAGGRNQSFQFLVD
FT                   KVEPHGNGICVVDTDLEVDIVALTEDQARETLEKRLEKSSRVSANRAGTSVGGELRLGQ
FT                   VVSGQVALGDYVDYEVLKWDPSNALELSVKGADDVDLCLFASPLSARQRNRPREDEHVF
FT                   GDLSNRPTKRIRIQPTNVDMEGAELLYISVHAPTSTDSSGNGLSALPYSLQVHVGSSPA
FT                   QAENAADSEPESREPGDVQCKNCRQWVPERTLMLHENFCLRNNILCPQCQNVFQKRSPE
FT                   WQTHWHCPHDSAYGTGDAEKNRHNHFFHSKRSCSGCGFEAEDLSRLAQHRTTVCPAKPI
FT                   LCQFCHLVVPQKSESDPEMDDPDVLVSGLTPHELVDGGRTTECHLCDKIIRLRDMKMHL
FT                   RHHDLERLSRPTPRICLNQNCGRTLDGRGTQTAVNLGLCSICFGPLYVDTYDPEGKALR
FT                   RRIERRYLSQMMSGCGKPWCQNEYCKTGKQARPSSTSGASAPLGAAAILAAVRPLLDAV
FT                   NLRGNAPNTAPFYLCTDQTGQQRRIAAEMLSTEGAVADGKTYALPWCVSAVETTAGNLD
FT                   KAREWLENWAPAQGEGTESFQR"
FT   CDS_pept        join(complement(57821..58171),complement(57118..57720))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000037706" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901829"
FT                   /orf_name="An14g00210"
FT                   /product="Complex: Yip1 specifically binds to the transport
FT                   GTPases Ypt1p and Ypt31p"
FT                   /protein_id="CAK41820.1"
FT                   /db_xref="HOGENOM:HBG611223"
FT                   /db_xref="UniParc:UPI0000EFC5DD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2C0"
FT                   /transl_table=1
FT                   /translation="MAQYYPQQQPYGVQSSAQNLQFYPSSYTSVSGHTTPSQASYGGFG
FT                   GAPNSASQAYPVGGVGGGYGGFGSPSAGVSGRMGEQGGLRTGWLAAFGTEGYDGEPPLL
FT                   EELGVNFEHIRTKTLTVLNPFARIDQHLMDDSDLYGALLYIVLYGTFLLLSGKVFYGYI
FT                   YGVAVFGTVALHLILSLMSPALDTAPVPNAADPANYSPHHKPTMSDASAAGHFSATLTF
FT                   PRSASVLGYCFLPLVLTSLVGILIPMDTLFGYLLTTAAVGWCTYSSSGMFCAVARMRGM
FT                   RGLVAYPLALFYVVFGIMGIFSSRGSGTLAAKTGAA"
FT   CDS_pept        join(complement(60334..60366),complement(60130..60246),
FT                   complement(59843..60029),complement(58578..59785))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170308" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901830"
FT                   /orf_name="An14g00220"
FT                   /product="Similarity to hypothetical protein SPAC17C9.06 -
FT                   Schizosaccharomyces pombe"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="CAK41821.1"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="HOGENOM:HBG756550"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniParc:UPI0000EFC5DE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2C1"
FT                   /transl_table=1
FT                   /translation="MSSPLSADDEDIFARLQQRADPKVLNEQQQAVDERVRAIYQKAQT
FT                   RLGELLDQNSTLPCTISSVEVHGARNTRRAFLERIFNPLLSSNQDRPYTLSEALREVSA
FT                   RADKLNRFDIFQQPVSVYLDQSEVDGSGIPSIKVHLSGKERSRVLLKTGTDLGNAEGSA
FT                   YGNLLWRNVFGGAENLNLNASLGTRTRSAYQATFDTPVLSNPDLRLELGGIASATQKSW
FT                   ASHEEVLRGGWSKFRWANSSGQQHEIGYNGFWRQMTGLTENASPTVRADAGDSVKSSVF
FT                   HSWSKDRRDSPLLPSRGYYAKMFNELAGWGPLKGDVSFWKSEIETQAAVPIPIPGIKGD
FT                   SGISLTTGFRAGLLYPLGLDSDSRPQLSRTNDRFLLGGPTDVRGFRLCGLGPHDGADAV
FT                   GGDLYAAGSANLLFPLPRVGAEKPLRLQAFVNGGRLLSLRTADKNAPTSSAEVQNAMAS
FT                   TVSELTNGLPSIAAGVGLVYAHPVARFELNFSLPLVLRKGEEGRKGLQFGIGINFL"
FT   CDS_pept        join(60773..60799,60862..60941,61012..61732)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901831"
FT                   /orf_name="An14g00230"
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAK41822.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000EFC5DF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2C2"
FT                   /transl_table=1
FT                   /translation="MATKAAFKRLTREYQNIQKNPPPYIVAHPSESNILEWHYILTGPP
FT                   GTPYENGQYWGTLMFPPEYPFAPPAIRMHTPSGRFQPSTRLCLSISDFHPKSFNPAWEV
FT                   STILIGLLSFMTSEEMTTGSVSASEAERRVLAARSRWWNSTGGGSHVSATPGVTPTAKG
FT                   INNVKAGDGGLKFRSEWPELDQENWRWMKDSRIDTNTGQLMPDPSATRCSPETSALRRR
FT                   PNGSAPGLGAVMEGGHVAREAGQSWVRRNKIWLGFAILFGYALLTRLVKDVQG"
FT   CDS_pept        join(62665..62748,62808..63481,63557..63797)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170352" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901832"
FT                   /orf_name="An14g00240"
FT                   /product="Catalytic activity: Holocytochrome c  "
FT                   /EC_number="4.4.1.17"
FT                   /EC_number="4.4.1.1"
FT                   /function="L-cysteine desulfhydrase activity"
FT                   /function="cystathionine gamma-lyase activity"
FT                   /function="holocytochrome-c synthase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAK41823.1"
FT                   /db_xref="GO:0004123"
FT                   /db_xref="GO:0004408"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0080146"
FT                   /db_xref="HOGENOM:HBG627179"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniParc:UPI0000EFC5E0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2C3"
FT                   /transl_table=1
FT                   /translation="MGWFWADSQAKPAPAAPHPVPSSDASPPPGCPMHASNTTPAMPAP
FT                   SPTSEPPSACPVRSTDSPFYVPPKSKSPESQPPSNPTTSSDTRSTLSKLNPLNYMFASI
FT                   SQERAPNQTVDLPVEREVSSIPRSDMNENWEYPSPQQMYNAMLRKGYTDTPQDAVEAMV
FT                   AVHNFLNEGAWEEIVRWERIFSKGLADGWEKCRRGEENIMMDEFKEQMSSAPKQDVPPP
FT                   RLIRFQGRPQELTPKARILQALGWVYPAKFESNPPFDRHDWFVMRQTPSGPKEVRYVID
FT                   YYSGPPEPTGEPVFYLDIRPALDTPTAAVERLMRWGGDVWWRASGASVREN"
FT   CDS_pept        join(complement(66348..66713),complement(64903..66285))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901833"
FT                   /orf_name="An14g00250"
FT                   /product="Similarity to hypothetical membrane protein
FT                   YPL109c - Saccharomyces cerevisiae "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK41824.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG327456"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0000EFC60B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2C4"
FT                   /transl_table=1
FT                   /translation="MTPGAFLQLAEDGDDDNGKTGEMQMLEVSREEVRKTVDDDARGLK
FT                   RLWQSLYVFTYCYIYDPIATGFRFVHLVIIFLPVILTAPTICFGKQLKDREGIRTGTLW
FT                   WYRFLVRSMERAGPAFIKLGQWAASRTDIFPPELCDIMSSLHSNAPAHSLHQTKRTIRK
FT                   AFNWLPFEDIFEEFQEEPLGVGAIAQVYKAKLKPNLAGTDDDIDLHPHGLRDKVRKNVG
FT                   ALVKSSPQRVPSSYVAVKVLHPRVERVIHRDLKIMSFFASLINAIPTMNWLSLPDEVHQ
FT                   FGEMMKLQLDLRIEATNLVMFREKFRSRTTAWFPYPYLDYSTREVLVEEFAQGIPLSTF
FT                   LEVGGGVYQEEIANEGLDAFLHMLLIDNFVHADLHPGNIMVRFYRPSELDLSLGNKSRA
FT                   SEAPSAEEVDVTESVLARLRPHIDNRRDWVKALDDLNAEGYRPQLIFIDTGLVTQLNDL
FT                   NRRNFIDLFRAIAEFDGYRAGELMVERCRQPDAVIDPYYFALGMEHLVLNIKSRTFALG
FT                   SVKIGDVLSDVLSMVRKHHVRLEGDFVNVVISCLLLEGIGRNLDPNLDLFKRYIDPLAL
FT                   LFHTAH"
FT   CDS_pept        join(complement(69359..69719),complement(69139..69273),
FT                   complement(68962..69081),complement(68731..68904),
FT                   complement(67446..68650))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170376" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966138"
FT                   /orf_name="An14g00260"
FT                   /product="Function: GDS"
FT                   /function="binding"
FT                   /protein_id="CAK41825.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG327466"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000EFC60C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2C5"
FT                   /transl_table=1
FT                   /translation="MEPPSDRTDVPGSMQGSDQQSELTPGTAGSAHRVQCPSLSQVLSE
FT                   LASLPPASTLAAIEPLPSEEQKNLFESLQKSLKAAENANILDALKDTPDILQKLWKCRS
FT                   PYLVPAAEAMANGSRAPLWRVSYGKIGVFNFFLQLIASKETIDNRVILHALRLVGNSCA
FT                   DTNDNREIVVEHNYTAAILQHSSNPELIQVVIPVLYNICIDFGPAQTQLAADKIVYILL
FT                   KLVKDGAFKDNDALLDYVFELVELVGEQGMTSPPLLQFNANYVASTPARFSGLVSGLAT
FT                   YLNNTRFQEICISNYIVPNILAVLSRSLTFNTESSGEDTQALAQSRLKINQILAEISGS
FT                   TSFAQYYPLDSPLAQSLKTWLTSTEDQLQICSCVILGNLARSDATCERMVQDLRIHEEL
FT                   ISVLKSDVRGAVLHSALGFVKNLAIAGNNRLVLGEAGILPAVSRLWQYESVPQVQFAAT
FT                   SIARQVTVAAIDNISRLLEGLARDGTDSNDERTYLSLLLALFQKTDSTPIKTEIGRTVA
FT                   SICRTLVPKSREGDPTAAALLSRFFDLHEDIALPVGAMIAQSQWPVVRSEGWFAMALMA
FT                   STKAGAMAVSRSLQKMQILPLLEETLSAETSESTEETEQMQAKKDRDNISVLVQELLKS
FT                   DVSLFSKFEIPTMIDIDASLPARHACRNR"
FT   CDS_pept        join(70607..70654,70735..71085)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812975"
FT                   /orf_name="An14g00270"
FT                   /product="Similarity to dolichol-phosphate-mannose synthase
FT                   DPM3 - Homo sapiens"
FT                   /protein_id="CAK41826.1"
FT                   /db_xref="InterPro:IPR013174"
FT                   /db_xref="UniParc:UPI0000EFC60D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2C6"
FT                   /transl_table=1
FT                   /translation="MTRAQQTLSVLLLVSSLYLVLYLGLVPLNETVQTEVIPVVRSSSL
FT                   TSATNNPPPPPIYNISDSQFHTYSLLIIAPCHSQLPFYALICFGCYLLGRLGLAILTFN
FT                   DVPEAHDELQKEIEQAKAELRRANVDVD"
FT   CDS_pept        join(complement(72886..72918),complement(72546..72652),
FT                   complement(72169..72481),complement(71986..72098),
FT                   complement(71876..71924))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117171"
FT                   /orf_name="An14g00280"
FT                   /product="Similarity to hypothetical protein YJR133w -
FT                   Saccharomyces cerevisiae"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAK41827.1"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG327482"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniParc:UPI0000EFC60E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2C7"
FT                   /transl_table=1
FT                   /translation="MPQKVYVTYNQVHKLCQASADKILDTFQPNLMIAIGGGGYIPARI
FT                   LRSFLKRPGEPNIPIQAIGLSLYEDLGRGDAEEVPGTKVTRTQWLDLSSLEMANLIGKN
FT                   ILIVDEVDDTRTTLEYAVRELQKDVEIAQKQLGREGEKTNFFVYVVHNKDKPKKGVLPE
FT                   DMMTSGRYHASVTTADVWICYPWEAKDIDEHDRLAEENPLV"
FT   CDS_pept        join(complement(75215..75347),complement(74836..75151),
FT                   complement(74355..74765),complement(73942..74290))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901834"
FT                   /orf_name="An14g00290"
FT                   /product="Function: The mae1 gene encodes a permease
FT                   involved in the uptake of L-malate "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK41828.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniParc:UPI0000EFC60F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2C8"
FT                   /transl_table=1
FT                   /translation="MAYPQSEAETRPSGLGWKKRIRHITWAFFTLTMATGGIANVLYFV
FT                   PYRFRGLETIGIIFFLANLFLYLLIWCLLITRFYLYPYTFKASFLHPTESLFVPASLVS
FT                   FGTILINISQYGPDHTGPWLTYAVGILFWIDAALAVISSAAIYLILWSTQTFTIAQMTP
FT                   IWIFPAYPMLIIGPHAGILSSKLEPARSLRIIIGGTTIQGVGFLVSLMVYSAFIYRLMS
FT                   QKLPRENVRPGMFVSVGPSAFTVSGIVNMAAHAKRSFPEDFMGNGALAADIVKVVANFS
FT                   CLWLWGLAIFFFFIASFAHWSAIGPGRMVFSMAWFSFVFPNTALITATFAIGKAFSCKA
FT                   ISIIGCAMVFPLILMYIFVFYMMVRAIVHRQILWPQKGEDKDEGGFEVNRIKPESPGEI
FT                   TPV"
FT   CDS_pept        join(78064..78107,78192..78416,78470..78477,78528..78679,
FT                   78737..78831,78892..79142,79237..79349)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18117172"
FT                   /orf_name="An14g00300"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41829.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000EFC610"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2C9"
FT                   /transl_table=1
FT                   /translation="MGGTEDGRKSVLITGCSPGGIGNSMAREFHRNGLRVFATARDAKT
FT                   IEDLASIGIETLSLTVDDEESVRRCFAEVKGKLGEKGLDYLVNNAGRNYTVPAMEAELS
FT                   EIRDTFETNFVAVVHICQTFLPLLMKAKGTIVQIGSVAGVVPYVFGSVYNASKAAVHSF
FT                   SDALRVELAPFGVHVTTVITGGVQSRIARVKRTLVPGSIYAPIEDEYNRRVVHSQAGAM
FT                   PNEAYARSVVTQVLYGSAPWRWIWPWAQGRKSWIWEDSEERLENETGEDGMMAGKSGLL
FT                   DGALVDPSGLSFQM"
FT   CDS_pept        join(80033..80086,80173..80256,80325..80397,80464..80563,
FT                   80623..81168,81231..81277,81330..81622,81697..81831)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660184"
FT                   /orf_name="An14g00310"
FT                   /product="Catalytic activity: GTP + succinate + CoA  "
FT                   /EC_number="6.2.1.4"
FT                   /function="ATP binding"
FT                   /function="succinate-CoA ligase (ADP-forming) activity "
FT                   /function="succinate-CoA ligase (GDP-forming) activity "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAK41830.1"
FT                   /db_xref="GO:0004775"
FT                   /db_xref="GO:0004776"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="HOGENOM:HBG315432"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniParc:UPI0000EFC611"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D0"
FT                   /transl_table=1
FT                   /translation="MFKLARSKPVTAALRAATESSVQSRVAQQQRNLSIHEYLSANLLK
FT                   SYGIGMPKGEVARSAEEAEAVAKSLGNDDMVIKAQVLAGGRGKGTFDNGLKGGVRVIYS
FT                   PTEAKMFASQMIGQKLITKQTGAAGRLCNSVYICERKFARREFYLAVLMDRASQSPVIV
FT                   ASSQGGMDIEAVAKENPEAIITTPIDIKVGVTDAIAHKIVTELGFSEQCVEEAKDTIQK
FT                   LYKVFMEKDATQIEINPLSETSDHKVMAMDAKLGFDDNAEFRQKEVFSWRDTTQEDADE
FT                   VKAAEHGLNFIKLDGDIGCLVNGAGLAMATMDIIKLNGGAPANFLDVGGGATPAAIKSA
FT                   FELITSDPKVTAIFVNIFGGIVRCDAIAQGLINVVQEMGLRTPIVARLQGTNMEQAHKL
FT                   INESGLKIFSIEDLQSAAEKSVQFSKVVKMAREIDVGVEFTLGI"
FT   CDS_pept        join(complement(84024..84103),complement(83730..83895),
FT                   complement(83263..83618),complement(82278..83196))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217275" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966139"
FT                   /orf_name="An14g00320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41831.1"
FT                   /db_xref="HOGENOM:HBG327508"
FT                   /db_xref="UniParc:UPI0000EFC612"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D1"
FT                   /transl_table=1
FT                   /translation="MAADAAPIQQIITLFTHLNTNSARHDAYHRILDLLNPHEWRDVQK
FT                   RINQRSFQKDILAESPPEIAVQIAQYLDLSDLFILQRLLSSELIQGAVYQQYTGHVGAA
FT                   AHVLTNHFTQYAKYRIRLERGLPICNLQAPNLFPTDGSKLECLDYASGRCAWLDNGTHV
FT                   VVHDLCKRSTQRFCTENRDSFWDLRLSDSMVVAISARAHPAHPESRYCHAWNLETEEHA
FT                   SFRIPAFSFRAFVVTGLKVALSFINHSAAGDEESKIYYWDMSSRTARTIQIAPHLALIG
FT                   LQPTTNSVTTLLLERGDDPTNPHHSPWDRLRVVKHTFDDHGRTTSPLPSYTLHLPFPIQ
FT                   PGWTIADISDSSTNNLAVFNCTPPPQPSALSATTTTTTLHYVLVVSYDPQRDQIHVHTL
FT                   PQEEGTPYFPFCKTALDSDLLYYVKSDRGKPAIWISSPASRIPHRPAESMSLGLPREAS
FT                   NAIYTYANMFTLYGDRDFVLLVHETDVKVWRFKDTQPPESVNLALLAA"
FT   CDS_pept        join(85803..86152,86272..86370,86437..86504,86566..86909,
FT                   86983..87052,87113..87915)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170398" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901835"
FT                   /orf_name="An14g00330"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK41832.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG324444"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000EFC613"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D2"
FT                   /transl_table=1
FT                   /translation="MSGLADPPSRSPLILTAIDAPGKTRKIPVLASSVPPSSQSTGDPM
FT                   EVTPPASGAAPPIHSSPDSDRAGANNTTATSNGSTEPSNVNHHAAPTQAIGAAAAAQQP
FT                   KVVQTAFIHKLYNMLEDPSIQHLISWSSTNDSFVMSPTSEFSKVLAQYFKHTNISSFVR
FT                   QLNMYGFHKVSDVFHTGSPDSALWEFKHGNGNFKRGDLVGLREIKRRASRHALIHRDSF
FT                   PGHKAAASQPGTPAEPVPDVTESRLMNLEHSMYDLHARLRNAEEGNATLNARCQSMAES
FT                   LTRCYHWTHSISRFLQGMIPDRESLLYRDVATMQAELEKHLEAVRALEHPPDPYLAVRQ
FT                   PYVTGISGDAGPPLSPRQMPPEESRRPSMLDPSRAGMIRPPVPPHLAVSPRRYGSIGTG
FT                   NSSPSYNRSQVPTVVTPQQPMPHPLSSVSSPPGPNLARRHTSADIRQHGWPPTGVSPFP
FT                   TAHPPPQPANPWSPSRHRTPTSSEQSVRDVLAQYEMGAPRRLQETRHPTPPLHPDQNPP
FT                   TDNGWSLGPRFPRHESSLPATRRSSMASNVHSLLNPADTAERPDEDQHAMADDRKRKRL
FT                   E"
FT   CDS_pept        join(complement(89287..89471),complement(88637..89144))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170409" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901836"
FT                   /orf_name="An14g00340"
FT                   /protein_id="CAK41833.1"
FT                   /db_xref="HOGENOM:HBG327517"
FT                   /db_xref="InterPro:IPR021641"
FT                   /db_xref="UniParc:UPI0000EFC614"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D3"
FT                   /transl_table=1
FT                   /translation="MSASKSQTDIILNKANVALARSQRLVASWLPAPTADDQANSKKTE
FT                   EELQREEDEIFTAVPETLGVGAPLPTKAADGSWNRSELDSNDKLRKQLLGRNYQKVMAA
FT                   KKASTAKGGGSDAAASTNPAKNGVAKGEEDDEDEEEGRTALIGRKKAMPAKKRKAAEPQ
FT                   AQSESETIGGESGESKQTSDVGDGSEAKADQSDKQPGASSRPASRRKKATSFLDEILAE
FT                   RSKKRKKR"
FT   CDS_pept        complement(89981..90751)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170420" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966140"
FT                   /orf_name="An14g00350"
FT                   /product="Similarity to hypothetical protein YPL107w -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAK41834.1"
FT                   /db_xref="HOGENOM:HBG327524"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniParc:UPI0000EFC615"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D4"
FT                   /transl_table=1
FT                   /translation="MDAPCLAIRSSLLRRCHVCLSGSRIPDASRLTRPRAVTPFIRRSS
FT                   TRRYATVQDTQAGNVSDSKSRQAHPLSGYYYDILSTRSPYRHHATTDSKTEEPKPEAQT
FT                   PQEKMAIVFGTRLAGPGRSSRYDPGSAPDTTWKTINGVAIPPRPEEPDNCCMSGCVHCV
FT                   WDDFRDELEDWAFRLEQAKAKGATKSNASDMRHTPRAEVNSASMSMDDDGGGSETNWSA
FT                   PTSDDDLFASIPVGIREFMKTEKKLKQRHQQESA"
FT   CDS_pept        join(91190..91935,91989..92955)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170431" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901837"
FT                   /orf_name="An14g00360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41835.1"
FT                   /db_xref="HOGENOM:HBG324442"
FT                   /db_xref="UniParc:UPI0000EFC616"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D5"
FT                   /transl_table=1
FT                   /translation="MQKPNQARSRALGLRDRKALRPSLTSTASPLGSLKGSKQSPVSSL
FT                   SGRRSSGLAAFAAPPRRVSTRITASDLMFRSPSASQQSTEKVPPPTDTPENQLASELDS
FT                   ATGDIDANEALQQPSFQDILDEPDLPPTPTQLGLERPPGRPKGLLSSSPSSQPGKWGRR
FT                   RNTDGREQSPSKLRKVDYGEAGESAESGLLLDRTSLPEEILMKRKLKNKLASELQQLKK
FT                   DILELETWSKDLAQDDASEERDLTGLITLLATSYPPQSTPTASGETSISTLISSLLPFA
FT                   TKGPPRPPPEAPPVNPFALGEHAQTEAYLTALAPLQLTAYSESIPSTPDLVLERHTLQF
FT                   SAPSPFPSNRYKVFVTCDVNPETQSLVSISSASQMTEEDARTPEDLRRWIDARLANPLL
FT                   KLDVTGLCWGINRYWEAMVSRAELWLHMEEQHAELISGNAKENHETKTKSASSQPLGLS
FT                   ELRQILPHLERTSMLFESKNGSPKVLVSCQLTLDEWTSEPQLAPGLSVSLLSESDSGSR
FT                   RKVDQESKRLFQSILNPNENNQAGSSGSGVPASAILRATDCVLRALLGTNSKK"
FT   CDS_pept        join(complement(95038..95040),complement(94885..94918),
FT                   complement(94735..94781),complement(94435..94593),
FT                   complement(93856..94290))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170452" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117173"
FT                   /orf_name="An14g00370"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK41836.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG601563"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniParc:UPI0000EFC617"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D6"
FT                   /transl_table=1
FT                   /translation="MAIKHNNQILNQHFHKDWQRRVRVHFDQPGRKHRRREARLAKAAA
FT                   VAPRPVDQLRPVVRCPTVKYNRRVRAGRGFTLAELKEAGIPKKLARTVGIAVDHRRVNY
FT                   SKESLVANVARLQDYKARLILFPRKSGQFKKLDSSAEEVNAAKAAFAEGKTEGFATRVG
FT                   GALPIKNATLEEAVTEVKRDDLPKGEEAAYRRLREARSEARYKGIREKRAKAKAEEESA
FT                   AKK"
FT   CDS_pept        complement(96066..97505)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966141"
FT                   /orf_name="An14g00380"
FT                   /product="Similarity: protein homologues are due to
FT                   repetitive sequence of the ORF"
FT                   /protein_id="CAK41837.1"
FT                   /db_xref="HOGENOM:HBG327543"
FT                   /db_xref="UniParc:UPI0000EFC618"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D7"
FT                   /transl_table=1
FT                   /translation="MSQDPDSQLSQGPLAPPAEITGPATPMQRASLSASPDLSVGAGIP
FT                   VSHSDQSKSVSPSLPSSDMTPPPSSQIPGAPRQRSRSTSSSLLASPPDIQKTLCVAYGA
FT                   SENLPTADDIDTADESKLRAMAKDLLSVAQEARMSALHFKLQNSLLSFTSNEAIKRAEV
FT                   EHQLARREVEIIQSSEYRSRHCQPEVKAVQQISNVELELALKRNQELGRVNATLDRRLR
FT                   RAKKLIEQEKERSDLLEEENKLLKERIRDNRKHFSQMIEHGPMSPSPQREIQASHRRPV
FT                   PHYVEHDGRQVNGSDSHDPFAQLLAADRVLNRGSPSVISTPHRSRTYKQHNDGQMRGNH
FT                   TLPSVPMTPSRARMAPGGNQYSTPGKESHDSHRDRDSTISASDIEEAETEEDIPASEAG
FT                   ALASNMLRSHAFSNRRESRGITNAPKSSTLLQTKLFGQVRKSGVERPSFGLKRKASFDG
FT                   ATSKKMKAEERVGLGIDTWNN"
FT   CDS_pept        99702..102686
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170464" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901838"
FT                   /orf_name="An14g00390"
FT                   /product="Remark: a putative human homolog of soc-2 of C.
FT                   elegans"
FT                   /protein_id="CAK41838.1"
FT                   /db_xref="HOGENOM:HBG327549"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI0000EFC619"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D8"
FT                   /transl_table=1
FT                   /translation="MDNPQKTPSRPSGIPRLASRLPLPTSAASKPLRPSPSREKLQTDP
FT                   GLHASRLSRPSQEPVFKKPLPKYTVPKKSLGTQRQEREISQTRTSDTGITEPEGALNNK
FT                   SLYLEADNVPAHDAEFRGRTRPSLSERTIETLSQIPPSPRPQSRQSSSFFGATSPMRSP
FT                   SRPPSAMTSYSRSPSRSSSRQPSGSDYLSRPPSSMRLPSRSGPSFSANSATSDQSSIPN
FT                   TDSPSKLKPPSTRITPYARKNDVTLSSNPRHAPTRVSTRPTEPTVDAPQQRLEVRKTRK
FT                   VQQGLSGQKPSLMGSRSPSAKSTSSDLTPEQQTEMETRKVSKSSSALRESIAKAKAARK
FT                   AEAQKTTESTTAAGGFNFDTDDPFNQGPKDPNHGLLRKRIDAGRTSGHLNIAAMSLKEL
FT                   PKEVMTMYDFDSNSTTDWYESVDLVKLIAADNEFTELPDDAFPDIDAHELDPEVDERGN
FT                   QFGGLELLDLHGNILQSLPVGLRRLERLHTLNLSNNNLNMDDINVVMELETLRDLRLAK
FT                   NKLQGGLTPDIGRLSNLEVLDLHENSLTELPGELAKLASLRVLNVGNNQLSALPFEQLY
FT                   MLPLKELHAPRNKLKGTLLPASVQKFETLQILDVASNALVRLSENEDLELPNLQSLAIN
FT                   TNRIQSLPDVSSWQALLTLLAEDNSLSDLPHGFTGLKNIRNVDFTGNDISKLDEKIGLM
FT                   ESLVNFRIANNPLRERKFLSMNTEDLKRDLRHRCEPEPQDTDDEGSVATQFTLAPETPV
FT                   QTASWQIKSGGVLDKSYTDLREIEVQELERIDFHEVRCLQLQHNELECFPVPALSMLAS
FT                   NLADLDLSNNPLNSGSLFSGPVTLPSLQNLTITAAGLTTLEPLLSYLTAPGLIYLDVSS
FT                   NRLSGSLPVVRRSYPNLTTLLASDNRISNLDFEAVQGLQVLDVGNNDIGVLPPKLGLLR
FT                   TEGSSKNWGNGSPLRRFEVAGNSFRVPRWQVVAKGTDAVLEWLKDRIPEEELREWETGD
FT                   ESNDE"
FT   CDS_pept        complement(102941..104047)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901839"
FT                   /orf_name="An14g00400"
FT                   /product="Similarity to hypothetical protein SPAC22E12.18 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK41839.1"
FT                   /db_xref="HOGENOM:HBG327558"
FT                   /db_xref="UniParc:UPI0000EFC64B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D9"
FT                   /transl_table=1
FT                   /translation="MSEKLQSTLTTSLTLLEQFQGAIASPSSDISSSTDLSGKDALPLL
FT                   SAASTTLKSQVTKLSLLTITSPFTPSAVTSVINALNESVLPSLVAAALLVTPAHHTKAF
FT                   QSEVHVLTQTALKETTALLQEVQTVAKKAEDAQKKEAGLSQSEKDVVTVAAGRLWDSCD
FT                   VLIDIAAKGVVGFVVRRVEEWRDLVRDAVQEIEEWDPNEEGDDFFDDLLSDDGKGKADE
FT                   DDEEDEDDDDDEDTAALQEQKKSALRILKPVSQIYPTISANRLKKTSDSPSLVGKLESL
FT                   MKYLQQIPGHVDEVAGALYEANTEKSLQYMRITKDCAVKAVNLASLPLDVTDSADAPQE
FT                   KEDKFTTWARTWLKVMDQVSKSVIDATQ"
FT   mat_peptide     complement(102944..103975)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D9 "
FT   sig_peptide     complement(103976..104047)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2D9 "
FT   CDS_pept        join(105012..105507,105582..106290,106349..106411,
FT                   106490..106628)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170496" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660185"
FT                   /orf_name="An14g00410"
FT                   /protein_id="CAK41840.1"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI0000EFC64C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E0"
FT                   /transl_table=1
FT                   /translation="MGTTKPRPSGRASVAKVQSLPDKTFVIDNGAYTLKAGYAPDSVPP
FT                   DDQSKALSACSEIPNAIVKTRGNKIYVGSQLNTHVTDWNEMMFRRPVEKGYIVNWEAQK
FT                   EIWEHSFFDEKTVRSKDLRITDPEDTTLLLTEAPNALPALQKNADEIVMEEWGFGGYLR
FT                   CVGPSMNAWNDVQSLFGDPIVQEANTTVSPKECLLVVDSGYSHTTVTPIYKGQSLQRAI
FT                   RRLDLGGKHLTNYLKEMVSVRQYNMVDETYIMNEVKEAVCFVSNNFVGDMEQTWKGNRK
FT                   RGLPDASEGVMVDYVLPDPNAGKKGFMRPHDALLNAKKRKGGLSGASAEALSEDALVLG
FT                   NERFAVPEILFTPSDIGMKQAGIPDIIMQSLSVLPTGLHPAFLANVLVVGGNALLPGFV
FT                   DRLESELRQLASAECAVRVKCPQDPIRSAWLGASRFATNKDELRKVAITRQEYQEHGSS
FT                   WASRKFTGAI"
FT   CDS_pept        join(107933..108195,108261..108791,108852..109128)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901840"
FT                   /orf_name="An14g00420"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK41841.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI0000EFC64D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E1"
FT                   /transl_table=1
FT                   /translation="MTAFNVKDLAARAAQRIAEHRQKAEARGSTFSTEPLPMDRVSSVD
FT                   ANSMRTMSHSEDEHRHKSKMSRLVQKVRGRFSKRLAKREVIDEPCACCLDIMPAECLIS
FT                   MPCQHKYCSRCLKKLVFTVMPEEGLFPPRCCKQKIPTEVILPVLTPKERTVYFAKVQEY
FT                   ATPARERWYCPAPTCGRFIPPKHLNSKLSSQSCPYCSTTFCSGCRCPGYNNSTSTGKKD
FT                   PGFMAVFEDPRLGKAQRGLKCGSLVDLLFNCDHVTCRCKAQVCNLCRNPWLSCTCAKPG
FT                   QRPIDFLTFIIGHSGVNKDQEAELAAVVAAILCNERLRDEELAKTQGMKEKGGSANRSR
FT                   ASLLIPQQATRARRVS"
FT   CDS_pept        join(complement(110590..110718),complement(110423..110522),
FT                   complement(109616..110346))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000141498" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901841"
FT                   /orf_name="An14g00430"
FT                   /product="Function: the enzyme beta-hydroxybutyryl-coenzyme
FT                   A"
FT                   /EC_number="1.1.1.157"
FT                   /function="3-hydroxybutyryl-CoA dehydrogenase activity "
FT                   /function="coenzyme binding"
FT                   /biological_process="fatty acid metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41842.1"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="GO:0008691"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG691737"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniParc:UPI0000EFC64E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E2"
FT                   /transl_table=1
FT                   /translation="MLFSSLRSLSHRGPSLASRAFSTSPAVHAAEVKSLGVIGAGQMGL
FT                   GIALVAAQKAQVPVTLIDNSQASIDKGLKFADKLLDKDVSKERLTRDAADAARARITPS
FT                   LKMDDLSSVDFVIEAVPEIPDLKTSIFSKLAQIAPKHAILATNTSSISITKIAAATTTD
FT                   PTDLQAPSRVISTHFMNPVPVQKGVEIIAGLQTSQATKDTAIAFVQRMGKVASVSADSP
FT                   GFLANRILMPYINEAIICLETGVGGREDIDNIMKTGTNVPMGPLVLADFIGLDTCLAIM
FT                   NVLHQETGDSKYRPSGLLKRMVDAGWLGKKSGKGFYDY"
FT   mat_peptide     join(complement(110590..110631),complement(110423..110522),
FT                   complement(109619..110346))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E2 "
FT   sig_peptide     complement(110632..110718)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E2 "
FT   CDS_pept        join(111030..111119,111181..111418,111473..113600,
FT                   113788..114703)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901842"
FT                   /gene_name="tof1"
FT                   /orf_name="An14g00440"
FT                   /product="Topoisomerase 1-associated factor 1 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="meiosis"
FT                   /biological_process="negative regulation of DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK41843.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0008156"
FT                   /db_xref="HOGENOM:HBG324441"
FT                   /db_xref="InterPro:IPR006906"
FT                   /db_xref="InterPro:IPR007725"
FT                   /db_xref="UniParc:UPI0000EFC64F"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R2E3"
FT                   /transl_table=1
FT                   /translation="MENEEPVLSAPDVQVVDPDVRAHVYSLVTALGGFNGEDADKYVLG
FT                   DDALACLRDIKRWLKLYDEKHNRMDVARCLGEANLVNGDLLPILAVWANSKKQTKYMSR
FT                   IALACLELLVPLTWPVELHGELTINHHRHIPYIQHVHVSYKRGLLSHASTSYLRTIIRV
FT                   GIPSMAIPRSERTTRDEGILKLLLYLLRNIALITPNTRLAAEGDEEETSRSATINAFQD
FT                   QDVFALLLTMCSNVGDDFTMQDVALLEILFHLIRGVSVEKLFMDDAQRTAKRTDELDDL
FT                   LRQESSLRREYAKNAPTRHGRFGTMIWVKRDDAKYSTVSGQNVLKDGQATLQKMDETKK
FT                   WNKPLIRRKPQDLTVHNDFSTPVHLNSTASNNLRMFVEEFLDSGFNPLLTHVRKAIERE
FT                   ADRVMDINTRQFLYTTAWFLEAERARRARQRKKHAESEKPAKELEPDSFGLVAGVLNQE
FT                   TFVFLNRAMQYALDNKDWEDLNAGMRCFTQILLTVQDMAQSPLEEDQEIAENIQNRIFY
FT                   EETTHDRVLAVIRGYKDQPFGYLDACTELTHVFLRMLERYSKENLDMQVRSRRRARRKA
FT                   KDVEGTGNDENDEENGSEDEDRLEAERVSKERKFDFRRFAAKFCNQKCVDTFVAFTKHY
FT                   KELNTEQLKRAHRYFYRIAFKQELSVLLFRLDIINLFYRMIKGPGALDSSKPIFKEWEE
FT                   FVRQIIRRLTKRLDQRPALFVELLFSKINATTFYLEYGHERQTVTRARKAPAELEIDPR
FT                   QAHTIEEKISIMVPALVLDGEEDLVTWVSDVLESAVEEREAWETQEKALRDAGAENSKI
FT                   PNPMICRAQDLREMKSFIDKYFEKAKRGTLGRDPRELIRRKYGGGKTASDNQHNPDIQF
FT                   GDDSEGEDEVPDGPLFPPNPRAAPNPANKPTKKKKRKERNPDDEDEDDSVDEETLEERR
FT                   RARLENSRARLAKIKSDLYVHASDEDTDEEGDKEFFLLEEQRRREQAKRIKHALLTGMT
FT                   EDGDGSTNKKGQRKRQTTRNRTGEAKSKRQRRGKQADEVDEDDDVVMGNMDAPSPMSDR
FT                   EGTPSGEEDDGFNFDDDLVFSRDREKLLGSAGNEEKDSNRPDKAMAQDEDDDDAPIVAA
FT                   NRRRMRAGFVVDSDSE"
FT   CDS_pept        115383..116657
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117431"
FT                   /orf_name="An14g00450"
FT                   /product="Similarity to filaggrin MMFIL - Mus musculus "
FT                   /protein_id="CAK41844.1"
FT                   /db_xref="UniParc:UPI0000EFC650"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E4"
FT                   /transl_table=1
FT                   /translation="MPDRVTRRSFLASSLQVLKCAFRGRRSRSGNMNTQASHSNRNQDT
FT                   LSKSTISELTCLQPPNTPQTSISTTETGSSASTPTKKLRSVRGERIRRAVMLPPDTTDA
FT                   GKPSTQAEEEGQESLGDCNEELNSVSYKEDERQSLTLHESSLPAPHQAASEKAHHANYS
FT                   RLPTPVKPPTSNLYSHEIYQHEARRSVLSSLGGPHAAGKRYEVGNPKSGSSEDSPGVCS
FT                   RSSSMHDGRTRASEQKPSGLPLPQRGHSSERVQTRKTNVLPTSTRGHGSSKPDNARKSL
FT                   PVMVTSRPSNRVLSRKEVSHSRAEMQANADSSSSSDPLSTHAADAPQSCSGEHRTDRQQ
FT                   FLRLIQIEDNLGLGLQMQSRDHHSDTTPTSEAELARSSLRALPRRVRLTNKFENLRAQN
FT                   ADKKEKEKEEKQPGNAAVQSFLKLN"
FT   CDS_pept        117140..118570
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902793"
FT                   /orf_name="An14g00460"
FT                   /product="Catalytic activity: betaine aldehyde + NAD(+) +
FT                   H(2)O "
FT                   /EC_number="1.2.1.8"
FT                   /function="betaine-aldehyde dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41845.1"
FT                   /db_xref="GO:0008802"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0000EFC651"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E5"
FT                   /transl_table=1
FT                   /translation="MLSERQAASGILGCPVEVLGLIFEILPPAELRVLSIVNKELRARV
FT                   EPFLYANIQWLWREASSPPPITQLLRTITCKPQLATYITNVHLDGMNIKGRMTAGPPKI
FT                   LISSSELTEYTAFIQGTGVPYSDLWICELHQGTIDALLALLVAQLSNLRCLYLGPIYTR
FT                   ENQVLGMILNSALCRPMDYRLPTFQHLRDVSFHRAVGDDGTRPKMTPQDRAKNTANVLP
FT                   LFYLPNIRSMSVTVENPDVFTWPAAHLPDPSKLTSLDLTAVREAYLGDLLSVMPYLKTL
FT                   RWAWYYDYGVEDDFVSPTVDLDRIAAAVSRVRGTLMDLTISADAPIGGNEQFHPAVKME
FT                   GSLRAMVEFDELKRLRIPLAFLVGFVEDTTKRLQDVVPRNIEFLTITDELGLQNDGGDY
FT                   NSDWPIYEWTDTAVLTLLRTWLRGWKSCTPQLRGISVLFDYIDTNIGEWPPELRHQFME
FT                   LGAQAEVHLELIEWKRDW"
FT   CDS_pept        join(120443..121034,121141..121184)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813221"
FT                   /orf_name="An14g00470"
FT                   /product="Similarity to hypothetical proline-rich protein
FT                   T20E23.180 - Arabidopsis thaliana "
FT                   /protein_id="CAK41846.1"
FT                   /db_xref="UniParc:UPI0000EFC652"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E6"
FT                   /transl_table=1
FT                   /translation="MQPQAEGKGQHERERESPSTSTTPQPPAHPNPDTTPTSTTGRRPT
FT                   PFPSHLPRPIVPHPAASSRGGRRRTLPPPQPQQLAPPLQHHRRSSPFPSRLPQRTLTST
FT                   TTAQTTPPRTRLESIYGAQSYAFWLGRLMTVLNAILYADLFDAPDPVTGIRPPSVFSLT
FT                   VSRHGYSQRVAALAGSDRGATGRFRRAFMMLEDAFGIFRLLLVGRPLC"
FT   CDS_pept        join(complement(122990..123116),complement(122844..122931),
FT                   complement(121555..122776))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170529" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966395"
FT                   /orf_name="An14g00480"
FT                   /product="Remark: the S. cerevisiae transcription factor
FT                   IIH"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK41847.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG318428"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="UniParc:UPI0000EFC653"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E7"
FT                   /transl_table=1
FT                   /translation="MAAAPSSRPFEYLESLAGTVFYKLYQQPSTALAIFRRMLPDLAKC
FT                   FVMALLYLKDPLPAADLEAWVKSESLKERDNALSILGRLHILSNTVTADNVRAYKVTDP
FT                   FATSLRHALTGADQTQSFGVLSQVPAGSEVSIPELDEYARRQWEGVLGYMVGTGGMGGP
FT                   QVTLSKGVKELLQAGHLVEIRDRRVEITQDGFAFVLQDVSTQVWHILILYVESASAIKM
FT                   DSVEVLSFVFLLSSLELGKSYEKNHLSSKQLRMLTDLADFGIVYQESPDAPRFYPTRLA
FT                   TTLTSDSSALSNPLLGSLSGPAGEASSKAGTGFIIIETNYRVYAYTSSPLQISLIALFT
FT                   TLKYRFPNLITGKITRQSVRRAVEMGITADQIISYLSTHAHPQMRKHNVSRSTSNQAGI
FT                   PPSVLPPTVVDQIRLWQLERDRVKATSGFLFKDFVSLAEYEAPCRYAEEIGVLAWKSDR
FT                   KRMFFVTRHEQVAAFLRSRK"
FT   CDS_pept        join(123379..123405,123470..123510,123755..123833,
FT                   123882..123924,123987..124159,124282..124300,
FT                   124354..124432,124504..124579)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170540" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902794"
FT                   /orf_name="An14g00490"
FT                   /product="Similar to"
FT                   /protein_id="CAK41848.1"
FT                   /db_xref="HOGENOM:HBG749290"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI0000EFC654"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E8"
FT                   /transl_table=1
FT                   /translation="MTTLRFVRSVWESFRATSGLEPRLSRQLRVTAAKPGLVNFELDIK
FT                   KEHTNRLNILHGGTIASMVDLGGSLAVASRGLFATGVSTDLNGEQIATSTFTEDPLINH
FT                   TVTYLSSGGKVGDRILAEVSCDKFGKTLAYTSIKFANTKGEVFARGSHTKFVALAWKDP
FT                   QNIVEEINKLESSSS"
FT   CDS_pept        join(complement(129068..129479),complement(125554..129024),
FT                   complement(125038..125486))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170551" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966396"
FT                   /orf_name="An14g00500"
FT                   /product="Similarity to Superfamily I DNA helicases and
FT                   helicase subunits"
FT                   /function="helicase activity"
FT                   /protein_id="CAK41849.1"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="HOGENOM:HBG319395"
FT                   /db_xref="UniParc:UPI0000EFC655"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2E9"
FT                   /transl_table=1
FT                   /translation="MGLQTRQAMAQGLDSRPTVEDFREDSAWVRLAKSYWLDGSKARKV
FT                   KQDVLKKDLWDPLEAENFSFRSLLTLENLNILEKCASPAMLLRPSPLRQCLTREQVSLA
FT                   DLHGRCLELPCAPSRLDCERQAARASTDMGYVNDIFSDRPADFSNLFHRILSMSVDPSL
FT                   GTSSRLSIVSFIISAFQSVENPLIRKECAPLVSISIWHNLSSEEARDRLLARSSGLKKA
FT                   WRAAGKRYDAGDDANKAKMRFERSWLYTMLLDFFRRLNGPEREQADNLRYCERLLEFLV
FT                   DLESQPPTRRYVNTLLKDLNFLSVIRLSQLYRSADSALFRDLCGLLEHFSAFAIDDFTG
FT                   EALSPQAIYDAHCQELARLQRTSMKYFKDKLMILALSNYGSIEQRSELEGQLATLEESE
FT                   LRDLCSHLGFRTDYPKQSQITPDRHLYMEVLLSFYEKKTTFQEAASQLSIVPTEENLYD
FT                   PTLLRNETYDGSRPLAIPKLNLQYLSTGDFLWRSFLLYRSEAFFQIRKDMESIVKRMQP
FT                   RASRDGKTLNFDGFSRMAIPITKPAIIEVAPPKVGSAKPAFVRAEIAIEVGRLADHIRM
FT                   EWESLRPDDVVFLLAVQSDDAGNPGFREPETPGLKYLRTAEIVQVLDENGRPLREPVSG
FT                   QANGHRYRPRVRKLLVNLDSAAFKADKDGLARGKPDVYPLINVVARRKGRENNFKSILE
FT                   TMQKLIVSDITLPSWIQDIFLGYGDPAGAQYTQLPNRLKSVDFRDTFLDWQHLIESLPG
FT                   STIEPSKEETSSFGPPYVLEYVEEPSKAPSAETSKKRRREQAEREAGPKSLRVSTYKPP
FT                   NPGPYPIDAPKLNTVRFTPAQVEAIASGTQPGLTVIVGPPGTGKTDVATQIINNIYHDF
FT                   PNERTLLIAHSNQALNQLFQKIVALDIDERHLLRLGHGEEELETETSYSKYGRVESFLE
FT                   NRNHFLGEVIRLAASIGAQGAHGNSCETAGYFNTVYIQPAWAKFWDQARSESASTEDIV
FT                   AAFPFHTYFANAPQPVFDATATKETLLDVAEGCQRHIDKIFSELEDIRPFEILRQPKDK
FT                   ANYLLVKEARIIAMTSTHAAMRRQEIADLGFHYDNVVMEEAAQITEIESFIPAALQNMK
FT                   NGELPLKRVVLCGDHLQNSPIIQNMAFRQYAHFEQSLFLRLVRLGVPVITLDQQGRARP
FT                   SIAELFRWRYKQLGNLPAVETAPEFKQANSGFQYDYQFINVPDYQGTGEREPTPHFIQN
FT                   LGEAEYAVAIYQYMRLLGYPASKISILATYAGQTALIKDVLNHRCAKNGLFGMPKIVTT
FT                   VDKYQGEQNDYVILSLTRTRTVGYLRDVRRLTVALSRARLGLYILGRREVFESCYELKP
FT                   AFDLLFQRPDKLMLAPGEMFPSARSLDDEVQGTPMENVEHLGQYVFEMTQAKIKAMGGE
FT                   NAINNEMDVGGDEEVVMDEDEVMLGAGEEGDDDPLHEHTFT"
FT   CDS_pept        join(129753..129992,130082..130160,130213..130331,
FT                   130389..131075,131129..131278,131334..131647,1
FT                   31704..132130)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170552" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902795"
FT                   /orf_name="An14g00510"
FT                   /protein_id="CAK41850.1"
FT                   /db_xref="HOGENOM:HBG324439"
FT                   /db_xref="InterPro:IPR021861"
FT                   /db_xref="UniParc:UPI0000EFC656"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F0"
FT                   /transl_table=1
FT                   /translation="MADVDVGAIHAYRRLIDDLLNRAERAKPDNHIEPPLTESQLGDSI
FT                   WLIQGDDEQLAKGLSQQTQFAAVEIAFREKFYSLLASTSIEDPSFICIWNLLDIISIFS
FT                   DNEQCEPGLIFWLIEELLDSQTIDGCRKVFDYLESRRERNTKKHFKQKSLIILRSCNEL
FT                   LRRLSRAEDTVFCGRVFIFLFQSFPLGDKSAVNLRGEYHTDNVTTYDELTKAAAKDVAD
FT                   ADVEMSDEQEAPTATNGLKEDSEAQTTSASESHTPAQEPPKTPRVVVPSSKDESQDKGV
FT                   DLDDLYPMFWGLQAYFSAPTKTFDPQHFAKFKTGLEATLSAFKNVDTDLENSSNSKMSE
FT                   EIRKSTKRKRTTDGQEIASSFNPKYLTSRDLFDLEVNDTAFRRHVLVQALILLDFMLSL
FT                   TPKAKAKLADLTNKSVLYGFVLHDDDAKWAVKMRKAIEEYLQEGIGGKFYYRMVDTVLS
FT                   RDKNWVRWKAEGCPLIERPPVSVSEYLGAREHATKVYANKRLRTSPMGSLDLKFLSEGE
FT                   SLAGLERLKEPERFSVPAADSLMMGIMDDELDIDTAQTKEDREYAMRSKSSKTWRILRL
FT                   SAKSKLAEFEKIEDGKNLKILFETPQQSDGTPQALEGTPQASEKPPAGSESTGHGQEHG
FT                   AASTENENSAIATEQASANSVEAAAPEQPNDVKNAT"
FT   CDS_pept        join(141196..141791,141849..141986,142050..142687,
FT                   142744..143114)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902796"
FT                   /orf_name="An14g00520"
FT                   /product="Remark: expression was completely lacking in
FT                   leaves and flowers."
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAK41851.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG327650"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI0000EFC683"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F1"
FT                   /transl_table=1
FT                   /translation="MSISGPCVWLSSLSPPSTSHLPAITNHWSTASWNSEQASSRPRAL
FT                   PSRLPGSWEKEGEPTKPSTTGMQPLVLKAENAFTAAAPPNISSPVQRSTGPASVDNREN
FT                   RHTETNGDASRVKLEKHGHDELQLPRPQETASPRVTTQTTPEKKEREATVQHEKEKDDG
FT                   DADMLSSDDGAGSSIGGDKKQSSDSKSEKKKMKRFRLTHNQTRFLMSEFTRQAHPDAAH
FT                   RERLSKEIPGLTPRQVQVWFQNRRAKLKRLTSNDRERILKSRALPDDFDTTQVLRTPFD
FT                   HKTPAEAPVASPRTLLTRNPASNSFKMLLTDGLPRLNDDDYVISPLSSASTTNGFSAAA
FT                   DRHFESYAQPGVMPGRGGPALSDLHRHNRSAFPFPRSSSFSESSFNSGLNFPGRFSRPG
FT                   VEPLSHPSMAYGRRPVDYALGRPANGMVVGYDHQRALEGSVSPTGPPDQSIHYNVDSHH
FT                   QQIPNYHSSLAMPAPKGYGGMEINSHLQQHGRQMPALQSVPVSDAPDYRSYSYDHHPYG
FT                   ISHTMPYSQANASSMSLPASFPSDTTPGAVTTSAEDRMNHPPQLIDPARAKFGGQTFEY
FT                   ANYL"
FT   sig_peptide     141196..141252
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F1 "
FT   mat_peptide     join(141253..141791,141849..141986,142050..142687,
FT                   142744..143111)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F1 "
FT   CDS_pept        join(144573..144732,144825..144920,144974..145050)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813222"
FT                   /orf_name="An14g00530"
FT                   /protein_id="CAK41852.1"
FT                   /db_xref="HOGENOM:HBG324438"
FT                   /db_xref="UniParc:UPI0000EFC684"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F2"
FT                   /transl_table=1
FT                   /translation="MVHPSSTCCKTSGDGSCVCAAQAKCSCGKQNALHCTCNKASTENT
FT                   VSGARCSCRARPAGECTCERSATENHPVTGAACPCGKRSSTSCTCEKASAIDAAVGLET
FT                   DFTTRA"
FT   CDS_pept        join(146338..146789,146851..147185,147242..149160,
FT                   149217..149324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813223"
FT                   /orf_name="An14g00540"
FT                   /product="Remark: coat proteins of approximately 100-kD "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAK41853.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG315674"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR003164"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013038"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017104"
FT                   /db_xref="UniParc:UPI0000EFC685"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F3"
FT                   /transl_table=1
FT                   /translation="MSSMRGLVQFIADLRNARARELEEKRVNKELANIRQKFKGGSLNG
FT                   YQKKKYVCKLLYVYIQGYDVDFGHLEAVNLISSNKYSEKQIGYLAVTLFLHEQHELLHL
FT                   VVNSIRKDLLDHNELNNCLALHAVANVGGREMGEALSTDVHRLLISPTSKAFVKKKAAL
FT                   TLLRLYRKFPDIVQNAWAERIISLMDDPDMGVTLSVTSLVMALAQDKPDEYKGCYVKAA
FT                   HRLKRIVVDNDIASDYLYYRVPCPWIQVKLLRLLQYYPPSEDSHVREIIRESLQQIMNL
FT                   AMDAPKNVQQNNAQNAVLFEAINLLIHLDTEHSLMLQISARLGKYIQSRETNVRYLGLE
FT                   AMTHFAARAETLDPIKKHQNIILGSLRDRDISVRRKGLDLVYSMCDTTNAGPIVNELLR
FT                   YLQTADYAIREEMVLKVAILTEKYATDAQWYIDMTLKLLSLAGDHVNDEVWQRVIQIVT
FT                   NNEELQAYAAHNLLGYLKTDCHESLVKIGCYVLGEFGHLIADNQGSSPIEQFLALQAKM
FT                   ITSTDTTRAMILSSFVKFVNLFPEIKPQLLHIFRLYSHSPDSELQQRAFEYLSLATLPT
FT                   DDLLRTVCDEMPPFSERASILLSRLHQKTAGTTEKKTWVVGGKDANADKQEVLMAQNTG
FT                   LKRSFTTIVNGHKTGANGTTATSGASGDLAGLDLSAPSGPPPNMASAAHLTPDWDIGYN
FT                   RLYFGDEGVLFEDAQIQVGLRSEYRGHMGVVKIYISNKSSYSIGSLTTTVDNPAAPNLK
FT                   IDTKSLPDPSVPAVGQTQQTFLVEGRGPFTEAPTIRISYLAGALQAYTLQLPILMHRYM
FT                   EPSALSAEDFFKRWRQIGGGPLEAQNTFGVTARHKEIGEAFTRRVVEGFGWKILDNVDP
FT                   NPKNIVGCAVYQFAEGKTGCLLRLEPNYERSMYRITIRATQEAVPQALAKQMEQKLSQG
FT                   ERGDSGR"
FT   CDS_pept        complement(149600..150415)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966397"
FT                   /orf_name="An14g00550"
FT                   /product="Similarity to hypothetical protein YBL036c -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAK41854.1"
FT                   /db_xref="HOGENOM:HBG289671"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="UniParc:UPI0000EFC686"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F4"
FT                   /transl_table=1
FT                   /translation="MATPIRPSTPTRTTTLLTNLATVTARINTATTSSPKSTPPRLVAV
FT                   SKLKPASDILTLHTNPPAHQTHFGENYLQELQEKARLLPTTIKWHFIGGLQSNKCVTLA
FT                   RDTPALWAVESVDSTKKASLLDKGWGERSAEVKETNHEERLRVFVQVNTSGEENKSGVE
FT                   PGDGALELCRFIRDKCPRLRLQGVMTIGAIARSKATTPENENEDFVCLRETRDRVVKEL
FT                   GLLGEEAALELSMGMSEDFEGAIALGSDEVRVGTTIFGDRPPKDQARVV"
FT   mat_peptide     complement(149603..150340)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F4 "
FT   sig_peptide     complement(150341..150415)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F4 "
FT   gap             153763..153862
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<153865..155761,155772..157283,157429..158063)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170608" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902797"
FT                   /orf_name="An14g00560"
FT                   /product="Remark: N-terminal truncated orf due to end of
FT                   contig."
FT                   /protein_id="CAK41855.1"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI0000EFC687"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F5"
FT                   /transl_table=1
FT                   /translation="RIYLSTSISISRFYIFIILPFLSTSPFHLRISAEPLDGPNMDPSK
FT                   RHEPTSFTAASSTPATGPPLSTDDATSSTHRLSHPSLHAMSLPPSSPGLSSAALLSPSD
FT                   PPARAVATQAHPTPRRIPSSSSLAEERRKSSPSLKKRSSTASLRSNRGASTSPRPSLSR
FT                   HSSSSFGTSPTSASATHPNMAKKAHRTVSAEHPVTTAASIAAESFRKEVDWHQSAKLQS
FT                   QTLVLVHDACYGHRFSRPRTSRAALNSIVERPERIQASVLGISAAYVRLARRHAGGAFA
FT                   PHPDLNPQQLPVPPFHIRKTARTLSLSSPAVTHVHGSKWMEDLKTMCDAAESRLALNGK
FT                   ELVRPRSAGKDSAATNAPAFHEGDLYLCSESLSAFEGALGGVSEGVDAVMGPAPTKRAF
FT                   VCIRPPGHHCSAGHPSGFCWINNVHVGISYAAMTHGLTHAAILDFDLHHGDGSQDIAWQ
FT                   QNHRAVTAPRNAAAHRKTMVGYFSLHDINSYPCEMGEPEKVRNASVCIDKAHGQSIWNV
FT                   HLEPWKSDKEFWDLYAAKYTVLIDKARAFLRMHTERLANTPNGPPPKAAIFISAGFDAS
FT                   EWEGAGMQRHQVNVPTEFYARFTADVVRMANEEGLGTDGRIISVLEGGYSNRALTSVIC
FT                   TGLGDAKGSTHDVDEQQINRLASEMTDRLGLSNSAEGRSVTEPVYNSEWWSPGVLEELE
FT                   ALVYSPAAPVKPREKAAPTYLTTTQSFSAKVVNPPRDRRSTGSHSSPEPEAPSPPPPVS
FT                   WATATHELCKVLIPTGRQTTSCQPEELNAEASRLRRERQTAVDAASTSATTAAVAAAAA
FT                   AAATATATAAEDSRMKLRVRKPKPSLPLSPSAETVKRPAARGSRRTTIDTAPDTAPAVQ
FT                   TPARVTRRKSAGAGSAASTPEPTGPRPATSATVRKTNTSQSSTPRLPSSPNTPPVPRVP
FT                   PAFLSAESEESPNPDGPQDDLDSLTAGVRKLHIKLKVPSPEENAARERERERRIAEERK
FT                   RTASKATSKTQTQTQTPKSPRKPAGRAQTSSASKTASRSAAKPAPVAIHPGTEAKDEPS
FT                   IVTPVTSSPPSVGKIESNTTNGWDRGESEAAAGMVMSPPLTPGRPPSALYSPPGMTLAR
FT                   DGLPVMMSSGVIPFADTVRGMQEEEEQKGVNATHISEQSPTRSDKVVHRHAESFASPHD
FT                   SRRRALPASARSIINDLSNLRRITPSYNLTLSFPSPNSHSQSTIISRIPKCPQYPPPPP
FT                   PPTKKHHQQQQQQTPTSTPSARTARSQPATNSTSSRSAAPPARGHSVSSTAPKQRISAQ
FT                   THVSRHHHPPPPPPPHLQPSSKNPPSTPQINAHTSHAKRSSIHSPTPACGAISAGRSIV
FT                   SNIG"
FT   mat_peptide     join(153964..155761,155772..157283,157429..158060)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F5 "
FT   CDS_pept        complement(158754..159824)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000257899" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117432"
FT                   /orf_name="An14g00570"
FT                   /product="Catalytic activity: 5"
FT                   /EC_number="2.1.1.45"
FT                   /function="thymidylate synthase activity"
FT                   /biological_process="dTMP biosynthetic process "
FT                   /protein_id="CAK41856.1"
FT                   /db_xref="GO:0004799"
FT                   /db_xref="GO:0006231"
FT                   /db_xref="HOGENOM:HBG588098"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="UniParc:UPI0000EFC688"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F6"
FT                   /transl_table=1
FT                   /translation="MSPSAETLPTQESTPQSTTTTTTTPQEPIPHDPTHEEHQYLNLIR
FT                   RILSEGEHRPDRTGTGTRSIFAPPQMRFSLSKPSTNTTTGIKEYTPILPLLTTKRVFLR
FT                   AVLAELLWFISGTTSSLPLSEAGIKIWDGNGSREYLDKVGLSHREVGDLGPVYGFQWRH
FT                   FGAEYVDAKTDYSGQGVDQLAEVVKKLKENPFDRRIIMSAWNPKDMRIMALPPCHMFAQ
FT                   FYVRFPDAKRDEEGVVRDGEWGRGHLDCLLYQRSADMGLGVPFNIASYALLTHLLAHAV
FT                   DMVPGTLVHTLGDAHVYLDHVDALKEQIEREPVAFPEVRIKREDRGSGVVDGWKEEEFE
FT                   VIGYKPHKAIKMKMSV"
FT   CDS_pept        join(complement(161615..161692),complement(161301..161551),
FT                   complement(161165..161248),complement(160780..161100),
FT                   complement(160677..160734),complement(160549..160626),
FT                   complement(160315..160502),complement(160082..160265))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223473" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902798"
FT                   /orf_name="An14g00580"
FT                   /product="Catalytic activity: tRNA guanine + queuine  "
FT                   /EC_number="2.4.2.29"
FT                   /function="queuine tRNA-ribosyltransferase activity "
FT                   /biological_process="queuosine biosynthetic process "
FT                   /protein_id="CAK41857.1"
FT                   /db_xref="GO:0008479"
FT                   /db_xref="GO:0008616"
FT                   /db_xref="HOGENOM:HBG629929"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="UniParc:UPI0000EFC689"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F7"
FT                   /transl_table=1
FT                   /translation="MSTATPTATRKPMPSALTFDLHAKCSTTKARASTLRLPHGDVPLP
FT                   IFMPVATQASLKGLTYDQLRQTGCQLCLNNTYHLGLKPGQAVLDAVGGAHKLQGWDRNI
FT                   LTDSGGFQMVSLLKLATVTEEGVRFLSPHDGTPMLLTPEHSISLQNSIGSDIIMQLDDV
FT                   IATTSPDQARIHEAMERSVRWLDRCIDAHKYPERQNLFCIIQGGLDLEMRKQCCEEMVA
FT                   RDTPGIAIGGLSGGEAKEDFCKVVDTCTGLLPEKKPRYVMGVGYPEDLIMGVALGADMF
FT                   DCVWPTRTARFGNAVVPTGTLNLRHRSFAEDFRPVQEGCTCSICLPKEQGGLGITRAYL
FT                   HHLAAKETVGAHLLTMHNVHYLLSLMGSARQAIIEDRFPAFLRDFFGNLYGEKTNYPEW
FT                   VVTALRGVGVDLME"
FT   CDS_pept        join(162576..162641,162697..162829,162876..162951,
FT                   162998..163079,163123..163225,163287..163690,
FT                   163742..163911,163968..164052,164120..164417,
FT                   164506..164678,164762..164872)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902799"
FT                   /orf_name="An14g00590"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK41858.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG327697"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000EFC68A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F8"
FT                   /transl_table=1
FT                   /translation="MMSGEKELDHAESVQDLEAAPQVTQESYAGIDLSIREKALVWKQD
FT                   LRIVPLCAGIYLLCYLDRSNIGNAKILNQDTGNDLLSETHMTSYQYTVALMVFLIAYAL
FT                   FEVPSNYLLKKLKPSRWIGFLMLAWGATTMGLGGSHNFSQVTGIRFLLGATEAGLFPGL
FT                   VYYLTFWYRNSERSMRVALILASATLAGAFGGAIAYGVGHMNEVRGLSAWRWLFIIEGA
FT                   PSCASAFLVWFFLPDYPESASWLSPEEKALAIHRLKEEGSHGAAKAMSWEEAKEILTDW
FT                   RLYAHYIVYFGISTPFSSLSLFTPAIVSGLGYADLRAQLMTVPPWAAAYVVTTVVAWSA
FT                   DYFNSRGLHSALFAFIGAMGFLASAVLPADAYLHRYGCLVVAASGSFACIPPLLGWLSA
FT                   NIRSTAGTGLAIALNVSFGAPGQIVGVWIYKSDEEKKGYPTGHLTNAALLLMVTTGCIL
FT                   LRLYYGWRNKWAKGGSVSLARVNSCVEGNSTHQHRFFISAASILLRSSPGELELRINSS
FT                   TPQQPTSHPSISCFWTTRRAENKYSSGSWDTTIRKSLCWVFPRRALVKP"
FT   CDS_pept        join(complement(170203..171281),complement(169555..169745),
FT                   complement(169337..169461))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813224"
FT                   /orf_name="An14g00600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41859.1"
FT                   /db_xref="HOGENOM:HBG327704"
FT                   /db_xref="UniParc:UPI0000EFC68B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2F9"
FT                   /transl_table=1
FT                   /translation="MGSHGASSYRNGSRTGGSSSSTNSDVSERSKSTAPTIYSDRPTPL
FT                   HRGGIDMDIYDEEDPKASVSTYASTVPSEDDPPETPRYEVIDRQLDVFSTDVVPSDPST
FT                   FGQLFPSSRRLLIRHDDATLDGNMNLRVDTMVPQRGGYQQDVTLFHLRMYDLFTRKCSF
FT                   RRYCRDSGREVCHSERRPVASSSDRHPVFRRSWGSVLASLRPGSSGHGSLPSHEHKRQD
FT                   SGYRSAEDDDESFEDKPSDHRGGWDRHFVLTDSTLLEFSNYAHVELRRRGAGLSKRYEF
FT                   EYWSTRYQWRRECRKEGELREVSYHLVNTRTSKTVAHIVPEILTPMEAAEEEKKGGWVP
FT                   PSSMWISDPSVYEKMPDVAELGFGKGGFALNFGWSMCSKFFLSTSSWYLRSWKGSGGGT
FT                   FGRLPEGQTGMIGDDVLQEPEGRAVLSSTRQASGWCEPELAACFSLTFPSLCWHLPGTI
FT                   LNYDQH"
FT   CDS_pept        join(complement(176569..176986),complement(175942..176452),
FT                   complement(175662..175878),complement(175422..175479),
FT                   complement(175101..175124),complement(174825..174898),
FT                   complement(174643..174710),complement(174372..174429),
FT                   complement(174098..174172),complement(173900..173993),
FT                   complement(173452..173749),complement(173293..173405),
FT                   complement(173158..173249),complement(173024..173098),
FT                   complement(172787..172889),complement(172373..172629))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117433"
FT                   /orf_name="An14g00610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41860.1"
FT                   /db_xref="UniParc:UPI0000EFC68C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G0"
FT                   /transl_table=1
FT                   /translation="MAIHPNFPSEVNPRGSLSPQQARAISVWTEQAAASLESLTLSESV
FT                   PVADSNVAFAQSTPTRAGVRGTTVSLSIPLDDPVPTAGSPSAPKVKVLGQPTKETQVAS
FT                   VTFRRREPIRRDSLKRREALLKGKDGSRRRQRWENDRLLNNPWAEPPSSKDWDIQATHT
FT                   RHDPLPYYLAPLWDNHYAHLDHRSSQQMETRTEKHRVPKELRQRLKHARAARGILQDIE
FT                   EDIRQFIQRWNEKQSLLKQEGLADAPQSSDSESEDEIVFVGRNGLMHDSPQRRARLQKM
FT                   REAMSAHHEHDGQKMVFESLVDDRAAGFGRWLVHSIASYYGLHTWSVTVGEPARREAYV
FT                   GFYPPAPSSRAGPISPPAGSKACRQEAMIQPGDELPQPLWTQDHIQGRIDQDLQLIWAH
FT                   REVHISYIYICRSEQLVHLVAQLLAANEDTSALKRLALGITNLCNHLSPFQAHLLTMWQ
FT                   ACNVGDVNDVSGCDCDVVVGPIVPGLDGLNDATMHQAVTERRICLVLLMLVLQQQITPN
FT                   LGCMYGARDWVSSPTSVHLSDCGMSNHLRFFPWRRVREETPSASIDKRGKGTDRAPLGR
FT                   PHRCGGRQGEKPEIGFVFEFLGGKKTTQKPPEPGIHLPTSSPPKAASSHMEIPGDLDVA
FT                   RLIGLPEGGDTRERQSMGDYSFGPIRRGDPSRFHGIDLIDVVDLTIGIFQAFYLCFSFL
FT                   LVSGDKVVGHSPFSVRSAMNIFQSTPRAKHQHQSGNVHIWESRRISWTHWRKRQKTYRE
FT                   MPLQGKDAHGLSSQLKSLGSSTTVSQGPKGKAVGRILADHSARLTWKNCVSFGSADSGG
FT                   QRGYCQHHQHSIIRTVSVGEEEVKQSETFSRR"
FT   CDS_pept        join(178750..178944,179019..179765,179825..180058)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902800"
FT                   /orf_name="An14g00620"
FT                   /product="Catalytic activity: release of an N-terminal
FT                   amino acid"
FT                   /EC_number="3.4.11.10"
FT                   /function="aminopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK41861.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG328999"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI000004F601"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G1"
FT                   /transl_table=1
FT                   /translation="MKLSIALALGATASTGVLAAVVPQQEPLITPQDPPTHHHQEKFLI
FT                   ELAPYQTRWVTEEEKWDLKLDGVNFIDITEERNTGFYPTLHAGSYVHYPPTMKHAEKVV
FT                   PLLRGLSKDNMEQNLNKFTSFHTRYYRSSTGIESAKWLYSRVSDVIEQSGAAEYGATVE
FT                   QFAHSWGQFSIIARIPGQTNKTVVLGAHQDSINLFLPSILAAPGADDDGSGTVTILEAL
FT                   RGLLQSDAIVRGNASNTIEFHWYSAEEGGMLGSQAIFSQYKRDKRDIKAMLQQDMTGYT
FT                   QGALDAGRQEAIGIMVDYVDEGLTQFLKDVTTEYCGIGYIETRCGYACSDHTSASKYGY
FT                   PAAMATESEMENSNKRIHTTDDSIRYLSFDHMLEHARLTLGFAYELAFAQF"
FT   sig_peptide     178750..178806
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G1 "
FT   mat_peptide     join(178807..178944,179019..179765,179825..180055)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G1 "
FT   CDS_pept        join(180938..181992,182160..182385)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117434"
FT                   /orf_name="An14g00630"
FT                   /product="Catalytic activity: adenosine 3' "
FT                   /EC_number="3.1.3.7"
FT                   /function="3'(2'),5'-bisphosphate nucleotidase activity "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="CAK41862.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="GO:0008441"
FT                   /db_xref="HOGENOM:HBG599916"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniParc:UPI0000EFC68D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G2"
FT                   /transl_table=1
FT                   /translation="MESTDPYAKELQIACLTVQRATLLTKKLLEAVDKGSFDKNDATPV
FT                   TIADFAAQALIIAAIHHAFPDDEFVGEESSDALRSDPALLDRTWELVSSTRLSDEESDA
FT                   LLYAPSSKEEMLDLIDLGAQGNCSKQSRAWVLDPVDGTATFIQGQQYAVCLSLVENGYQ
FT                   KVGVLGCPNMNLETGRLHENIVDRDGYGHQVFAVAGQGAFIRRMGTGALLPSRKIEPKA
FT                   QITDPKDIDFVDCVSATSSDRNMHARLASHLGAPWPASTDLWAAQLRYIAIAVGGCNVM
FT                   IKIPHKSSYRSKIWDHSGGMLIAEELGCTVSDLAGNPVDCSLGRTLSGCYGMIVAPSSI
FT                   HSRLVEAVKQIIPPSGLTGQFVREGQEYLLGYHKTNKTPGGIRAQMHSKRVLLLHFVCS
FT                   LAEETLGCMRQQDRALIDNVGTAINGI"
FT   CDS_pept        join(182980..182989,183076..183286,183386..183825,
FT                   183885..184105)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902801"
FT                   /orf_name="An14g00640"
FT                   /product="Similarity to hypothetical protein EAA61679.1 -
FT                   Aspergillus nidulans"
FT                   /protein_id="CAK41863.1"
FT                   /db_xref="HOGENOM:HBG327736"
FT                   /db_xref="InterPro:IPR013920"
FT                   /db_xref="UniParc:UPI0000EFC6C0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G3"
FT                   /transl_table=1
FT                   /translation="MSTSIHSTRRESHGRFSLGTYRVLVPLSWLLVVVVGIYYSSHAPD
FT                   VKHGHTIWKQANKHITPFSLSTVIAGIYWIITLLSQIGFVYHLFSNDAVTATAAANVGS
FT                   HFILNNLFIFAWILLWTRNHFWGSEIILIAHFLNQKTTYWRHRTLPPLAHFAAVAAPYA
FT                   WTLITLFWNGAVAVNSNSLPARIVANVFIWVLFALGSTHILSTQDDILGYSLSLLTLAL
FT                   AVKQFGVKVISLQWIFAIVIFAVFFAESLYISLTKYSGRNIFFRRAGQPAPATNREREP
FT                   LLNDSTQPAQTA"
FT   CDS_pept        join(185552..185790,185833..185968)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660422"
FT                   /orf_name="An14g00650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41864.1"
FT                   /db_xref="UniParc:UPI0000EFC6C1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G4"
FT                   /transl_table=1
FT                   /translation="MNNSSRMYVPAHNQEEEPPAYDTYEDPYFTEHESPPAASRAHGAT
FT                   MRLLPTSTIVESDLSADTGVSSEYHYGDPFVDDGDYGFWHSDDSVWYLPYGVELHTNSP
FT                   LVDMVNAVEIAVWGKLRPGD"
FT   CDS_pept        join(186076..187846,187899..188083,188143..188309,
FT                   188367..189270)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813225"
FT                   /orf_name="An14g00660"
FT                   /product="Catalytic activity: UDP-N-acetyl-D-glucosamine + "
FT                   /EC_number="2.4.1.16"
FT                   /function="chitin synthase activity"
FT                   /biological_process="chitin biosynthetic process "
FT                   /protein_id="CAK41865.1"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0006031"
FT                   /db_xref="HOGENOM:HBG327157"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniParc:UPI0000EFC6C2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G5"
FT                   /transl_table=1
FT                   /translation="MIYEMMVMKRSANSRAQNNRRSERQRYYPYEPTESPSRPVSSLGN
FT                   VPTIPPPAASTVDVPHYTSRPGSPTRPWSPNRVGNWARPPAPPSVASSQYERADLNGSP
FT                   RPGTPSSRYGGSPRRPLPPAPLFSAPGGHDANIPINDAGDDDVFGGGGRTIDPNNRASM
FT                   QSFMSESTIITDEKDAMSKVDLDDEMEETDEMVDPNIHYGPAPEKQSRRGVREAQMSTK
FT                   EVQLINGELILECKIPTILHSFLPRRDDREFTHMRYTAVTCDPDDFTQRGYKLRQQIGS
FT                   TMRETELLICITMYNEDEIGFTRTMHGVMQNITHLCSRSKSRTWGKDGWKKIVVCIIAD
FT                   GRKKVHPRTLNALAALGVYQEGIAKNVVNQKQVNAHVYEYTTQVSLDPDLKFKGAEKGI
FT                   MPCQVLFCLKEHNKKKLNSHRWFFNAFGRALQPNICILLDVGTKPAPTALYHLWKAFDQ
FT                   NSNVAGAAGEIKAGKGKGMLGLLNPLVASQNFEYKMSNILDKPLESVFGYITVLPGALS
FT                   AYRFFALQNDAEGNGPLNQYFKGETLHGQDADVFTANMYLAEDRILCWELVAKREERWV
FT                   LKFVKSAVGETDVPDSIPEFISQRRRWLNGAFFAAVYSIVNAKQLWKTDHSLPRKILLQ
FT                   IEGAYQFMQLIFTYFGLANFYLVFYFIAGSLTDDKIDPFGHHIGKYIFVILRYACILVM
FT                   CLQFIISMGNRPQGAKKLYLSGIIVYSIIMFYTIFCTMYLVVIEILARTGADTSLEVSD
FT                   GLFVNIVMSLLSTVGLYFYASFLYLDPWHMFTSSAAYFIMLPSYICTLQVYAFCNTHDV
FT                   SWGTKGDNVLNMDLGAARVVNGTTVQIEMPSEQLDIDSGYDAALRNLRDRVEVPETPIT
FT                   ESQMQEDYYRAVRTYMVSIWMVANVILAMAISEVYGPDAGGTNIYLAIILWSVVVLALI
FT                   RVIGSTTYAILLVVQKIVEGKTKFDAGNLANMSHVSGSSGGRSSTALKYGGGVSFKDKF
FT                   AEAKWSAKRVAGKAMFWRK"
FT   CDS_pept        join(complement(191272..191547),complement(191118..191216),
FT                   complement(190991..191064),complement(190835..190934),
FT                   complement(190354..190775),complement(190176..190299),
FT                   complement(189553..190113))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158126" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117435"
FT                   /orf_name="An14g00670"
FT                   /product="Catalytic activity: a Monocarboxylic acid amide +
FT                   H2O "
FT                   /EC_number="3.5.1.4"
FT                   /function="amidase activity"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="CAK41866.1"
FT                   /db_xref="GO:0004040"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG327754"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR015830"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI0000EFC6C3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G6"
FT                   /transl_table=1
FT                   /translation="MSLSWETQAQKAKDILQQSIPKQWLLPAHKLPSADLKNVEDFPRK
FT                   SGLLSARELSITDMSAATLVQNMGAGKLTAEEVVVAFIKRSVLGHQLLNFATEFLTDRA
FT                   IGRAKELDEYYRRTGKLVGPLHGVPISVKEHVGVKGLTCNAGYVAWVDDVATEDALILQ
FT                   CLEKAGAVFHVRTNQPQSLMHLCCSNNLTGKTLNPYNRTLSAGGSSGGEGASTGFKCAP
FT                   LGIGTDIGGSIRCPAAFCGSYGFRPTALRNPMSGAKAPKDGHESIRGVIGPLASQSVED
FT                   MDLFQQAIIDQEPWNIETSLAPVPWKRAKPTKGMTVAIMWDDGVVRPHPPVTRALKHAK
FT                   AKLQAAGIKVIDWEPYKHKHGWDIISAMYFPDGALSQRKLIAQTGEPILPLTAWAFNYS
FT                   SPTPLTMAESWELNVQRDVYRDEYHALMKSRGVDFILCPAYAGVASVLGESHYWNYTAV
FT                   WNILDQPAVVFPSGLSVNPQLDQLTSEHKSYKPRDEVDQREWSKYTGPERYEGAPIALQ
FT                   LVGKHFKDEETLAAGALVDGILKGAEQTSTRSML"
FT   CDS_pept        join(complement(194057..194171),complement(193830..193973),
FT                   complement(193464..193619),complement(193293..193373),
FT                   complement(193132..193241),complement(192848..193076),
FT                   complement(192719..192798),complement(192350..192661))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902802"
FT                   /orf_name="An14g00680"
FT                   /product="Remark: the protein is probably responsible for
FT                   the uptake of zinc and cadmium ions "
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK41867.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG317426"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI0000EFC6C4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G7"
FT                   /transl_table=1
FT                   /translation="MSELDGTTTHQQCRDLRATCLPWYRHTRRGPRNMLRQPVLLQQKV
FT                   VWALSHPHLRDFSIMVLKISRATRLTVVVVISSAFFVAEISAHDTVRNVATDTEIKLQV
FT                   SEADESPKALSFGWQRAQLLGAFFNGVLLFALGISVENPKLMFIMGAIGLTLNLISATF
FT                   LHEHHHHDHGHEPSSGALEELPVSTTDDITGPERPGSPNHNDHKHLSNGAHAASHGHDL
FT                   GMLGVLIHVIGDAANNLGVMAAALVIWLAHYGGRYYADPGTSMGISIMIMLSSVPLVRR
FT                   CGIILLESAPNGVDLEDVKHDLEKIPGVLSVHELHIWRLNQHKALASVHVMVSDCSVPS
FT                   FLKLSKTINECFHAYGIHSTTIQPEMAHPEAIALGRPAVETELSSQTEMSEKCQVICGT
FT                   LCEELTCCG"
FT   CDS_pept        join(complement(196483..196674),complement(195997..196422),
FT                   complement(195908..195941),complement(194387..195771))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000087851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902803"
FT                   /orf_name="An14g00690"
FT                   /product="Catalytic activity: 2 H2O2  "
FT                   /EC_number="1.11.1.6"
FT                   /function="catalase activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAK41868.1"
FT                   /db_xref="GO:0004096"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG339355"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniParc:UPI0000EFC6C5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G8"
FT                   /transl_table=1
FT                   /translation="MASEQFNMATKHDDLARDTVQLSGVQPMTTDYGIKISDPDHWLRV
FT                   VDAQHNGPSLLEDPIAREKIMRFDHERIPERVVHARGAGAFGTFKLHQAIPELSSAGVL
FT                   TDTERETPVFVRFSTVQGSRGSADTVRDVRGFAVKMYTAEGNWDIVGNNIPVFFIQDAI
FT                   KFPDVIHSVKPEPHNEIPQGQSAHNNFWDFQYMHSETTHMQQWVMSDRAIPRSYRQDPD
FT                   FHRKDLMDAIEAGQYPRWKFGIQVIPEEKKDDFEFDIQDATKIWPEELVPIQYIGQLEL
FT                   NRNVDEYFPQTEQVAFCTSHIVPGIDFSDDPLLVGRNFSYFDTQISRLGPNWQELPINR
FT                   PVCPYMSLVNRDGQMRHRITKGKVNYWPNRFDANPPTSPAHGGFATYPEKQRGVKARAL
FT                   SDKFSEHFNQAQLFYNSLSPIEKLHVSKAFSFELDHCDEEIVYKRLSERLAVVDLQLAK
FT                   TVAKNVGGNTPTKAPKENDGKTSKGLSQFDYLSDSAQIATRRVAILIADGFDLNSYRDM
FT                   KSALQKQNAFVFTIGSQRQGVTSESGEKVIPDHHFPGMRSTLFDATFVPGGKHVSVLAK
FT                   NGIAKHWISESFAHLKPIAGVNEAVDFIRKQINLDAVKYASNGQVKESYGVVTAHGAPA
FT                   ELLQVSSNISRESKGFVDQFIWQISRHRNWQRELDGLVDEIAA"
FT   CDS_pept        join(complement(198987..199347),complement(198414..198858),
FT                   complement(197838..198354),complement(197459..197769),
FT                   complement(197281..197305))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000259600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902804"
FT                   /orf_name="An14g00700"
FT                   /product="Similarity to hypothetical ATPase HFN2B -
FT                   Haematobia irritans"
FT                   /EC_number="3.6.1.3"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="CAK41869.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG664131"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="UniParc:UPI0000EFC6C6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2G9"
FT                   /transl_table=1
FT                   /translation="MSGSSAKLCADYLPGALRARGPLLRAVPRGTRRPGAREYRRGAHG
FT                   ANNSRYRPSVTAHRVPVCDTVDVRLSQGQYARRFATAAEGKAVEADAAAGMQGGPLAEY
FT                   DARVQQGRLRDDPYQRQIIEQLQDLYERLRSYNPPPVVQPSVESLDPKPKSFFGSLFGR
FT                   NAKQELTIPEALPKGLYMYGDVGCGKTMLMDLFYETLPPNIKTKTRIHFHNFMQDVHKR
FT                   MHVVKMKYGNDFDALPLVAASIAEGSSVLCFDEFQCTDVADAMILRRLLESLMSHGVLL
FT                   VTTSNRHPDDLYKNGIQRESFIPCINLLKTALDVINLNSPTDYRKIPRPPAAVYHHPLG
FT                   PDADQHAQKWFDFLGDPINDPPHPATQEVWGRKIHVPLASGKAAKFSFQQLIGSATGAA
FT                   DYLELVRNYEAFIITDVPGMNLTQRDLARRFITFIDAVYESRAKLVLTTEVPLTNLFLS
FT                   ADDVKGTLKDGSDDNGADLSDAMRMMMDDLGLSMQALKTTSIFSGDEERFAFARALSRL
FT                   SEMGSKMWVERGLGVGMDADHGKSEHDAYSCIYRP"
FT   CDS_pept        join(complement(202717..202722),complement(202364..202393),
FT                   complement(201241..201996),complement(200248..201162))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117436"
FT                   /orf_name="An14g00710"
FT                   /product="Remark: required for polarized morphogenesis in
FT                   response to pheromone signal"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAK41870.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG397148"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0000EFC6C7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H0"
FT                   /transl_table=1
FT                   /translation="MKSAIAILPPKKVIKALYDYQPEPGNSQELAFSKGDFFHVISRED
FT                   DLDWYEACNPLIPSARGLVPVSFFEVIGKNERHSAGSVDHHKKKEPHDSGFSDRAAFPG
FT                   TDFISNSSRNSFQPRMSQLGKGSSAMVYGIVQYDFQAERPDELDAKAGEAIIVIAQSNQ
FT                   EWFVAKPIGRLGGPGLIPVSFLELRDMQTGQAVTDPLEAVRRAGVPKVEEWKKMTAEYK
FT                   NSSITLGKIDSAGGSSMQSVTSSMDKMSIGRQSQMSQNGQSQGYHTRNASKGSLVQQVS
FT                   HQSQQSYHQSLMAPIAASIPRYCFDNDKYWYIIEAKMEDGRCWELARYYHDFYDFQIAL
FT                   LTQFEEEAGNRGKPRTLPYMPGPVTHVTDAISNGRRQNLDEYIKKLLAMPPHISRCQLV
FT                   RQLFAPRAGDFEIDPNAFGEETRFSGGSHHSSANEPSRSVSRQSSQAPIAVHTERNSHQ
FT                   RGQPSLSLSNGGPPPMNRQPSSLTQVSTSSGGAMKVKVFFQDDLIAIRVPNDISLQQLK
FT                   EKLMDRLKIQDEIMVQYKDEPSGTYVDLATDSDLDTAIQRNSKLTLYVGLA"
FT   CDS_pept        join(205226..205374,205549..205579)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966398"
FT                   /orf_name="An14g00720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41871.1"
FT                   /db_xref="UniParc:UPI0000EFC6C8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H1"
FT                   /transl_table=1
FT                   /translation="MARILCVCPRFCRRQYVLCMGHKWPRSSVPELRRTRQEWSLGCSG
FT                   GQGKRYLDLFDNRS"
FT   CDS_pept        join(complement(207050..207093),complement(206657..206801),
FT                   complement(206600..206625),complement(206204..206261),
FT                   complement(206140..206151))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813226"
FT                   /orf_name="An14g00730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41872.1"
FT                   /db_xref="UniParc:UPI0000EFC6C9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H2"
FT                   /transl_table=1
FT                   /translation="MGICTRLKTAYVLGCSATKDFVLHLAGWWARWIDQFYPPTSRVAN
FT                   DRSVVRLFVPAISLETFIRASTTVSSYRGIALENPCHTLQPWYATTIRK"
FT   CDS_pept        join(complement(209933..210005),complement(208616..209876),
FT                   complement(208346..208562))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902805"
FT                   /orf_name="An14g00740"
FT                   /product="Similarity to hypothetical protein T16B24.2 -
FT                   Arabidopsis thaliana"
FT                   /protein_id="CAK41873.1"
FT                   /db_xref="HOGENOM:HBG735264"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniParc:UPI0000EFC6CA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H3"
FT                   /transl_table=1
FT                   /translation="MSSGIPPWRVAASATATTSIHSGHVAPAYIPVQARRSIAPTKATN
FT                   PGPSPTTPTTSTDAATRKRVEFPEAVRKYVQRSFAPENRLSGVERSEMEAKLKSVITEA
FT                   AEGNMLDKIDWETLPLPQVMVQNDRNMVLASPGVSTWAAFGTLSPKKSSTPLVDLSKKR
FT                   KSVEYHGDASSCPPWRQTNNQNAFEDRVTYPSTDKRQKMDSKNPSKSKANLEMRRKRFE
FT                   DAQGRHGSSPSSRGASPTPNANQGPVVGRCQELEKNYFRLTSAPNPDTVRPLPVLMKTL
FT                   DLLKKKWKKDNNYGYICDQFKSLRQDLTVQHIRNEFTVSVYEIHARIALEKGDLGEYNQ
FT                   CQTQLRALYAQQLGGHPTEFKAYRILYFIHTRNWTAMNDALADLTAADKRDLAVKHALD
FT                   VRSALALGNYHRFFQLYLDTPNMGAYLMDMFVDRERLSALAAICKAYKPDVNIRFITEE
FT                   LGFESDEQSARFILDHTSEDLLQEKDGVVRLLTGGRAGQLFEGAKAEAHRIVDIKGQI"
FT   mat_peptide     join(complement(208616..209865),complement(208349..208562))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H3 "
FT   sig_peptide     join(complement(209933..210005),complement(209866..209876))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H3 "
FT   CDS_pept        join(210526..210626,210769..210904,210956..212590)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902806"
FT                   /orf_name="An14g00750"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK41874.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG327797"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="InterPro:IPR021648"
FT                   /db_xref="UniParc:UPI0000EFC6CB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H4"
FT                   /transl_table=1
FT                   /translation="MFFKPLDLTTALRPSLLPDETLLFVQDAVGLYEGKYKIPNYQNGH
FT                   AYLTSHRVCYVAVDEPRKYSVGIDLKDIDRTEYQASFWKSSPKITVYPKPLKNIDRSKN
FT                   AGASPSRSQSPLTPKSVHHPSAGLPPPVNATWVCPICSFSNPVPSNFDPSTATASTPIP
FT                   PCLACGIKPPFATILKAAITAATSRESSVATPPTSQPGHESSLESNNSKNLIAPQNGAQ
FT                   VSCPRCTFVNHPSLIECEMCGASLVSSNILKVTNGDHYRAESPAPVFDQGNIKSKQIKD
FT                   SMKLSFRGGGEKIFHERLKGALIQRKWLLYNAPPVPQQPSQSSSEVQGLAVPTPPNGPG
FT                   ASLPRSPGVGIAGLERRGLEARKNNELVIGNAFEDLEALMASAKHIVALAETLARESGM
FT                   ASDESSAETSAVLSESAAALGMVTTKDMLGSGAESLYLSELSRNLAEYLTDDRKGILQK
FT                   EGGIISLIDLWAIFNRSRNGVELVSPSDFQKAAELWEKLKLPVRLRRFKSGLLVVQRYD
FT                   WTDEKTLQQLLDWMAELRQVPPTEPVAWDWRLFGRAVTAQEAAQRFKWSVGVAAEELEM
FT                   AEDKGVLCREQGIEGLRFWFNYIASDPGQQEVDDLGLAKVSIDNRDI"
FT   CDS_pept        213027..215216
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170719" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902807"
FT                   /orf_name="An14g00760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41875.1"
FT                   /db_xref="HOGENOM:HBG327798"
FT                   /db_xref="UniParc:UPI0000EFC6CC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H5"
FT                   /transl_table=1
FT                   /translation="MVYPSAVSDIRAVKRSVTHSRAVLFASSRLLRSSYQRRHLWRGPG
FT                   ERINYDYLEKQMDRHRRYCLSKLREKPARPRKANVYESHHPWWFRGFGPGYDRDKPFQF
FT                   DHRSGIKGDFWEAERSRIKDRMDQIKREIDNDPYAALFGRRLQPFSSFEKLDNAFTSLC
FT                   RSFLGLGKSESTMDTTARPKATAAASKDSSESPKKPNSKMGGGVPSSDEVVSGINRPSY
FT                   EFDPVSGRMIPKGTEQPVATEEGFRGSDIDASVGSQKPHSGPTGYLSPFERSAIESKSA
FT                   TVSGNERAEERSHQGVEAVPVADEPYQAPEVLKSDPPTEARYKALEPSIDALKDQRDVA
FT                   EKVNGLSEAIMADQPKPQGEYTNGGTYDHLEAPVNSRPFGDQQSHEVLMRPPDAPGSTL
FT                   STAQEQERVQAERDEDLDILSASDIRSHYLARPSIDPEIEKQIRQSLDDRFDSFVDPAG
FT                   DIDAQSVRSKFQKHETVGADRPEVSDIGVQPDQQTAESREPSQVLQAREQGSAQRFDQT
FT                   AIIEQPLADSPSTETYRVLAYDPSTLQVNEAETSSSFHASDETIHPAEILGRLNAPAKF
FT                   LPHFARMRTDGYEIVSGGGDILVFRKASSSVHDNAPSKAADKIETSPDGQNNGALKQST
FT                   SPIQLSQEHISSQAPDHEVQLSDGTSQAQGSSYSSSKGQSRVGQALRRMLFSGVATAGT
FT                   CYAISVVVEYFRTGGQDGRGIDAFTAFESERRHGD"
FT   CDS_pept        join(complement(216784..217093),complement(216283..216689),
FT                   complement(215540..216109))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966399"
FT                   /orf_name="An14g00770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41876.1"
FT                   /db_xref="UniParc:UPI0000EFC6CD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H6"
FT                   /transl_table=1
FT                   /translation="MDPGAVQKRLAQAAVKLYKARKELKRYKAAKKIVEEQEAEAAEKA
FT                   ETTEYIRRPTFSILETILEVSEVKTVDIEVHGMKAKFYLSRPDEDIVPLRYLKKADTDK
FT                   IVHRAVWIFSKAKDGRQVNQDKWPTLETVFFDVFHNLKNSPQWDKALFDDDKGSTATCP
FT                   PNTDFRLARFNQDNVLHALISELFFNVDVMHPTSKPMLWFHLQYVTTSTLKDPTQPPST
FT                   NASSSSNQSESHGRNFRTLTDNQPLDKALCQNFQLHLGQLLTNLHHLHINKYCLPDQEV
FT                   FLINLHGSRLHVQRAVFPSPKISRIYCKKYKPADPKSELHTFRAGDTTRRYTEQDLEYD
FT                   IDQLDWLHTLREDNNEAPDEEDKPVIRVLASQEYDLWTRSGWHAALKLLAGLNRYLMGG
FT                   RAKCGVMQNMFEKFPIAESPPKESSAAKS"
FT   CDS_pept        join(217950..218114,218197..218346,218402..218506)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660423"
FT                   /orf_name="An14g00780"
FT                   /product="Similarity to hypothetical protein PH0854 -
FT                   Pyrococcus horikoshii"
FT                   /protein_id="CAK41877.1"
FT                   /db_xref="HOGENOM:HBG695954"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0000EFC6F4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H7"
FT                   /transl_table=1
FT                   /translation="MSKATRIPIRTQKAPLPPPFLSQGIVVGDMVFCSGQVGVNPATGK
FT                   MVEGSIQERTKQILNNLGAVLEAGGSSLQDAVKMNIFLADMNDFAAVNEIYAAFFEDPL
FT                   PARTCVAVKTLPMGTDVEIECVGVVRGVPSRGSRL"
FT   CDS_pept        join(complement(219881..220045),complement(219468..219514),
FT                   complement(219205..219349))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902808"
FT                   /orf_name="An14g00790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41878.1"
FT                   /db_xref="UniParc:UPI0000EFC6F5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H8"
FT                   /transl_table=1
FT                   /translation="MTGMSEMQESRSLFTAPAGAAVRAETMALSIPSVSELPRTESYKI
FT                   PQIAYWLRLLAESVQRSSLSLSLGRTSGNGGYDPESHEPWTKVANDPRTGKLLQTDTKP
FT                   VPDCCPTVVLGSIG"
FT   CDS_pept        223979..226963
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902809"
FT                   /orf_name="An14g00800"
FT                   /product="Similarity: the similarities are due to
FT                   repetetive sequences."
FT                   /protein_id="CAK41879.1"
FT                   /db_xref="UniParc:UPI0000EFC6F6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H9"
FT                   /transl_table=1
FT                   /translation="MIAPTTSLLAAFLSFGGLELVAAREAGQVRDLGAREVSSAALVSS
FT                   QPVTPIELTTRSETSTHESAPTSDNEQTSPIVDPSPAVIVVPVTISVDANGVTHTIVGT
FT                   APFVPGASTTTSSTIERAASTPAAAAATSTASATTSDKDSTTSDSDKHTSTSESEKHTS
FT                   TSESSAKPETRSSSAAEAETPSSAAAAAAAATTSSQSSLAESWESFISSILGSSTSTSA
FT                   ASTTASPTASSAESSSATPAPASSSAGVVVDVTTSKSSTSDGSTTSESSTAKDSTTQSS
FT                   SSPASSTPASTAESSAEASKSEPATASSKAETSSQLITSQSASAQSSSAQVPLAESTSK
FT                   SESSTQSSSSQVTSVQATSSGAATQATGSVSSSLIPSASEDVTSSSSAPASSGGVLGFL
FT                   SDLFPTSTTSTGSASATSKSASESADSSAFPLSLPTISVSVPVVTPASSSSGSVNIVPG
FT                   LLGTSSGASLESSGISLGISATSTALIPGASSGTQSSAAGASTPVVSGGIIIMPTSTES
FT                   ASASVSGSASTGLFGTTSESASSLASGSASGSAGVIPTSVSGSVSGSAGLFPTSASGSL
FT                   SGSAGVIPTSAPGSASGSVSGSASGSAGLFPTTASGSVSGSAAGTSSASMYTSISGPAS
FT                   SIPLITSTKESSSLASATPSYAPSTTSKETPTPIEQPTTTTTSAAETTVTPTPTTTTSD
FT                   SDNYLPSSILVVEPTTTTAVSTGTATHSSTSTAAAQLPGSISPSGGLPDQPANDTLVQI
FT                   GFNGKLRWSFVATTPLSSSQIFMYVPEGLGYALQLNDSDVVMYDLQPYDNSASTGYIAT
FT                   VALMYIPSDDVDTLRKMLHNPISRLYEQPNETVKTLMAMIDPSIPLLVGDSGSSSGSSS
FT                   SSGGSGGSSGDGDGSDSGYNQGDAGTSSSGTTKASAVGIGCGAVAGAAAYGAGMFWVAR
FT                   RYRKKRQLHQRSPSSVDQMSEGRGAGSVLGAGGRLSRNSQNSRGTGRTQMISAPVMAEN
FT                   SLGWN"
FT   sig_peptide     223979..224047
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H9 "
FT   mat_peptide     224048..226960
FT                   /db_xref="UniProtKB/TrEMBL:A2R2H9 "
FT   CDS_pept        join(complement(229349..229482),complement(228545..229079),
FT                   complement(228113..228475))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902810"
FT                   /orf_name="An14g00810"
FT                   /product="Similarity to hypothetical protein EAA61688.1 -
FT                   Aspergillus nidulans"
FT                   /function="carbonate dehydratase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="carbon utilization"
FT                   /protein_id="CAK41880.1"
FT                   /db_xref="GO:0004089"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015976"
FT                   /db_xref="HOGENOM:HBG327802"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR019560"
FT                   /db_xref="UniParc:UPI0000EFC6F7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I0"
FT                   /transl_table=1
FT                   /translation="MFWGKHHDDTPEAAQQPPIPRKKLPSHLQTLADHDDGFYDDIYSS
FT                   SVDSTETPYRYAGYANRLRTVLLSAHRYVAYTSDIGESFRPVAHPWLVRSAYAISWTYL
FT                   IGDVAHEGYKAYLRNRRVLAPPCEAYKDASDLTHDKIAKGMVTGNIAGSLTGGDTLMPW
FT                   PTTHVPLAEDYRTVMAQRAVFQGIASMGLPAFTIHSVVKYSGRMLKNSRSVFFRTWAPI
FT                   GLGLSVVPFLPYLFDKPVEEAVEWAFHTGLRAYAGEDAVRPLPQAVRTPHDEDTSLSHF
FT                   LKLQAEKNNGEVMGHDANLSWEQYKEDRRRAKEQRMQEREQRGEAGPLALLGFGSNSKE
FT                   KKE"
FT   CDS_pept        join(230392..230439,230576..230700,230744..230807)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170763" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660424"
FT                   /orf_name="An14g00820"
FT                   /protein_id="CAK41881.1"
FT                   /db_xref="InterPro:IPR021278"
FT                   /db_xref="UniParc:UPI0000EFC6F8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I1"
FT                   /transl_table=1
FT                   /translation="MVVYYQIAGKQVGSHVLAMGVLGALFGGVGLATRGGSQPKPATPP
FT                   IQASSKDEETFIQTLKDMVGIFELKLMFITGTS"
FT   sig_peptide     join(230392..230439,230576..230623)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I1 "
FT   mat_peptide     join(230624..230700,230744..230804)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I1 "
FT   CDS_pept        join(231406..231830,231974..232038,232192..232376)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902811"
FT                   /orf_name="An14g00830"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /protein_id="CAK41882.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="HOGENOM:HBG327804"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniParc:UPI0000EFC6F9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I2"
FT                   /transl_table=1
FT                   /translation="MKPTPFPFALNIGTDIVHLPRITRLLARPNYLTRFTHRILHAREQ
FT                   QDFRTRFALPSLPPLSSQTQTPNISISPDMTRWLAGRFAAKEAARKAAPRGAAHISWKD
FT                   VVVTVGEDGGRPEVVYLDGEGEDEAGRVGKLSISHDGDVTLRQLRDGLWLCWGNIWMKG
FT                   GSVIAISYLESEMLAELPVEQNIRARLTRRNNSLLLHTALFTTLLVVQGHVSVSLSVAD
FT                   QL"
FT   CDS_pept        join(232544..232702,232771..233538)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902812"
FT                   /orf_name="An14g00840"
FT                   /product="Catalytic activity: L-Histidinol phosphate + H2O "
FT                   /function="histidinol-phosphatase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /protein_id="CAK41883.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0004401"
FT                   /db_xref="HOGENOM:HBG327805"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniParc:UPI0000EFC6FA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I3"
FT                   /transl_table=1
FT                   /translation="MPFTHHSHSGQFCPGHAKDNLEEIIQLAISKKFHTFCLTEHMPRH
FT                   EEDFYPEEIEAGDTESSHVANEAAYFAEATRLRTKYADQINILIGFEIDWIRPASRQLI
FT                   EESLSRHPFEFFMGSVHHTLTVPIDYDRPLYEKARALAGGTDELLFEAYFDEQLDMLKQ
FT                   VKPVVVGHFDLIRLKSDDPDRSFQDYPRVWEKILRNLDYVAGYGGLLEVNSAALRKGMK
FT                   EPYPNGEICKEFLARGGRFCLSDDSHGLAQVGLNFHRVVPFLEQVGVSRLHYLALGEGD
FT                   APVDARFPRTQIKEVTLEEVKNMSFWR"
FT   gap             233812..233911
FT                   /estimated_length="unknown"
FT   CDS_pept        join(234051..234178,234343..234407,234495..234555,
FT                   234626..234692)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902813"
FT                   /orf_name="An14g00850"
FT                   /product="Catalytic activity: peptidylproline "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAK41884.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI0000EFC6FB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I4"
FT                   /transl_table=1
FT                   /translation="MGVTKTVISPGNGQQFPQKGDQISMHYTGCLYDENAPNKMGKQFD
FT                   SSRGRGPFKTAIGVGRLIKGWDEAVPQMSVGEKAILTITPDYGYGAQGFPGLIPPQSTL
FT                   VL"
FT   CDS_pept        join(complement(236806..237341),complement(236634..236748),
FT                   complement(236458..236576),complement(236339..236406),
FT                   complement(236197..236287),complement(235877..236130),
FT                   complement(235507..235793),complement(235282..235417),
FT                   complement(235072..235214))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902814"
FT                   /orf_name="An14g00860"
FT                   /product="Catalytic activity: diacylglycerol + H2O  "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /protein_id="CAK41885.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="HOGENOM:HBG326885"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI00003502C7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I5"
FT                   /transl_table=1
FT                   /translation="MASALLWLSLLGGSTLASTLDTSNTPTIKRADAGNNTSSIPTATL
FT                   NNTVFIGRSLPEFEQELFLGIKFADEPVRFTPSTLKTVYRANDSDNGVYHASTASGLQT
FT                   SSGTVLYNATEYGYDCPGYGSDETELAEEGYARFDENCMNLNIIRPKREKEDELLPVMI
FT                   WIFGGGWVQGATADPRYNMSYIVRQGALNDKPVLGVSINYRVAAFGFLDSVEVMESGNT
FT                   NLGLRDQRVAMHWVKQNIKAFGGDPDKITIWGESAGAYSVGAHLVTNDGDNEGLFRAAI
FT                   MESGNAVGPPYNGTDWYQPMYDQIVNATNCTTSSNTLQCLREVPFSTIYTAADIGLEWF
FT                   ATIDGTFIKEYPQISITEGRFAKVPILHGTNTDEGVSFGTTGVNTDAEAIQQLMASKRW
FT                   VLNETQATTLLSHYPNISALGCPYGWGNTTWPKLGYEYKRYESMAGDLCMVAPRRLLSQ
FT                   KMKEYEEQVFAYRWDVAALNDSSTIGVAHFAEIPFVFANPVQNITPLGSDPARLELGNL
FT                   AARMWTAFVTDLDPNGHGVSGIPHWPKYNLTDPRDFVFRLPRDGSYVEKDTFRTGGIDY
FT                   INTIVR"
FT   mat_peptide     join(complement(236806..237290),complement(236634..236748),
FT                   complement(236458..236576),complement(236339..236406),
FT                   complement(236197..236287),complement(235877..236130),
FT                   complement(235507..235793),complement(235282..235417),
FT                   complement(235075..235214))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I5 "
FT   sig_peptide     complement(237291..237341)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I5 "
FT   CDS_pept        complement(238421..240340)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813227"
FT                   /orf_name="An14g00870"
FT                   /product="Similarity to hypothetical protein K06A9.1a -
FT                   Caenorhabditis elegans"
FT                   /protein_id="CAK41886.1"
FT                   /db_xref="HOGENOM:HBG327806"
FT                   /db_xref="UniParc:UPI0000EFC6FC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I6"
FT                   /transl_table=1
FT                   /translation="MSSNGGFADLFSLGTASTTNTGRRSTSTIRSRNRRLISFTEDEVD
FT                   ENGKQMQSSGLSSMLSPDNSAVRSRGATPSPNPSRGVSPIPMRHPSRATEAANRSKGNS
FT                   SLGGFCREEESGIMFAESSRAAVDFFDASWTSLQSLASSVLGSDIARPATTNGSARGHV
FT                   RKPSRPDPYMRPPARTSTPATWGPSAPSTPEIGSGTQEERQALVQAKKREALLLADTGP
FT                   AWSTTPRHKRRDSSDRTGHSNIDPDLDEDALAYIHHVQSTDTITGVTIRYGCQPAVFRK
FT                   ANGFWPSDSIQGRKTVLLPVDSCSIKGRPIRPKMGEDLLGDDHQERESLEDMNGSSIAP
FT                   TSAPTSAEGATSASPAAEIEGDRIWKHESWVRIEGFPGPVEIGRVPRRALGFFPRTRRK
FT                   SVSYSDSVSSPLSGRGGTTAPSSPSPIESASTQPVIPPWARPHADSSASRTSSKGRPGI
FT                   RHQRQRSNIQLSGPGVGTLDHDSNAPGPAMDGLSKFFAQHLPNLAPVARPPDFESSSES
FT                   ASTAAANTPTSLDNLGGAVESWVRKMTTRAKASLNELQQTQGPATHDPAQAMGRRGNGD
FT                   LIELNDGLESRSSSNAISEPRWRPDLLRSGSSLHEGTALRGRFLSPSPGTSRTRSGGDR
FT                   AKDD"
FT   CDS_pept        join(complement(242702..242767),complement(241464..242645))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225141" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902815"
FT                   /orf_name="An14g00880"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAK41887.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI0000EFC6FD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I7"
FT                   /transl_table=1
FT                   /translation="MASARGPRWQQFLQELVMVAGTSASAYFLIRYLLSRLDFDPESQK
FT                   KEEQKRKSAAILRKLDGGDESDEDSPRRGGKGGRRPKRGDLVLNQYEQAIAMDVVAPDD
FT                   IPVSFEDIGGLDDIIEELKESVIYPLTMPHLYASTSSLLTAPSGVLLYGPPGCGKTMLA
FT                   KALAHESGACFINLHISTLTEKWYGDSNKLVNAVFSLARKLQPSIVFIDEIDAVLGTRR
FT                   SGEHEASGMVKAEFMTHWDGLTSANSMGEPQRVVVLGATNRIGDIDEAILRRMPKKFPV
FT                   ALPPAAQRLRILSLILKDTKVDRDNFDLDYLVKGMAGMSGSDIKEACRDAAMVPVRELI
FT                   RQKKAAGQQMTAVDPKEVRGLRTEDFFSRAGGVRVIPPPAQLSNKANSEKEWSTESEAA
FT                   SEAEARTPAEMAEPPE"
FT   mat_peptide     complement(241467..242633)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I7 "
FT   sig_peptide     join(complement(242702..242767),complement(242634..242645))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I7 "
FT   CDS_pept        join(243171..244071,244126..244563,244617..244840)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813228"
FT                   /orf_name="An14g00890"
FT                   /product="Similarity to nucleolar phosphoprotein p130 -Homo
FT                   sapiens"
FT                   /function="DNA binding"
FT                   /protein_id="CAK41888.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG327807"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020981"
FT                   /db_xref="UniParc:UPI0000EFC6FE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I8"
FT                   /transl_table=1
FT                   /translation="MPKRKAAAALSGSAGDEDPMQANDSGRERPTKKQRGRPRSKSAEM
FT                   KPQMQSGRDSSTAAPQASEAPTRKSGRRGRPKGSRSSVQATQDISEEQAEVRESEHEAD
FT                   DQEAEGAAASNDEADGAQDVAKPTKATKSTRAAPRGRKNATIRNSVQTDGGFEYTPSTG
FT                   RQSKSLDKPEDRPEPPKRQRRKPEVEENNDAQDNESTAPDVVDETLLQDAPMEARSVSR
FT                   SPTKRRQSQKGIYSSPSKSRLGGTTEANVEPELRRRIGELTKKCDTLENRYRNLKEIGI
FT                   VEANSNMEKLRKQCESMTNASNNLIASLKAELEAQKALGQQSRSLQRQLKERDAEVAQL
FT                   KSQAEEATGQLSSAQTEVKALQTKLAAARNTAASLENAASKIPGSAIKSGANRANAAAV
FT                   TAEAAQAAQFAQLKEDLYTDLTGLIIRDVKKRPSDNLYDCIQTGSNGTLHFKLVVPHVS
FT                   TANFETAEFQYIPLLDENRDRELVDVLPEYLTVDITFVRQQASKFYTRVIDALTKRRST
FT                   AAI"
FT   CDS_pept        join(245563..247302,247355..247542,247601..247742,
FT                   247819..247927,248018..248829)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902816"
FT                   /orf_name="An14g00900"
FT                   /product="Function: Mcd4 is involved in cell wall integrity
FT                   in yeast."
FT                   /function="transferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAK41889.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG609268"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR007070"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR017852"
FT                   /db_xref="UniParc:UPI0000EFC6FF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I9"
FT                   /transl_table=1
FT                   /translation="MARLGRVGFLTLAVVFHLIYAYSIFDIYFVSPIVSGMSSFRVERE
FT                   PDAAAPAKRLVLFVADGLRADKAFQALPDPDDTTGEDADPVYLAPFIRSRVLSHGTFGI
FT                   SHTRVPTESRPGHVALIAGLYEDVSAVTTGWKLNPVNFDSVFNRSRHTWSWGSPDILLM
FT                   FQEGAVPGRVDADTYGEEEEDFSSDATRLDTWVFEKVKDLFASAKTDPELDAKLRDDKV
FT                   VFFLHLLGLDTTGHFSRPYSKEYLRNIKLVDRGVQEITKLVEEFYGDDETAFVFTADHG
FT                   MSDWGSHGDGHPDNTRTPLVVWGSGVAGPRYTQEGTLTGHEDGVSSDWGFDSIQRNDVA
FT                   QADVAALMAYLAGLDFPTNSVGQLPLQYLDASPKDKALAALANTQEVLEMYRVKEEQKK
FT                   AALLRYRPFEPLADHGRTSVNEHLEEIKAKITSGSYDESIAMSSALLANALEGLRYLQT
FT                   YDWLFLRTIVTLGYLGWIAYALTTVIDLHVLHGTSDSNRTAFSTSFFSSILVALFSVFF
FT                   VQHSSWRYYLYGFFPVFFWEEVFARRKALLAGRDILIGHVHSASGYVAFGFQLVAFVGV
FT                   LEALVQSYFHREIFTVCFVLGAFWPLCYGLGFVKKHTLLSFTWLVGCLLMSTFTLLPAN
FT                   KVEEIDTITWGGLLMFFTGLLYLLFENRILGKKEHPTQLSITLPSCGSRTIMGMQLGMV
FT                   MLALIVTRSSAMSLQAKEGLPFGNQVVGWFVLVTSLLLPFLYRLYPNRHYLHRLMVLFL
FT                   TFSPSFIILTISYEGLFYFVFCMTLATWVRLEHAIHVYTAAARNGAADATKPGTDAAAV
FT                   VEGHTYRYRTLSVSDARVALFFFFLLQSAFFSTGNIASISSFSLESVVRLIPVFSPFSQ
FT                   GALLILKILIPFAIISANLGILNRRLEVAPSALFMVVMSISDIMTLNFFYMVRDEGSWL
FT                   DIGTTISHFCIASFLCTFVAVLEFLSEVMISGVDFGLRSTAINAVNGSTKTNGTAMADK
FT                   KKHRKVQ"
FT   sig_peptide     245563..245625
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I9 "
FT   mat_peptide     join(245626..247302,247355..247542,247601..247742,
FT                   247819..247927,248018..248826)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2I9 "
FT   CDS_pept        join(250465..250480,250589..250668,250798..250980,
FT                   251080..251284,251402..251652)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902817"
FT                   /orf_name="An14g00910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41890.1"
FT                   /db_xref="UniParc:UPI0000EFC700"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2J0"
FT                   /transl_table=1
FT                   /translation="MLAGGGVVGTGGSHPVVAIPGLRRKEGGRISPGMCPSTRYFGVLE
FT                   PSLARVEDGDRKTEIAAIQPSRLTKSRLTIRMDPGWIPLRALARPYFLVRPKQLEQHRD
FT                   WLSWGPAKPYFQVSFCPELRLSDATLQGQWEEAVELLLAAAAAACFWGEGCSRPLPLST
FT                   GSWSHPSPSLLSPLIPGIFLPCAPPHCLFLSRALSPVTFRQAPSIASIGWRQILPPLLS
FT                   IFRACVVLYLFRSVPSVHLPGQ"
FT   CDS_pept        join(251963..252093,252293..252317,252469..252555,
FT                   252669..252790,252865..253592,253660..253732,
FT                   253795..254223,254278..254460,254510..255490,
FT                   255569..255613,255768..255825)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902818"
FT                   /orf_name="An14g00920"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK41891.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG324433"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFC72F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2J1"
FT                   /transl_table=1
FT                   /translation="MSTTENHSDPTASKTSPAPSTAGSTGTSGITVRTGPNGHMSFRRQ
FT                   RASRACEDFCLANMIFSCTCEDMPCSKSESIPLFLRVRCDAASLGVPCTNCVAFSIECK
FT                   IPTPKRKKNQTKSKETSGGEEAESKSPQSKPEPLPVESGKDAFGYQRNRMAVDGMPVTS
FT                   LTESQAAQQASQNSMYAQFMKPKFARAPIKEAGRVAYLGESSNLSLLVQDRHGTTDVVH
FT                   YPLPPNMGGTPARLTDLDSLELDILHQRGAFLLPPKPLCDELVEAYFKWVAPVVPIVNR
FT                   SRFMRQYRDPKNPPSLLLLQAILLAGSRVCTNPQLMDANGSTTPAAMTFYKRAKALYDA
FT                   NYEDDRVTIVQALVLLGWYWEGPEDVTKNVFYWTRVAMVVAQGSGMHRSVESSQLTKPD
FT                   KRLWKRIWWTLFTRDRSVAVALGRPIGINTDDSDVGMLTEDDFIEDEIDIAAEYPPDPV
FT                   HVQFFLQYVKLCEIMGLVLSQQYSVASKSRRMNAMDLTHSDMALADWLQNCPKEVCWQR
FT                   QRHHFWAALLHANYYTTLCLLHRAHMPPASSVSSNYRVEEMAYPSRTIAFQAAGMITSI
FT                   VENLQNHTEIRYAPAFIVYSLFSALIMHVYQMRSSVPSIVATCQERINICMQALKDVSK
FT                   VWLVAKMVHTLFESILGNKVLEERLQKAAGKRHQRVRPEAAQQPPAKKPEPPKRKFDEM
FT                   EFGLPNGGGPTPPVSYERSRPQTPAVTPSREMQPPGLNLPQGSPPAPGQPGASRGNTRP
FT                   TTPFNQYSLPATPPDLFLVTRTSPNLSPSLWENFQPDQLFPDGTTFFPELTSPQPNTVD
FT                   PQLQMQSQLQAQGMDQRAMMPQQVPGRGSISAAQGSPEVMSTLTPAIGLPGQHSQQVFG
FT                   IESQQGWPMQNMDATLGGAPMDAASQDDNWSSSSRSGPTAPTTLNVEDWFQFFGINGSF
FT                   GDLATESYIQVSPVVGDVDEGHS"
FT   CDS_pept        join(256393..256587,256686..257729,257798..257860)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117437"
FT                   /orf_name="An14g00930"
FT                   /product="Catalytic activity: Cystathionine + H(2)O [ "
FT                   /EC_number="4.4.1.8"
FT                   /function="cystathionine beta-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAK41892.1"
FT                   /db_xref="GO:0004121"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006238"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000EFC730"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2J2"
FT                   /transl_table=1
FT                   /translation="MSAAGSSSDAAVKKAFPRVDLEGHDLPPSPAPSSPHGGRRYNIAT
FT                   ELVYTEGNDQYNASSVPIYQSATFKQTSGGGGGEYDYTRSGNPTRTHLERHLAKIMSAQ
FT                   RALVVSSGMAALDVISRLLRPGDEVVTGDDLYGGTNRLLKYLSTNGGIIVHHVDTTVPE
FT                   KVREVLTSKTAMVLLETPTNPLIKVVDIPQIAAAAHEANPNCVVSVDNTMMSPLLLNPL
FT                   ELGADIVYESGTKYLSGHHDLMAGVLAVNDLSLGERLYFTINASGCGLSPFDSWLLLRG
FT                   VKTLKVRMDQQQSNAQRIAEFLETHGFKVRYPGLRSHPQYELHHSMARGSGAVLSFETG
FT                   DVGVSERIVESAKLWAISVSFGCVNSLISMPCRMSHASIDEKTRRERAMPEDLIRLCVG
FT                   IEDADDLIDDLRRALVQAGAVNVTLDDFQANSSN"
FT   CDS_pept        join(258654..258826,258928..259717)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902819"
FT                   /orf_name="An14g00940"
FT                   /product="Similarity to hypothetical protein SPBC365.16 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK41893.1"
FT                   /db_xref="HOGENOM:HBG332679"
FT                   /db_xref="UniParc:UPI0000EFC731"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2J3"
FT                   /transl_table=1
FT                   /translation="MPRNALSSEAPLPMSAITEQSISSDWNTNRLGARLGVDIASAATA
FT                   GALTCPVITVIDRAIIEKAAKGVPIRQTITSCFRSMFTKPGSFFLSTPFLLIYTLYTST
FT                   YLTANTIDTFTSTVRDKPFSTVFPGTAKFLTTTAVNMGICVYKDARFARIFGAKPSPAA
FT                   TPGSTSAPQPASRSTSASTPASCHPSGAAKVPKISYGLFCLRDSITIFASFNIPALVAP
FT                   SIPDSIAATPGMKAALAQFSCPALMQFASTPMHLLGLDLYNRQPPGGLGWRERASRIRR
FT                   DYIPSCFARMGKIVPAYGVGGVVNVRMRASLMEYLEGGK"
FT   CDS_pept        join(complement(262416..262534),complement(262301..262364),
FT                   complement(262067..262254),complement(261970..262018),
FT                   complement(260896..261915))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170841" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117438"
FT                   /orf_name="An14g00950"
FT                   /product="EC:1.6.99.-."
FT                   /EC_number="1.6.99.-"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK41894.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324432"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI0000EFC732"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2J4"
FT                   /transl_table=1
FT                   /translation="MTLGPRPYYWPNTETVSYGGSPPIATRSGWMALALLPFVLALSAK
FT                   ANLISTLTGVPHEKLQVFHHWTSYAMFVLALVHTFPFIVYHIDQGDMVDQWKTEVTYWT
FT                   GVAAIIPQAYLTFMSFPAIRNRFYEFFKATHFLAALAPLTYHVMDPAHPTRDYFISAGA
FT                   IYILSLWISNIRTYFMHGRHTATIEQLPCGLVRIRIPTIMTWRPGQHVFVRFLSIQQGI
FT                   HCLSAHPFTICSLYQDMERTGKAPEIIFYVKPRRGLTASLGNTALEQPNSSETVLLEGP
FT                   YGGISESVDFAQFDTYVLITGGTGGGFSLAILEEALRAHRQQQSTATIQVHFATRTAAL
FT                   ADWYREEIKAKLAAYNVQSDEISLSIHVTSKDSLLSTPASGSPLIPDSVEKRGPGGSSD
FT                   SVSSQIDIADTVVQLGNRPDISGIIAASTASHTSRRIAIFTCGPGSMIRDVRNAAAHAQ
FT                   GQVLKKGSTVEEVYLHTEPFS"
FT   CDS_pept        join(complement(265380..265490),complement(264431..265318),
FT                   complement(263773..264366))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170852" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902820"
FT                   /orf_name="An14g00960"
FT                   /product="Catalytic activity: O3-acetyl-L-serine+H(2)S[ "
FT                   /EC_number="2.5.1.47"
FT                   /function="cysteine synthase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity"
FT                   /protein_id="CAK41895.1"
FT                   /db_xref="GO:0004124"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG327810"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI0000EFC733"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2J5"
FT                   /transl_table=1
FT                   /translation="MCTLGWMRSXKYFDPDCQPPLPLVELPDRLNPFHQDGVCRPSVGQ
FT                   TMCLALALTKQAMNLLEKTVVPGKTQTIVEFSSGSTVISMSMLARLMHGISDTRAFLSN
FT                   KSTETKLRMMQFFGLDVTLFGGPSQPDPFDERGGIQTARAMAMQSDEIVNPNQYDNDDN
FT                   WHAHIRWTGPQIFKQLPEINVLCAGMGTSGTMTGLGTYFKEVKPSVLRLGVCTAPGDRV
FT                   PGPRTFALMQVQEFPWREALDVHEEVSSYDAFSLSLDLCREGVVCGPSSGLSLKGLYQM
FT                   LEKRKSAGTLQQLAGPDGSIHCVFLCFDLPYQYVGDYFEKLGPERFPPIRNQNLAGVDL
FT                   YRYDESWERSPAVLFTEYYELPRCFSSNLLSEMVLRPLCCVLDLRTAGDFGTWHLPGSV
FT                   NIPLHSLDSHTAKPFSDADVLEAQWLELEALFSNADVLGKLSGHNVLMLCYHGDTARVA
FT                   SSVLRAKGIAADSLRGGYQALKDHLLWGSNGVESNKMGKAASATVEAVDAAAEDAVVAA
FT                   AAVETAVVVTDPR"
FT   CDS_pept        join(266386..266547,266603..266736,266789..267582,
FT                   267648..267837,267955..268095,268151..268463)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170863" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902821"
FT                   /orf_name="An14g00970"
FT                   /product="Induction: the S. pombe fnx1 gene expression is
FT                   induced during starvation"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK41896.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG328580"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC734"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2J6"
FT                   /transl_table=1
FT                   /translation="MPGISIENEVKHDNPSTISRDVVTESSGEESRSAAPPPIFNEQTN
FT                   YVPLSTIITIFLACSTVDFVAVMDQTTLAGSLSIIGNTLNASNKTSWISGGYFVTSTCF
FT                   QLLYGRLSDIWSRKYVLYIGLAIMFIGSLASSLAQTATQLIIFRAFTGMGGGGITSIAQ
FT                   MIVSDVVPLRERGKYQGILGAVIAIANGIGPVIGGALSPISHNSWRWIFRLMLPLTAIS
FT                   ILAVMFFMPLRKVTGNWKAKLKAVDFFGVFLALGGTAVLMLGLTWGGGEYVWKSAHVIA
FT                   TLIVGAAVCVAFVLWEWKGHPYPLIPMHIFKSRIVNGACLTMFINGWNIIVMLYYIPTF
FT                   YQLVFGYSTTKAGAMVLPITLLQTLSSTFSGLIVHWIGRYRESILVGWMIWAIGLGLMS
FT                   TLNETSNLGKQIGYGLLTGIGSGNTLQPNLIPKVHPSPPTLHIYPISYPLTPTTKYSFI
FT                   RNLGGTLGLAVSGTIINNLLSTSITSLHLTTAQKQSFLASPSNYLSKLPADEAAHVRAL
FT                   LIPAYKEGFRIVFTVNAALAALAFFLAVALMPQVKLERADDERLKEEGMRRREEQREGE
FT                   D"
FT   CDS_pept        complement(268881..271070)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813229"
FT                   /orf_name="An14g00980"
FT                   /product="Similarities to database proteins "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK41897.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG327811"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0000EFC735"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2J7"
FT                   /transl_table=1
FT                   /translation="MVLSLSVPSFSRSTTSSALRASESSNSTTISEALRNNPFGITSRS
FT                   RSLAASNTTSEEQKREQEELNQALQTLARIFPDIRIEVFRELLVRFDGQSRLHVCVEQL
FT                   LRHKETWVAGRWNVPAGVGGTEEDGKNDLRHTGHDQSVPPEELFRTNEYKAAVKAALTK
FT                   EFNGLSKSTVEAVLAEVNFCYLRARPTLQDLSRRTWRATFNSILPSFKRSKDKNEHPLI
FT                   VWQRQPDGDEIPRLKKTECPELDRELYRALLAPLLRTRREERLDRDQKLAEELNETEAK
FT                   EADAVYECECCLDDVTFEQISTCSDNTHIICYGCIRRTIHEALFGQGWGKSVDVEKSTL
FT                   KCLAPFDHDSCPGTLDPAIVKQAILLDKAGLETFTKFETRLSSEVLLKSQLKLIRCPFC
FT                   SYAEVDPVYHPSAQGRVWRFRRDGFISTLLITIFLLDLIPILIIPIAILYFVNSSAVFT
FT                   IFQNALLNLCLKTRPKKFTCAHPACRRVSCITCQKPWRDPHVCHEPLLLDLRATVEAAR
FT                   TAAVKRTCPRCGLSFVKSSGCNKLTCVCGYSMCYLCRKALGPPIKSANRLGRLRPRRRA
FT                   NLVENVDPAAGPDAINDELEAGNDDEFEEMEGYKHFCEHFRIDPGSRCTECNKCELYQD
FT                   EDEEAVARRAGEKAEREWHARQGTAGVGIGTLRVNNDFSKAEGKRRGNGGLSLHHQGKG
FT                   MSYWVDEVWRDGRWRIEGQTFVDWVVERVLVIDEF"
FT   CDS_pept        join(complement(275526..275681),complement(275222..275449),
FT                   complement(275052..275160),complement(274909..274998),
FT                   complement(274473..274860),complement(274009..274417),
FT                   complement(272629..273954))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902822"
FT                   /orf_name="An14g00990"
FT                   /product="Catalytic activity: 3-hydroxyacyl-CoA
FT                   dehydrogenase:"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="5.1.2.-"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase activity "
FT                   /function="binding"
FT                   /function="enoyl-CoA hydratase activity"
FT                   /function="isomerase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41898.1"
FT                   /db_xref="GO:0003857"
FT                   /db_xref="GO:0004300"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327812"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000EFC736"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2J8"
FT                   /transl_table=1
FT                   /translation="MSELRFDNQTVVVTGAGGGLGKAYALFFASRGANVVVNDLGGSHS
FT                   GEGKSAKAADVVVEEIRAAGGKAVANYDSVENGEAIIETAIKNFGRIDVLLNNAGILRD
FT                   ISFKNMKDQDWDLIYRVHTYGAYKCARAAWPHFRKQKYGRIINTASSAGLFGSFGQANY
FT                   SAAKLGQVGFTETLAKEGAKYNIIANVIAPIAASRMTATVMPPEVLENLKPDWVVPLVA
FT                   ALVHSSNTTETGGIYEVGGGHVAKLRWERAKGALLKTDASLTPGAIARKWNDVNDFSQP
FT                   DYPTGPADFMGLLEDGLKLPSAQAGEEPNFKGKVALVTGGGNGLGRAYCLLFAKYGASV
FT                   VVNDLVDPEPVVQEIKKMGGQAVGNKASCEDGENVVKTAIDAFGRIDILINNAGILRDK
FT                   AFTNMNDDLWNPVLNVHLRGTYKVTKAAWPYMLKQKYGRIVNTASTSGIYGNFGQANYA
FT                   AAKLGILGFSRTLALEGAKYNIKVNTIAPNAGTNMTRTIMPEEMVQAFKPDYVAPLVAL
FT                   LCSDIVPEPSTKGLYECGSGWFGRTRWQRTGGHGFPVDVKLTPEEVLKNWKKITNFDDG
FT                   RADHPEDGQAGSEKIMANMSNRSGGDSEGGNKILQAIEKAKQATTDGTSFDYEDRDVIL
FT                   YNLSLGAKRTDLPLVYENNEHFQALPTYGVIPWFNTANPWNMDEIVANFSPMMLLHGEQ
FT                   YMEIRKFPIPTAAKTLTYPKLIDVVDKGNAALVVSGYTTKDAKTGEDLFYNESTVFIRG
FT                   SGGFGGSPKPTARRPKAAVASYKAPQRKPDAVVEEKTSEDQAALYRLNGDRNPLHIDPE
FT                   FSKVGGFKTPILHGLCSLGVSGKHVFSTYGAFKNLKVRFSGVVLPGQTLRTEMWKEGNV
FT                   VLFQTTVVDTGKPAITGAGAELLEGAKAKL"
FT   CDS_pept        join(276706..276852,276936..277336,277553..277713,
FT                   277769..277932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117439"
FT                   /orf_name="An14g01000"
FT                   /product="Similarity to hypothetical protein CAB52731.1 -
FT                   Schizosaccharomyces pombe"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /protein_id="CAK41899.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG559891"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="UniParc:UPI0000EFC737"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2J9"
FT                   /transl_table=1
FT                   /translation="MPEIIDDKSQHCIPFLFDRLQAHQARHPTNTPPFFLGLNGVQGAG
FT                   KTVLVSTLQSTLRSPPYSLNVVTLSLDDLYLTHAQQEHLAASHPTNPLLQHRGQPGTHD
FT                   LTLAKEVFSALRAGQRTAIPAYDKSAFSGQGDRVPASQWEVVNKEGEEKVKVVIFEGWC
FT                   VGFRAWDEEVLRGKWEDAVSSLVYYSKMLIDCLYSDAQDLHFVYDWRQEQERTLRAAKG
FT                   TGMTEEQVTKFVDGYYPSYELFTETLREGTFKPVPHATTASAPPTGWEGRQLRLVVDKN
FT                   RRVQEIINI"
FT   CDS_pept        join(complement(280631..280644),complement(280466..280533),
FT                   complement(279741..279853),complement(279383..279549),
FT                   complement(278871..279330))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902823"
FT                   /orf_name="An14g01010"
FT                   /function="structural constituent of ribosome"
FT                   /function="transcription regulator activity"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAK41900.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG618766"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniParc:UPI0000EFC738"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K0"
FT                   /transl_table=1
FT                   /translation="MGRPSTTAFANRPTRELYGPSQWPPLLRTVPTKEQVLVPETLLKK
FT                   RKSQEQARAVAREEAEKKKAANKEKRAVIFKRAESYVKEYRDAEREKIRLARVARKEGN
FT                   FYVADEPKLVFVIRIKGINKIPPQPRKILQLLRLLQINNGTFVRLTKATQEMLTIINPY
FT                   IAYGYPNLKSVRELVYKRGYGKVDKQRVPLTDNQIIEENLGKYGIVCMEDLIHEIYTVG
FT                   PNFKQANNFLWPFKLSNPTGGFHTRKFKHFIEGGDYGNREENINGLIRQMN"
FT   ncRNA           complement(279612..279698)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snoZ196"
FT                   /db_xref="Rfam:RF00134"
FT   CDS_pept        join(280817..281071,281108..281292,281370..281678,
FT                   281722..281740)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902824"
FT                   /orf_name="An14g01020"
FT                   /protein_id="CAK41901.1"
FT                   /db_xref="HOGENOM:HBG397278"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016689"
FT                   /db_xref="UniParc:UPI0000EFC739"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K1"
FT                   /transl_table=1
FT                   /translation="MATRRGVGLGAFANRTQASQSFANHGANLRSSHLSSLQTQLSVFQ
FT                   SLLHTFALEHSSTIKSNPTFRAEFARMCNAIGVDPLAASNIGSFWTQIMGGDMNDFYFE
FT                   VAVRVVELCRATRSENGGLIGVEECRKRVGKGKAIGSGLEVTDDDVLRAVKSLEPLGSG
FT                   FSIVHVGSKQYIRSIPKELNTDQATVLEAIQVLGYVSISMLQANLNWEKARAQTVIDDL
FT                   LADGLVWLDAQAEENEYWSPQNLLDDSGISSDT"
FT   sig_peptide     280817..280870
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K1 "
FT   mat_peptide     join(280871..281071,281108..281292,281370..281678,
FT                   281722..281737)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K1 "
FT   CDS_pept        complement(282338..>283855)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000029414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813230"
FT                   /orf_name="An14g01030"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="eukaryotic translation initiation
FT                   factor 3 complex"
FT                   /protein_id="CAK41902.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005852"
FT                   /db_xref="HOGENOM:HBG608917"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000EFC73A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K2"
FT                   /transl_table=1
FT                   /translation="PRQHLXSYVEXHWMMSLTRSLQHIDPHTAEYIDRLGDEKQLYANL
FT                   VRTQVYVEGLTQSEKTDPRQDSLNRVVMRRLEHIYFKPSQVVTILEEGTWKVLPSELES
FT                   NVTPRGNTGDVTNLVQTLCSYLFKHSDGIIRARAMLCQIYFLALHDQYYRSRDLMLMSH
FT                   LTENIANFDVSTQILFNRTLVQIGLCAFRAGLIYEAQTTLSEVCGSGRQKELLAQGIIL
FT                   QRYSTVSPEQERLERQRQLPFHMHINLELLECIYLTSSMFLEVPLMAQTSSSPEMKRRV
FT                   ISKTFRRMLDYNERQVFTGPAENTRDGVIMSAKFLAAGDWKKAAEMLNSIKIWDLMPQP
FT                   DKVKEMLSQQIQEEGLRTYLFTYAPFYDSLSISTLATMFELPEKKIAAIISRMISHEEL
FT                   AAALDQVNDAIVFRKGVELSRLQSQIVTLADKSMNLLESNEKTLEQRTQGMANAFQRDQ
FT                   GAGARGGRGPRGGGQARGGPRFPGGQQGRRPGGQQFSGGALGGAIKA"
FT   gap             283856..283955
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(284447..284786),c
FT                   omplement(<283956..284357))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902825"
FT                   /orf_name="An14g01040"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="eukaryotic translation initiation
FT                   factor 3 complex"
FT                   /protein_id="CAK46444.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005852"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="UniParc:UPI0000EFC73B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K3"
FT                   /transl_table=1
FT                   /translation="MSRFFYGGGSDSESSSSEEEELYSDREEEEQSEEESSEEESEEEE
FT                   ESSSEDEDAGKTGANRFMKNVSESEESEDEERVTIVKSAKDKRLEELENTVKLIENAEK
FT                   ISDWAVISTEFDKLNRQIVKIVQSGPTPKIYVKTVADLEDFVNGTISKQKSSNKKMNAS
FT                   NAKGFNAVKQRIKKNNKDYAVQIDKYRKDKDGFMEAKEEVARPVAAAPRLTKIERIEAP
FT                   ALSTAGDDEVLRPLAVAARPSSTPP"
FT   CDS_pept        join(complement(288617..289169),complement(288276..288547),
FT                   complement(288020..288219),complement(287796..287955),
FT                   complement(287477..287736),complement(287300..287419),
FT                   complement(286881..287239),complement(286066..286829))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170931" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902826"
FT                   /orf_name="An14g01050"
FT                   /product="Catalytic activity: ATP + a Protein  "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK46445.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG327364"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000EFC771"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K4"
FT                   /transl_table=1
FT                   /translation="MDSQWQAYQDPLMGHPAQFNNGLTSNPQQLASKYGAQPQHSQPPV
FT                   GYTYEPFQSPGTTAKPPSIGANSRTVSMASSPAATPRSRDYVTDADTTMEDADPYNRAK
FT                   YSTRPSHHSRPSSQYFPSEESSAARRYSPMNVLSPSMSFNASPGKSHNSYAFPPGPNQP
FT                   RRSPTRGSTYASPPQAFQSPPSASRPPRLPPLQPTDMSPDQYYPPSAGSQLNAAFAQDG
FT                   RSPRSASISGGSQQPGRGPVPKFQKIKSIQELQPRMNAQPPYRRANPDGGFISPLQALT
FT                   THLPATYRICNPGFNYESSRNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAG
FT                   HKNRYLILDVLGQGTFGQVVKCQNLKTGEVVAVKVIKNKTAYFNQSMMEVSVLDLLNSR
FT                   YDKNDDHHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLN
FT                   ALSLLNKAHLIHCDLKPENILLKNLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEV
FT                   LLGLPYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVCRIVEMLGLPPTWMLEMGKQS
FT                   GEFFEKTQDEFGRKTYRLKSLEQYSREHNTKEQPSKKYFQASTLEEIIRSYPMPRKNMK
FT                   QAEIERELNNRVAFIDFVRGLLAINPLERWSPQQAKLHPFITQQKFTGPFMPPMNLKYS
FT                   SLNKTVPPGIQQQQQAEAASKQRAAQAAHAQSAAQNAYAMQLNQFHTPTHAQPPPMYNG
FT                   IFTGHQQGAPPPYPTQPPAYGHQMNLIPGQVPQAQYAPSQSLYAQATTRAGRQRASTMD
FT                   PQGGGIPPTIQRVASHLDPNAPIRLQPSPAYYPPPPDGYVDPNSAGQRRRGSRTGGTRN
FT                   RDFIRTLEDGVLGGEGFMGQNQWH"
FT   CDS_pept        join(291399..291635,291691..291764,291822..295182)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117440"
FT                   /orf_name="An14g01060"
FT                   /product="Complex: protein may interact with TFIIH "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAK46446.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG590781"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000EFC772"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K5"
FT                   /transl_table=1
FT                   /translation="MDGAKLNDVDVAASRSGFDEDMKKEEEPEQQAKSTLDPAESEASL
FT                   NQGHSANADEASRLRELQADVRDQDDLERDISRQADRLLMEQADERDSKRLEKTTLEKQ
FT                   KLESQILKLHQRLSQPVGTSARVRISNEIEKLESRNTALATDLKEIQQRMDERHQGDEA
FT                   GSQTTGTGRMPNESRRDYLIRTGKITPFSNMSSGPNHGPLASLQDALIDAEDERDEKEA
FT                   LEQVKNRSAVSHRNLVRPGFGFDETPASSLVDEAPTSRASKRRKIDRESHEEEEEALEQ
FT                   ETKVSLEDNFEDQDESASYVESERQSSVSEDEEEFLPEERPKRTAKPVKAPKSSDEVED
FT                   FSGMDDGNEELYQTRLQYWVSRRAAARKRALESRVAGHGPEVDAAGDNVDVLDQDEQEE
FT                   WFMPHPTVSDMPYDNGYRIPGDIHPLLFDYQKTGVQWLWELQQQQVGGIIGDEMGLGKT
FT                   IQVISFLAGLHYSKKLTRPVIVVCPATVMKQWVNEFHRWWPPFRVSILHTSGSGMVNIR
FT                   NESSREDALLSQAWNASSTRGMPSGLKAARKVVKRVVEEGHVLVTTYSGLQTYASLVIP
FT                   IEWGCAVLDEGHKIRNPNTSITIHCKELRTPHRIILSGTPMQNNLTELWSLFDFVFPMR
FT                   LGTLVNFRNQFEFPIRQGGYANASNLQVQTAAKCAETLKDAISPYLLQRFKIDVAADLP
FT                   KKSEQVLFCKLTKPQRQAYEAFLGSEEMKSILNGRRQVLFGVDILRKICNHPDLQNHKL
FT                   MSSTTGYGSGSKSGKMQVVKSLLELWKDTGHKTLLFTQHRIMLDILEKFVNSLSGFSYR
FT                   RMDGTTPIQHRQAMVDEFNNDPSLHVFLLTTKVGGLGVNLTGADRVIIYDPDWNPSTDV
FT                   QARERAWRLGQKRDVTVYRLMTAGTIEEKIYHRQIFKQFLTNKILRDPKQRQTFQLSDL
FT                   HDLFSLGDEGQGPTETSKIFKDADVTYEDSDGTSRKSNAAIKSSASSHSAQEEKKDISK
FT                   VVGVAAVEQFQGDQEQQSEQEKGTSGANSESRIMEGIFARSGVHSALEHDQIVNGKRVV
FT                   RADPKIIEAEAKRVAAEAAEELRRAGEAARSVPIGTPTWTGQFGLAGKPEEQLPSRPAF
FT                   GGSSSAARRAVAGPSSASILANLSARTPSPRSSSNSPAPSRTPSGIDFITMIRDFITAQ
FT                   GGSVYTQMLIDHFNRYCTTPQRSAEFKEMLKTIAVLDKGGRNGRGKWALKPEYAKRR"
FT   CDS_pept        join(297289..297697,297764..297855)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902827"
FT                   /orf_name="An14g01068"
FT                   /product="Similarity to EST an_2307 -Aspergillus niger "
FT                   /protein_id="CAK46447.1"
FT                   /db_xref="HOGENOM:HBG327365"
FT                   /db_xref="UniParc:UPI0000EFC773"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K6"
FT                   /transl_table=1
FT                   /translation="MKFLASLALLASTVAASPMLYPRQSSNSTQSFYLKTSGASNDNHN
FT                   NLYVYAYHTGAGFNDAVLTSDVGTASPAFLNGTHTQFDLGTSFPWGFKMGVQNNYAAWE
FT                   SVQINVGYGDDDFAIGTTGLEWSAQDGFGGWLVCDWYPTHPSSSTSTATKSPLFLPPAA
FT                   LST"
FT   sig_peptide     297289..297336
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K6 "
FT   mat_peptide     join(297337..297697,297764..297852)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K6 "
FT   CDS_pept        join(299188..299293,299379..299984,300034..300170)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170964" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117441"
FT                   /orf_name="An14g01070"
FT                   /product="Similarity corresponds only to multiple A and T-
FT                   repeats."
FT                   /protein_id="CAK46448.1"
FT                   /db_xref="HOGENOM:HBG327366"
FT                   /db_xref="UniParc:UPI0000EFC774"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K7"
FT                   /transl_table=1
FT                   /translation="MRSMSRLFILCLLLLLGTVTSAWPWRPHGELLRRADTTAAESATT
FT                   GAAATTESASKTEAATKTAAATGTDTTATATGTNTKSATKTGTASGKSSGSSSNSTTSV
FT                   SINPAAGAGGISMLIPTEGATSYYKIGDFVTLEWNYTSLTISPTAVNVVASCSLNSATY
FT                   TISSNMTMSPTGKVVWDTKKYQANATVPLLTASYTLIVWDASKAITETASAGYLSAASS
FT                   YIFGMYSSQPYTPLNGFVCATCSGAFSELERLGMKFTFGMFAITVLSFTWFAGGFGLFS
FT                   T"
FT   sig_peptide     299188..299253
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K7 "
FT   mat_peptide     join(299254..299293,299379..299984,300034..300167)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K7 "
FT   CDS_pept        join(complement(303062..303253),complement(302350..303006),
FT                   complement(302114..302278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966400"
FT                   /orf_name="An14g01080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46449.1"
FT                   /db_xref="HOGENOM:HBG327367"
FT                   /db_xref="InterPro:IPR021627"
FT                   /db_xref="UniParc:UPI0000EFC775"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K8"
FT                   /transl_table=1
FT                   /translation="MASAPNPGQTLPRMPVVVPAMVPPSNGAEASTGGASNTDPSPDAW
FT                   DSEMQLVSSLAKLQKMEAMIHQLRTLLPERLLEPLAPIVNPKAAAGRPVPKSPQMLYEQ
FT                   LAQAARAGVSELQEFQSMWRSPEMKAVWDRIDAQIKENGGVMLQPTGKWERDYDTILAD
FT                   LREEEQTQNEQQQKANEEMERSKIQATEGGWRAIVEGFAQKNVPGVRVLASQSEAAVTV
FT                   VLVKAGMVFRVEAIAGQDGNGVPDWRVFTRTPGGQTPSKVETAVAQCLNSRPRQWDLLY
FT                   LLDMISSYSTIKQTPCAKCTKMTDSTATLPTIRKPSSTPQEQGSQTWEAYHQGCTE"
FT   tRNA            303718..303790
FT                   /gene_name="tRNA-Lys (CTT)"
FT   mobile_element  304070..304218
FT                   /mobile_element_type="transposon:Tndm1"
FT                   /locus_tag="An14e01100"
FT                   /note="Title: probable transposon 160bp LTR (Tndm1-LTR) -
FT                   Aspergillus niger"
FT   CDS_pept        join(complement(305962..306411),complement(305241..305901),
FT                   complement(304918..305184),complement(304705..304865))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117442"
FT                   /orf_name="An14g01110"
FT                   /EC_number="1.14.14.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, reduced flavin or flavoprotein as one donor, and
FT                   incorporation of one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46450.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016712"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397671"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002402"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000EFC776"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K9"
FT                   /transl_table=1
FT                   /translation="MLAAAIVFLGAIYLTFRILSSLHQAYHHRKKAKALGCQPPNSVDT
FT                   GFLGITGFYRIAKAAREKRWVEYIAEHYQTSGPTFRQQALGGLMVTNTVEPENIKALLA
FT                   TQFQDFGLGTRHREFYPLLGNGIFTLDGAGWSHARGMLRPQFTRDQVADLDLMDGHVTK
FT                   MMDLIPKDGSTFDIQRLFFLLTIDSATHFLFGESVGSMRTSAESSLLEKSTVGNAQGFA
FT                   EAFNRAQEYLAARSRAMAFYWLVNPKEFREANQLVHEVVDHYVRLALEAKRHPEKKEPG
FT                   RYIFAEALAGDTDDPRVIRDNMLNILLAGRDTTASLLSSAFFYLARHPNVWTRLRQTIV
FT                   DEFGDAQHPNGKITHARLKDTPYLRYFLNEVLRLLPPVPLNFRVAAKDTSLPLGGGPDG
FT                   KAPIYVRKGELVSYSVYAMHRRTDLYGPDAHAFRPERWEENSKRGWEYLPFNGGPRICL
FT                   GQQYALTEASYTMVKLLQRYNRIENADPDMMEPIINSSLTLSHDRGVHIRLFSA"
FT   mat_peptide     join(complement(305962..306351),complement(305241..305901),
FT                   complement(304918..305184),complement(304708..304865))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K9 "
FT   sig_peptide     complement(306352..306411)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2K9 "
FT   CDS_pept        join(complement(308680..308838),complement(307156..308625))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170997" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660425"
FT                   /orf_name="An14g01120"
FT                   /EC_number="3.4.16.-"
FT                   /function="carboxypeptidase activity"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK46451.1"
FT                   /db_xref="GO:0004180"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="HOGENOM:HBG327369"
FT                   /db_xref="InterPro:IPR008758"
FT                   /db_xref="UniParc:UPI000004F600"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L0"
FT                   /transl_table=1
FT                   /translation="MGSRQGKAPFGWGTQSLAHFGINPDLGLHNQQNLNSLISHSAMAT
FT                   ALETEYATIPIDHNNASAGTYQNRFWVSDEFYQPGNPIFVYDTGESDGGSIAQSYLTST
FT                   LSFFREFLIEFNAMGIAWEHRYYGNSTPAPVSYETPPEAWQYLTTKQALADLPYFASNF
FT                   SREKYPDMDLTPQGTPWIMVGGSYAGIRAALTRKEYPETIFAAFSSSSPVEAQVNMSAY
FT                   YDQVYRGMVASGWTNCSADIHAALEYIDDQLSDEDTATSVKQLFFGSGAETNSNGDFTA
FT                   ALTAIYGYFQSYGMAGGIGGLGAFCEYLEIDPKTNGTTGPDGLAPTYGGQYVAERWAAW
FT                   PTFLELVNLNMGTNCGPQDASQPIDCDFSKPYGDPSAITWTWQYCSEWGFFQANNDGPH
FT                   SLASRYQSVEYQQEVCNRQFPDAVDKGLLPPSPRADDVNQEFGGWTIRPSNVYFSGGEF
FT                   DPWRSLSILSTEDFAPQGVEFTSAIPACGVQTNEDTVFGYVMQNSEHCFDFQATPTVGK
FT                   LSRGIFTSALLQWLECFGQNSSQSR"
FT   CDS_pept        join(311672..311927,311970..312077,312126..312247,
FT                   312294..312363,312410..312485,312531..312582,
FT                   312630..312841,312890..313111,313174..313420,
FT                   313478..313618,313682..313738,313867..313905)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902828"
FT                   /gene_name="rglA"
FT                   /orf_name="An14g01130"
FT                   /product="Probable rhamnogalacturonate lyase A "
FT                   /EC_number="4.2.2.-"
FT                   /function="carbohydrate binding"
FT                   /function="carbon-oxygen lyase activity, acting on
FT                   polysaccharides"
FT                   /function="carboxypeptidase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK46452.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004180"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0016837"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG327370"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR015364"
FT                   /db_xref="InterPro:IPR016590"
FT                   /db_xref="UniParc:UPI0000591327"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R2L1"
FT                   /transl_table=1
FT                   /translation="MLSKTSLLSLLSLAAGVVNADFGITTNDDSYVINANSPNSLVFTV
FT                   DRGSCDITSIVHYGTELQYSGKGSHIGSGLGTATVSATKSGAGDYIKVTCETDTLTQYM
FT                   VVHDGDPIIHMATYITEEPSIGELRFIARLNSDVLPNEEPFGDVSNTADGEAIEGSDVF
FT                   LVDGETRSKFYSSQRFIDDQRHCIAGDEHRVCMILNQYETSSGGPFHRDINSNNGGDYN
FT                   SLYWYMNSGHVQLESYRMGLHGPYSMYFSRSGTPSTDIDTSFFADLDIEGYVAESGRGT
FT                   VSGTASGADSSFDWVVHWYNDDAQYWTYTSSSGSFTSPAMKPGTYTMVYYQGEYVVATS
FT                   EVTVSAGSSTSKDISGSVETGTTIFKIGDWDGQPTGFRNAENQLRMHPSDSRMSDWGPL
FT                   TYTVGSSSLTDFPMAIFKSVNSPVTIKFTATSDQTGAATLRIGTTLSFAGGRPQATIND
FT                   YEGSAPSAPTNLDSRGVTRGAYRGYGDVYDVSVPEGTIVEGENTITISVISGSSGDDFL
FT                   SPNFLDAVFIIALVDN"
FT   CDS_pept        join(complement(315500..315736),complement(314011..315374))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660426"
FT                   /orf_name="An14g01140"
FT                   /product="Putative frameshift"
FT                   /EC_number="3.5.4.3"
FT                   /function="guanine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK46453.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008892"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="UniParc:UPI0000EFC777"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L2"
FT                   /transl_table=1
FT                   /translation="MSPKYTLFVGTFIQLPRFKSEEGHQLAITRGALWVSTADGTIEGF
FT                   DWSIANDRDLKRFLRHKGWTVVNDKDGHNKNKHGKHPIDTHIHAPQYPNAGLFGDAGLL
FT                   HWLKNYTFPIEASSAAPNSPPSLYAYRVYNQVVARTLANGTTCASYFATIHVPATNLLA
FT                   SLCHARGQRALIGRVCMDRPEQCPDDLRDESPDIAIDKTQASIDHIHTIDPEGALIQPI
FT                   VTPRFAPSCTPRSLGKLSKLAASYSPPLHIQTHLAENLDELDLVKKLYPESRDYTSVYN
FT                   YFKLLTPRTILAHCVHLSDDERAMIAENDAKLSHCPASNSALGSGICEVRKAIDSGITV
FT                   GLGTDVSGGYNPSILETVRQACLVSRLLPHMSRAQPEEREGTPDDNDDKVPREVLSIEE
FT                   ALYLATRGGAAVVDMADQIGGFDQGMVWDAQMVKLGKFNPAGRWGKTGGVESAVDVFDE
FT                   GQSWKEKVHKWVWNGDSRNVRMVWVGGRLVHRVWEEGEDRDGRGKGGWVRWVMGAVGVG
FT                   AVGWVIVRRLGGGR"
FT   CDS_pept        join(complement(316439..319565),complement(316332..316387))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239369" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902829"
FT                   /orf_name="An14g01150"
FT                   /EC_number="1.4.4.2"
FT                   /EC_number="2.1.2.10"
FT                   /function="aminomethyltransferase activity"
FT                   /function="glycine dehydrogenase (decarboxylating) activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="glycine decarboxylation via glycine
FT                   cleavage system"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46454.1"
FT                   /db_xref="GO:0004047"
FT                   /db_xref="GO:0004375"
FT                   /db_xref="GO:0019464"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG286723"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniParc:UPI0000EFC778"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L3"
FT                   /transl_table=1
FT                   /translation="MAASLCALRGTRQLALRSRLRAAPSPIAVRRVSPLIRSLHTTTQQ
FT                   SPSARRPVYTSSVADHGVPHPPDLFQPLDTFPRRHIGPSPDAAKEMLATLDPPVASLDE
FT                   FVKQVLPADILSEKDLKVSAPHSTANLPHSSVHGGLGETDMLKLLDTYRKQIDVSGKTY
FT                   LGTGYYPTIVPPVILRNVLENPAWYTSYTPYQPEISQGRLESLLNFQTLTADLTGLPFA
FT                   NASVLDEGTAAAEAMTMSLATLPMSKQKKAGKSYVVSHLCHPQTIAVMRSRAEGFGINL
FT                   VVGDILADDFKLVKEQGDKLIGVLAQYPDTEGGIYDFQSLSDTIHGSGGTFSVATDLLA
FT                   LTLLKAPGEFGADIAFGSAQRLGVPMGYGGPHAAFFACADKYKRKVPGRVVGVSKDRLG
FT                   NRALRLALQTREQHIRREKATSNICTAQALLANMTAMYAVYHGPAGLKAIAQRIMSMTT
FT                   TLQAKLAGLGYNVPIKSNSADGGALFDTVVVELSGAQETDAIIAAAREQSIFLRRLNDT
FT                   KVGISLDETVGREEVKSILRVFAAHASKAEVGLEEDLAVAPVPASLERTSAYLTHPVFN
FT                   THHSETEMLRYIRHLESKDLSLAHSMIPLGSCTMKLNATTEMIPISWPEFSQMHPFLPA
FT                   DVAKGYTQMIDDLEQQLADITGMAEVTVQPNSGAQGEFAGLRVIKKYQEAHEGDKRNIC
FT                   LIPVSAHGTNPASAAMAGMRVVTIKCDTKTGNLDLEDLKAKCEKHKDELAAVMITYPST
FT                   FGVYEPGIKQACEIVHQHGGQVYMDGANMNAQIGLCSPGEIGADVCHLNLHKTFCIPHG
FT                   GGGPGVGPIGVAEHLRPYLPSHPGSEYLQSKRTESSSPPISAAPWGSASILPITFNYIN
FT                   MMGSKGLTHATKITLLNANYILARLKDHYPILYTNENGRCAHEFILDVRKFKDTCGVEA
FT                   IDIAKRLQDYGFHAPTMSWPVANTLMIEPTESENKAELDRFCDALISIREEIAAVESGA
FT                   QPQEGNVLKMAPHTQRDLLSSEWNRPYTRETAAYPLPYLVEKKFWPSVTRVDDAYGDQN
FT                   LFCTCGPVEDSE"
FT   CDS_pept        join(complement(322317..322534),complement(322025..322199),
FT                   complement(321894..321963),complement(321788..321835),
FT                   complement(321596..321741),complement(321332..321549),
FT                   complement(320814..321275),complement(320635..320758))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157494" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902830"
FT                   /orf_name="An14g01160"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46455.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328832"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC779"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L4"
FT                   /transl_table=1
FT                   /translation="MSSTDIEKPPSVERIEDIDKPEIHDVDYDEEFTPAEQRKIIHRVD
FT                   RRLVTMAGLAYCISLMDRTNLSMAAVAGSTLSVLLDVTADKGQSVVILVFFIPYVVFQP
FT                   PMTVIIRKVGPTLFLGTLVISWGAILVGMGFVKNWKQMVAIRVLLGALEAGYFPGCVYL
FT                   LSSWYARYDIQKRYSVFYLIGCVASALAGVLAFGLMQMGGIQGISGWRWIFIMEGVITG
FT                   AIGLLTFVFMVDFPEKAHKSWKFLNERESAFIVRRINRDRADGNEEPFTFKRFFSPAFD
FT                   LKIWGFALICLCSTTVAYAIAYFLPIILQEGMGFSTGASQCLVAPPYGFAGIVMYTTAW
FT                   ISDRYRMRGPIVAFNAVVGIIGLPLMGFAKGNAARYVGVFLVVAGANSNIPAVMAYQAN
FT                   NIRGQWTRAFCSATLIGVGAIGGIISSLVFQSKDAPEYRPGIWTTIACNLVTMITVAAL
FT                   SVWFRYANKQADRGERVIEGSSDFRYTI"
FT   CDS_pept        join(complement(324916..325741),complement(324387..324826))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660427"
FT                   /orf_name="An14g01170"
FT                   /product="Similarity to hypothetical protein B7F18.110 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK46456.1"
FT                   /db_xref="UniParc:UPI0000EFC7A1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L5"
FT                   /transl_table=1
FT                   /translation="MPAKRSTTQAKPFRYVDECQTRSSASLGDLKLGRIRVDCCFLISK
FT                   TQWGKLRGQDAGLMYLDLTFHQPTDCKLSQATITMNFHEAEHRRRRINTGLEVTEFFGP
FT                   KILTGEKRERQVSKSFEATPKVGTANASVEGIGISRKTQASYASRWKFTGSRFTDDSDD
FT                   ESYTPNNRYRQLVWHLEENELERQAVHHSIVHTALTFHHDSSPFYLDLQIEVKMQRWHH
FT                   RVRQRLVCPPRNKKALTRAKIKPVVSATDDPYFSKLVRNIDQVMVEENLHPVADDTLGK
FT                   DPDTEFSEICLPNEALLELARQLTGNKSPSTLAPPRSSSAASTQTVNSSDSTLVESETI
FT                   SQSDEQAEIKCTSSEAGNPITVDPPKEIIKTTTIPEHASRVALSGARHTSQVLAALIAW
FT                   LILGLNGLHAGLTRAGRGLEKS"
FT   CDS_pept        join(326029..326718,326780..328516,328585..328923)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201447" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660428"
FT                   /orf_name="An14g01180"
FT                   /product="Similarity corresponds to a distinct region "
FT                   /protein_id="CAK46457.1"
FT                   /db_xref="UniParc:UPI0000EFC7A2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L6"
FT                   /transl_table=1
FT                   /translation="MTLNITIGSDRASDEEDSSESGVEIAPPSITGSHASHDSHAEWAD
FT                   VPLPDELKPGKKAYKPPPRVQSRYWAAAPSPFRVSKQDDWLISSGDNDKDITAHLNLDV
FT                   ALDLEHELGYLARLNRLGHFKKGIRYFERRLAPYVDFFPVVAEYADLLLEQGNFGNLHQ
FT                   FISSRLKDHLVEYSKEEYILLKILKAFAEIYTKGAIVPALNMAKETLSHLSVRKHVSKV
FT                   PSLSTGVKIQLLEMCVRIITNAAAYSNLLETESFNPLLYWSASSNGTVKLDDKGDSGEI
FT                   HARGYRTPRQSPPRIGSWYRFLLQEGFSWDAHRILRSILPMLGSPDGHYIFNGRFEEFF
FT                   ELKNISEAEKVLLQPAEMSFQDEQVLLAEFANACLLADFLSAERFSEIVQVAGCQFLQR
FT                   SRSLASAILLEYPHLISTRPYLDWLLSESIRILPFSRHVQPLVKNTRLVPDSWTWKSFD
FT                   NMQFLHQRKLSMTRGTELPKTPNDPPSFQSLESISECVRGLGDYRLERSVLHQMFWHSL
FT                   DWDQSLQALRDLTRLNRDLMSDTCGYLQSLIDECIALDYSNAPDCERLREDLYSRFSAF
FT                   DHSFPFRFDYDTAVHESSAIVFFDNALLKYIERNMLFDFLVETGRGTEAELVGMKLSRT
FT                   GHYLPGEIRSSLISTGRYFGRTDSLAAKQIPKSAEIKGHIPDSTLAGYRVPDLVPGPSD
FT                   VRRDGPGGIPRAILQVPYRSDAAADDTALSLERLIRQGRDAERAKQTGDLVEREKKAMK
FT                   QERVRFTQEVARFRRHFQIEEEKKRVAQTDSTSLVTLKDPVGRAFLFPFNQCRPFAAMK
FT                   GLMQQVFRSDNILAPHIAKGNYRFTSLDGNPITRDSWDSDIQPGGTIMVHITSDLGQDL
FT                   SQEPEKANTEHDQPVEGERLTAQLESVNIVDPEDKQDQGPRVDDVSDSST"
FT   CDS_pept        329777..330667
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234969" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902831"
FT                   /orf_name="An14g01190"
FT                   /product="Catalytic activity: L-arginine + H(2)O  "
FT                   /EC_number="3.5.3.1"
FT                   /function="arginase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="CAK46458.1"
FT                   /db_xref="GO:0004053"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="UniParc:UPI0000EFC7A3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L7"
FT                   /transl_table=1
FT                   /translation="MPANAITIIFSPYHVGIRDHRVGNGPHRIRQHGIIQALEDLGVKV
FT                   NFIELDRVDEFEGEIGRSFELLRRTSTAVTQAVKNNTFPIILSGNCMASAAVACGLNTD
FT                   DLKFIYFDAHDDLDSPDVNENGYLDAMGLSMLRGESWKTLTRTVPGYKPFTYDGNFLYC
FT                   GLRDQSDVQRQRVFDAGMVAIWGETERKVDFVGELSKQLEAKSYDPALVHLDLDVLDES
FT                   YGKVNDYPSPGGLFESELLGCMDLVPRRSTPRSLTVCSFDPDAGDGDRIAVIAVRAVTS
FT                   FVQSLLDTGALINDA"
FT   CDS_pept        join(complement(333440..333511),complement(333270..333352),
FT                   complement(332512..333215),complement(332310..332442),
FT                   complement(332053..332262),complement(331827..331982),
FT                   complement(331594..331771),complement(331024..331527))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966401"
FT                   /orf_name="An14g01200"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46459.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFC7A4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L8"
FT                   /transl_table=1
FT                   /translation="MSQVQSYRKRVSVACDVCRRKRIKCNGAKPSCAGCLGQAEKCEYQ
FT                   YDKEKRKPPTKQHIQALQARIEFLESQLAQYEHKEGKTLTTTTHQMLDRDETFGSRELS
FT                   GTQPRSLDPIDDITDLLGGLSIGEGDQLRYFGSRSNLSFVERQGTKHTTFRQNSHQPLQ
FT                   RIDMDPQIQEELLDIYWKWQNPWQYLVYQKVFLRGLENQIDDGYCTPLLLHSMMALAAR
FT                   YSDNPEVRTVPNDPSTAGDCFSHKARALLFEEIKAPRVSTVVAAAHISLYEMAKDNEPA
FT                   GWIYLGIAIRMAYNLGLHIDPHLWVSSGFMASEEAELRSIAWWGCYMIEKLFTVGIGRP
FT                   SIIHERDIQVNFPSNLADVEYGQWNGDSMPSIDRSPLSYSITTLHNTCRLLRLATRPLD
FT                   DIYTPEQFVTSAEKKSIMTKTNIALTSFYNNLPSVLRLPPTSSRPLPPHMYCFHMHFYT
FT                   LVILLHRPFINIPSNARPPQRSMNGAVSTSLETCTKAAEKVTVLFRAYAKFFTLRKISI
FT                   SVVDTARTAAFIHLFNSTAKDHQIRDKSRQLFLETLQYLEQMSIAWGWAKRSVRALSMI
FT                   ARKWRVHDILNNRDSSSVEPSLAHQHERQDRDSELAGDFDAWLQDPFDLQSAVQVIDNN
FT                   NSSLGEGFNLEQELFHLQDFLSVGDDAYSSSSFLNTDWEHELGL"
FT   CDS_pept        join(complement(335582..336389),complement(335286..335529),
FT                   complement(334964..335228))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902832"
FT                   /orf_name="An14g01210"
FT                   /EC_number="1.5.3.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46460.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI0000EFC7A5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L9"
FT                   /transl_table=1
FT                   /translation="MAPNNTSYLIVGAGVFGVSTAYHLIQKYPNATVTLVDRDAYDAES
FT                   RVAASWDWNKVVRADYDDMTYCKLALEAQEIFKSDPLWQPYFHQTGVYWTCRSDYAQNV
FT                   ITNHKKLGRNDDIIALPVAEARKLYNGIFDNADYTGVKEVLINRASGWAAAGDALRAVT
FT                   KKCLDLGVKYVKADIATLEFDGRGSCIGVRTRDGDVLSASRVVIAAGAFTPTLLEWSAA
FT                   KSGNGGLRAGDRILAAGITTGMAQLDKEQYERFKDMPVGFQGYTPEEGKPFIGTIPPTK
FT                   DGELKWWGSKIFTNTREVLPGRHISSPPPTDDYNQWKVPGPLKQDIVESRNLWYGPKSA
FT                   EWKMTKHRICWDAFTTSADFIISPHPASKGLYVATCGSFHGYKFFPVLGKYILQMIEGE
FT                   LEPELVEKWAWDRQRPDSSQNVEYPNAEMKHLLEPPAKL"
FT   mat_peptide     join(complement(335582..336326),complement(335286..335529),
FT                   complement(334967..335228))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L9 "
FT   sig_peptide     complement(336327..336389)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2L9 "
FT   gap             337379..337478
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(338008..338321),complement(337593..337957),
FT                   complement(<337479..337574))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902833"
FT                   /orf_name="An14g01225"
FT                   /product="Function: SRPK2 phosphorylates the SR family of
FT                   splicing factors in human."
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK41903.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000EFC7A6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M0"
FT                   /transl_table=1
FT                   /translation="MVKLRCNLRNLFPCFSHMSQAGISRLPYFSLRTVTSQGLPLRQFP
FT                   TSGYVTLDPADKIEEETLPLYKPENYYPVSIGEVFGSRYQVVSKLGYGTSSTIWLSRDL
FT                   QEGGYYTLKLCAKGQSSDREITISAHLKQSVNEIGKRMLRIVLDSFDVVGPQGSVFICL
FT                   IYQPLGMSFTEFQNLLPTGKFPKELIQRSIQLVLIALSSMHESNVVHTGMAIKLGEKSN
FT                   GWNQYLSPNNILQGVQDISILSKMEEDEIERPIARK"
FT   CDS_pept        join(complement(340420..340615),complement(339430..340379))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000244351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117443"
FT                   /orf_name="An14g01235"
FT                   /product="Similarity to essential gene #5905 from patent
FT                   WO200277183-A2 - Bacteroides fragilis "
FT                   /function="catalytic activity"
FT                   /protein_id="CAK41904.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG694081"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI0000EFC7A7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M1"
FT                   /transl_table=1
FT                   /translation="MPPMSLILASIILILTLFLFQPSLCGIMVEHVLDWLRDKAVGWSH
FT                   TPPVNKIDTHHHIVPPFYAKANPTTAVEQQGGDPSGWPTPSWNPIASKLLMKRVGVKTA
FT                   VLSVTAPGACIAPDRQSRSQLARQMNEYAADLRDKDPDHFAFFVSLPNILDTEDALAEI
FT                   AYGLDTLHADGVTLFTRYGPSNTYLGHRDVEPIWAELNRRGCVVFIHPTHPVDIRPVNP
FT                   KLPQPAIDYPHETTRTAMDMITSGTTLKYPNCKVILSHAGGALPYLISRVTTPMKRAPD
FT                   VAVSYRIGTTHDKAMEAFRSFYFDLALSSSPQVLDMLLKMVPHDHILYGSDFPYAPITA
FT                   YPAFLEELETYDMDQELRDMINFKNALRLFPRLANRTGPAI"
FT   mat_peptide     join(complement(340420..340540),complement(339433..340379))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M1 "
FT   sig_peptide     complement(340541..340615)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M1 "
FT   CDS_pept        join(340885..341133,341184..342386)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234971" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902834"
FT                   /orf_name="An14g01245"
FT                   /EC_number="1.14.14.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41905.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000EFC7A8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M2"
FT                   /transl_table=1
FT                   /translation="MSKSVHAQISGIAREYPFSATLVTIAAFLATIFLVIREIFTPVGK
FT                   RRPPPGKRCKLPPGPRGIPIFGSLLDVRKVRDDQDHIINNDLAKYGEMTTLHLGSKTWI
FT                   LLNSKRVVSEIIAKRGTLTNGRSPMPIASGIVSRNGRSLLLPPSGWTEKRRVMHSLLSG
FT                   TALKQYASWQELESTQLLAEYLFQPERWYRHHYRYANSVVHRIALGERLVKSGKELEDL
FT                   QNVVTYFVGSIGSSLIDWFPELDRLPRALQPWRKHWEKLGNWNEEVYKSWWIPVRDKVE
FT                   QGTAPPSWVRDVLLHPDTKFTGDDQEAMYVAMQLLEAGSDTTREVLNIFVMAALCYPRV
FT                   FQKAREEVDRLCCTEGGLRLPGIEDLEHMPYICALIKELLRWRPIFVLTPDHVLTSDME
FT                   FEGYHFPAGVGFVINEVPVCNECEDPEEFKPERWLDGHETDAAHGLWQFGGGRRICVGY
FT                   RLAFRGLFINVARLVLCYNYAAVSG"
FT   CDS_pept        join(complement(343550..343886),complement(343380..343490),
FT                   complement(343239..343330),complement(342626..343180))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902835"
FT                   /orf_name="An14g01253"
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK41906.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI0000EFC7A9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M3"
FT                   /transl_table=1
FT                   /translation="MTRNLAKVRFLLTLVLCVLPRAAIRISAAIFRAFWKGLPLGSSMW
FT                   NGFAGALITNTPPDQLQAVLPSTLKTYESWVLSRGVSRAVDVLAADNSTRLLWIGPSIS
FT                   AKVLLFFHGGGYVLPLSEAHLDWMAYLRNEAANAGVDMSVCILEYDLIPTNPYPRQLKQ
FT                   AIFAIQRLLVSGYRPSDIVFGGDSAGGHLSLSLMAHLHRHYQSNEVKKNLIHLQSPVKG
FT                   CFLVSPLSSFDFSTPSYQRWFSADILTRKVVDEWGRYLVNNSPWHEEISAGYGWGMALD
FT                   VPDSWWDGFTAVDSILVTGGYEEVFSDHIQLLGETLKTKCKGNVALHMSNETHDGPLMD
FT                   FEARRPPSETTRAIRDFIIACFKD"
FT   mat_peptide     join(complement(343550..343802),complement(343380..343490),
FT                   complement(343239..343330),complement(342629..343180))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M3 "
FT   sig_peptide     complement(343803..343886)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M3 "
FT   CDS_pept        join(344332..344531,344608..345726,345783..346175,
FT                   346235..346483,346640..346964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217705" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902836"
FT                   /orf_name="An14g01255"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK41907.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329526"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFC7AA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M4"
FT                   /transl_table=1
FT                   /translation="MPPKVTGDPKRRTGARRKVVLACDSCREKKIRCDGNKPICGACRR
FT                   RSYRIDQCLYNPDNARTASRDEYFQTLHLRIRELENACLMAGVSIDSPLGLRAQQESHS
FT                   ELNRGNEIPVETEGLIMAAPTPFGELEERTTTSTGFRVGGRPDQPVLATRSESANSRSR
FT                   LAVEETTECSPDVGSYGSPLFADGEAHVTGMGQITAPDAESRKQSSRFQFYGSSSTASL
FT                   MRFAWQSLPSRPANSSGAELASSTLHDTFTEYRFDDFALLPRTLADHLVRCFFDHVYTL
FT                   YPFFHRPAFEAAYRNLWRAEDEPKIPLTDLRIGLGSGAESSPKSIVFHAALNAIFALGC
FT                   QFVDIEEVESVANSFFLRCKRFIGLDFLDINTLGVVQTLLITALFLQSSPYPSRCWHSV
FT                   VVACRVALGLGLHESDILTSLSPLESDIRRRTWHGCVMMDVTLSMTHGRPTMTTHLAPL
FT                   PPPDDSEMPRQDPPGEPSLLSFYIEAIKLYSILDKILSDVYCAWCSRTRQDRPQASTKI
FT                   LGGLDTILEIERELTLFEASTPPCLKWDPDAPEFNSDGKLNQAIAQQRNVLHARYLHLH
FT                   LLLHRPMFTQLYAEKVRKSDFVGGNGIREEWTAHSSATRSTLYFSTANKSATACVMAAI
FT                   DLTHLVHETYHTNATDAWCPSCRREATSVLESMATVKRSANNTLQFLKALYRQAVPADM
FT                   QQTGSQTAGAASLHPDNMTQHYTPFDHPDHDLTQAPFFNWEEYAGSMGQGFDDLGFLTR
FT                   LDFPDTLP"
FT   CDS_pept        join(347623..347794,347850..348251,348310..348644,
FT                   348728..349068,349162..349309,349364..349468,3
FT                   49640..349720)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660429"
FT                   /orf_name="An14g01260"
FT                   /EC_number="1.-.-.-"
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41908.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326751"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI0000EFC7AB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M5"
FT                   /transl_table=1
FT                   /translation="MTAKTDIPSYSQVACVGTGLSAVALGATLKRWYDLEDIRFFERHP
FT                   TSGGTWYINTYPGCGCDVPSALYSFSFALNPNWTKLMPSNTEIKEYVDNVVDTYNLRRA
FT                   MTFGTEVVRSVWREDANRWILYLRELETGHQYTHECQILFAATGQLVEPRPCDIPGASD
FT                   FGGSIFHSARWDHSVDLEGKNVVVIGNGCTAAQIVPALVNEGKIKSLTQIVRTKHWIFP
FT                   APNFSYPRLLQWIFRYVPLAMKLHRFHIFVIAENDFRLFPMTKGAARLREKRRMKVEKY
FT                   MREAGPKKYHDLLIPDFDVGCKRRIFDPGYLESLHSDKVLLTDAKIGRITAQGLETDKG
FT                   FIPADVIVLATGFRTNKFIPYMDVVGRNGESVSQHWTKYDGPAAYNCSVLSGFPNFFML
FT                   LGPNAATGHTSAMMAAENSINYALRILKPVLNGDASSVELKPKAEHDYVYWVQDALNKR
FT                   VWNAGCVSWYLNDKKWNSMSYPWTQGHYWWMSLFPTWSDWNIKLAYAGNLSSELVKRYL
FT                   ASVQSSMLTK"
FT   CDS_pept        join(350571..350943,351017..351121,351184..351422,
FT                   351500..351727,351787..351900)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966402"
FT                   /orf_name="An14g01270"
FT                   /product="Catalytic activity:"
FT                   /EC_number="1.1.1.100"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] reductase
FT                   activity"
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41909.1"
FT                   /db_xref="GO:0004316"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000EFC7AC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M6"
FT                   /transl_table=1
FT                   /translation="MAKPGFLPREGLYIDPIIVGLRKTIFRPLTTVLGLYLATKFSFLA
FT                   PYEQLIRITATASVLLWLNEWLTSKCLNNWVTDHTWDWKKELVVVTGGSGGIGAGVAQR
FT                   LAALGSRVVVLDIIPLTYKPENDRILYHKCDLSDEKEIASVCEKIKADIGDPSVLVNNA
FT                   GLSRGRTVAEGTYSDNSITLKTNLLAPFLLSKEFLLAMIRRNHGHIFNVASVSAYIPPP
FT                   GLADYAASKAGLIAFHECLAQELRAQNAPKVRTSLAVLSFTKTPLFKGETNQSRFLMPL
FT                   LHVDTVVDAIVDILDSGLSQTVYIPGIFRYFAGLRGAPDWFQQLIQSGTKSLRVDFKGR
FT                   QKIDPQTGRLVQ"
FT   CDS_pept        complement(352896..353804)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902837"
FT                   /orf_name="An14g01280"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41910.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC7AD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M7"
FT                   /transl_table=1
FT                   /translation="MNISAQDPSLRETNWPAVASYVAARKDTYPFIDPAKADLTGKSVL
FT                   ITGASKGIGKATAISFAIAGCSKILLAARSDLADVETAVHDAAIKANRPQPLVHSLKVD
FT                   VTSEDSVRAAAETAADMLGGSLDVLMNNAGYLEEWKPIAESEPSEWWRTWEVNIKGTYL
FT                   AAHFFLPLLLKSQTKTIINISSGGAHVMFPGASAYQTTKFALCRLTEFMDNEYYQQGLI
FT                   AISLHPGAVKTELAMNMPPERQVVLTDTPELAADTLVWLARERRDWLAGRFASVSWDME
FT                   ELEQKKQDILQRNLFKFRVVI"
FT   rRNA            355222..355334
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="An14e01290"
FT   CDS_pept        join(complement(356064..356162),complement(355698..355928))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902838"
FT                   /orf_name="An14g01300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41911.1"
FT                   /db_xref="UniParc:UPI0000EFC7AE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M8"
FT                   /transl_table=1
FT                   /translation="MLQVVMVSTDLQGHHDQLGAAAVALDYISDSQQHVRSTGNQGSGQ
FT                   QIDAISSFIRLCKSTCRNFMTCRGKNSRPPNFTISSLHTLTYTTLEGNRYDIIRLYLRL
FT                   IILVS"
FT   CDS_pept        join(356452..356556,356646..356740,357002..357153,
FT                   357332..357481,357573..357693,357796..357937)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902839"
FT                   /orf_name="An14g01310"
FT                   /product="Similarity to hypothetical protein PA3829 -
FT                   Pseudomonas aeruginosa"
FT                   /protein_id="CAK41912.1"
FT                   /db_xref="UniParc:UPI0000EFC7AF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2M9"
FT                   /transl_table=1
FT                   /translation="MRALESRRMKSRSHFVSRQIPLLQIAKVLYDESAEAAKRIPLSKD
FT                   FVLSVAVPIATTALHDILPDWRFQTVIMCSEKVELKILDSVTLRGNLYPAMTRGSAIIL
FT                   GVGVSLHKWTHLTEDYSDALTFLSTYNAVDPNQIGFWGMSFNEPMVLAAAALDPRARFL
FT                   LLVVPEEGSHVFGVPDSEGRKTYKLIQGTMPTAFRYRNHVTFVKWELKGPKKLHLANGP
FT                   DTNKRQKLQVDSIRGAVSGKSVRYYSIRHTDV"
FT   rRNA            complement(358852..358970)
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="An14e01320"
FT   CDS_pept        join(complement(361770..361975),complement(361477..361715),
FT                   complement(361284..361424),complement(360984..361225),
FT                   complement(360193..360921))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902840"
FT                   /orf_name="An14g01330"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An02g11890 - Aspergillus niger"
FT                   /protein_id="CAK41913.1"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EFC7D8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N0"
FT                   /transl_table=1
FT                   /translation="MPSSLASVIALTFFIPFAVSVQFNKFNVTREISISPAANPRPGKQ
FT                   TVDAAYQSFSIEFSFMSDYAGNDTHPNLFSRRVIQNLYDISGAYPIFRVGGSTQSSAIY
FT                   YPNQTEAIIDPFSSVASDQPSHTFVGPSWFQSFRQFPNGTQYIYGLNFFNTVNETYNNI
FT                   GNGLDQCVLEANAAYKTMEKSLYAFEIGNEVDGWGNGKHREGNWTVQRYVNQWNEFATA
FT                   ISRNLTGKNAARLFQGCAFEAPRHINERTDCWNIENAELDGMHPDKTKTVSDHEYMGAN
FT                   CHYTGAGPTIEDTLFDRTNMLSRVWYHDYLGNATAESGIKYVIGETNSISCQGAFNISD
FT                   VMASAVWAVDYVMYLSSLKVSRVHFHMGTRYRYSPWQPIVYNDSAPHVNPMYYGNLFNA
FT                   AVFAGGNKQTEVLVNETNFGAYAVYKSGSLDAIVAVNLNIWNSTLDPVARPYTALALPE
FT                   IWKDAKVSRLTSPGVDIAGNITFAGQYVNENASIVGQKIYDKVTGGKVLVGAGEAILVQ
FT                   R"
FT   mat_peptide     join(complement(361770..361915),complement(361477..361715),
FT                   complement(361284..361424),complement(360984..361225),
FT                   complement(360196..360921))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N0 "
FT   sig_peptide     complement(361916..361975)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N0 "
FT   CDS_pept        join(complement(363943..364145),complement(363644..363883),
FT                   complement(362743..363593),complement(362518..362558))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813231"
FT                   /orf_name="An14g01340"
FT                   /product="Catalytic activity: 2-carboxy-2 "
FT                   /EC_number="5.5.1.2"
FT                   /function="3-carboxy-cis,cis-muconate cycloisomerase
FT                   activity"
FT                   /protein_id="CAK41914.1"
FT                   /db_xref="GO:0047472"
FT                   /db_xref="HOGENOM:HBG499008"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR003031"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI0000EFC7D9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N1"
FT                   /transl_table=1
FT                   /translation="MLNSAVDSRIFRNLFGTEEIRDIFSDEAYIKCLIEVEIALARAEA
FT                   TFNVIPQESADVIAEKAKYENLNLSRMAADTENVGYPVLPLVWQLAEMVPQEHAKYIHW
FT                   GATTQDIMDCASMVQIRRGLVVVRRNLHELDTALRALSEKYADTPMAGRTHLQHALPIT
FT                   FGYKCAVYLSGIQRHIQRLAEIELRCLLVQFGGAAGTLASLGSDNTGLQVRKQLARELG
FT                   LHDPSITWHVARDHVAEVVNFLALVGGSLGKIALDIIIMSSNEVAEVAEPFVPFRGASS
FT                   TMPQKRNPISSEVILASSKLLRSNASLALDAMVSDFERASGPWHLEWSCIPDSFVLCCG
FT                   ALHQANFIMRGLLVNTDVMSSNLNMTKGLIVAEAVMMGTAPKIGRQRAHDVVYEACTKA
FT                   IEGNLPLIDILRQDESLVAQVGEEKLRSLCDPWVRSGVKDVTDYG"
FT   CDS_pept        join(364569..365430,365488..365878,365939..366224)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660430"
FT                   /orf_name="An14g01350"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK41915.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC7DA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N2"
FT                   /transl_table=1
FT                   /translation="MALHGRALSLAQLILVVCPAFFLFGYNQAGVGGLVSVESWTKTFS
FT                   EIDTIHTVGAVKSHNLTVQGVVISTFTLGALIGALSCSFIGDILGRRRVIFAGSLATLV
FT                   GEVLCCSSFGLAQLIVGRLIIGVGIGMLSGTVPVWQSECSSAQSRGKHVVLDGVFISAG
FT                   YAITSWVNLGFYQIKSGSVAWRVPLAIPGLVSLIPMFSIFFLPESPRWLVQKGRLEQAR
FT                   ATLVSLSGASAASEDVSGDIAAIQLTLENHSRGLSIMDIWRPNDEKLLYRFSLCILLQF
FT                   YQQMSGGNLISVYAPIIFEENLQMSSMMSRILAAATLSWKFLSCFVAFYCIDRYGRRMV
FT                   FIVSGTGMSLCMLALAITTSFPHANKPASVMSALFIFLFNFFIPIGFLGANFLYCTEVA
FT                   PLRLRVAMASISTANHWLWNFVVTMITPVAINNIGYQYYIVYAVMGACIPISVYFLYPE
FT                   TMGWKLEDLDMLFKRGLSIRGTVRSSFRSPDCDAEGRISLEKGEIAKVEHHEGV"
FT   sig_peptide     364569..364655
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N2 "
FT   mat_peptide     join(364656..365430,365488..365878,365939..366221)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N2 "
FT   CDS_pept        join(367206..367262,367501..368129,368183..369182)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660431"
FT                   /orf_name="An14g01360"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK41916.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFC7DB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N3"
FT                   /transl_table=1
FT                   /translation="MSSEHKMRIYSARSSNYVLSLFNHEEGFPDVVNRLHLLGPGPEYS
FT                   QTRHLSKSSNISRPPHFLLENTRAFYLRGVTDFSKFWSSIWPIFMEKQFLSAFHRVFDL
FT                   VETHDPNLSPSDYVILRQIFLVLSITAWQNRSPTECNSYYLNALECSRLTTASENEGLA
FT                   GLQSLLLTCLYLQLTRKHEEWIQTAGQAVRLAQSLGLHRHSRRFRFCAGEMELRKRMWW
FT                   CVYAVDVACSVVHGLPKLIQDDDVDTDLPIDTDLDDVTASDIPLPLPGETTSMATFILY
FT                   VKLLRLFSSCLKSLYTTTKRRNGVAKITALDHELSVWHHSVVRFQGSGMKENDDALPDT
FT                   LHINSSGQSFETLFLHFLGNVAVVLIHQPALTFDPKHPQFMKSLSRCVRAALNILGLLE
FT                   SSHDGQRLHCLFPNKSSIVFQSTLLCFYHQWMCISFSLTPSHNLNPLMGRIVDTALKLL
FT                   DKHKAELVAPDTGPNTCIDIETISAAEDLVRLFSRRLDNARHASVSIEGTPSMAQNSLP
FT                   TSTFPPQADLGGHEPANFESESPMATIPLDFGIWDHDILDFDWP"
FT   CDS_pept        370756..371232
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902841"
FT                   /orf_name="An14g01370"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41917.1"
FT                   /db_xref="UniParc:UPI0000EFC7DC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N4"
FT                   /transl_table=1
FT                   /translation="MLLNPFRPCEGSPTFQEEYRSSNYVPEVIETAWGRQIVAPDTPYV
FT                   AAAGPSQLYFLDTRLDPEMAQHIKQQIEKASVPQLDEYIAIDEIEATAEVKNSVTGETT
FT                   FVFDPAYARILFARGMNRHNPDLKLPEPEPAGDWLVTYDLDNILAAKGRSVAKG"
FT   CDS_pept        join(complement(372987..373189),complement(372692..372806),
FT                   complement(371636..372625))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902842"
FT                   /orf_name="An14g01380"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK41918.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG327388"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI0000EFC7DD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N5"
FT                   /transl_table=1
FT                   /translation="MDVIEYAAPSVQHIHLHWSGNQTVLYGWASSENGMPLLCKNPTSL
FT                   LSKITLHAYQLRLSSLKGIMGNREQMEKPRSDAWIEAMERFRGSLIRMHDKSMLSNTKR
FT                   VKVALIDDGIDLQDFNTYRFAQCTGVSYCSSDISNGDPWWKSTNGHGTIMANMISRINP
FT                   WVQLEVIKVQSSPSYVHGDGARSMSPRSAADAINAAVVRGADIISMSWTITDVGFRMSV
FT                   LSDSASNVDGDKRRADENDLKLLQSAIDDAVKGDKRLLICSAADDVRLNGDNTFPYSQA
FT                   PELILRMGSTGPQANRDLGSGSGGSITYYLPGNQVAEDRRPHSAKPVVYHNGSSVSTAL
FT                   AAGLASLIMYCCHCLHSCQAGAEYENCAKALRSHANMRKAFNSINRYFEWKDDEKIVPV
FT                   WGPFGDKSSMLDKATNSEDKIKVLKELVACLCLDIK"
FT   CDS_pept        complement(373627..375681)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813232"
FT                   /orf_name="An14g01390"
FT                   /product="Similarity to hypothetical protein AAO75370.1 -
FT                   Bacteroides thetaiotaomicron"
FT                   /protein_id="CAK41919.1"
FT                   /db_xref="HOGENOM:HBG327389"
FT                   /db_xref="UniParc:UPI0000EFC7DE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N6"
FT                   /transl_table=1
FT                   /translation="MWLLLYFLAVIPICVITEASNHSYDFSSGYALLYSNSSAIVQFID
FT                   GANPEREFLLNKTTATFHTRSHAWGAGTISTDSGEGSWNLDYIPYNNFSGPYNIPLNDG
FT                   LRLKITRSPGQVLTETYTFENTSPERIAVTGIYIQTPFNDLYDTALWSLTSAVNAHIFT
FT                   GGAWAWALAEPMSGEGRSLGLIVRKGHLWSYSLETSSSSDVRGHIVLQVTDAKRDSQGF
FT                   GGQPVVYIDPGDSYVLEWEIGFYDDASDFIEATNPPATFSAYSAPLGQAITLDSKIEPT
FT                   SSSSSLKIKKSGDGYTLSASSPGTYNVDIGDSRTEVSFHLPLETVVRERAHYMLEHQRP
FT                   VERSAPLDAAFVAIDTDNLTTIVSSTWDDWGDGSERIAMPTLLQLAAMHGYISSELVDV
FT                   PLENWIEFASTSLFDAEGNTWRCTGCSQTQRPYDAIWLVMFFNDRYKWLGNSTNIDTAV
FT                   TLLNRAFEVGKVQEAPIIFFSQAILELCQSLDKLGRYNESATYRSKLVDTTMSFVNDGR
FT                   DLPASEVSYEQSIVEPLVEMVADTYNLTRNMTLLSETQERLNWLMAFSGPQPHARLYQI
FT                   ANRHWDDYWFGLRRQWGDVFPHYWSALTSQALIRLPRELRTKQTDQIALQILRSNMVNF
FT                   FSGGSATCAFVFPSAVDDESANVADPMANDQDWHLVIWLRLLEYGIPSV"
FT   mat_peptide     complement(373630..375624)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N6 "
FT   sig_peptide     complement(375625..375681)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N6 "
FT   CDS_pept        join(376070..376206,376305..376384,376592..376709,
FT                   376919..376996,377080..377245)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902843"
FT                   /orf_name="An14g01400"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK41920.1"
FT                   /db_xref="UniParc:UPI0000EFC7DF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N7"
FT                   /transl_table=1
FT                   /translation="MGVLLNCTMGYDPETKGHPSIRPNVVPSEGRRCMPSHDMIRGQPS
FT                   RGGDWLPSLFLDFRIIRAMLTSQLPRPIYKESLITGSSSLKLSIPAQYEIFPQQEVAWL
FT                   ARELNRSRGAVRLEYREAFKSWPRTGPACGSIMDQLFLTVEFLHELNVQSVTVGIRSVA
FT                   HDYTIAVKGPVTYCLLKVRVSGCPMANRV"
FT   CDS_pept        377460..378317
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902844"
FT                   /orf_name="An14g01410"
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK41921.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="UniParc:UPI0000EFC7E0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N8"
FT                   /transl_table=1
FT                   /translation="MPDIRGATLTPSTSKADYLEALKEAVGPGGLRTLPPDSVDSPELQ
FT                   DFRRSLANSTATAPGRYTCSSEKPLPVTIRGINNRATLQGGFGGVIPRWKPDNPPQSIN
FT                   FAAFENGYPRPGLALLAANALRDAANDWNELDLGVKFQWVQDIEKASFVLSYAGNQGDV
FT                   LAEAFFPNEDDLSYLNVYSSAFQPGTVQYLKNIFLHELGHVLGFRHEFAPELEDNKDDF
FT                   TVQFGPRNPLSVMGYEFPPRLQTTDRDSAEAFYKFPGSHLGWKEARAPKEKRGMLRIKD
FT                   CTAR"
FT   CDS_pept        join(379753..379960,380013..380175,380224..381285,
FT                   381339..381648)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902845"
FT                   /orf_name="An14g01420"
FT                   /product="Similarity to hypothetical membrane protein
FT                   YMR221c - Saccharomyces cerevisiae "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK41922.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG326531"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000EFC7E1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2N9"
FT                   /transl_table=1
FT                   /translation="MSLVQHVSAIEGVDREPEPQDDSTIATAVTGEPLTAIHRKISYDI
FT                   LQPPPAPVEVAGTPAYKVSTAKRLAQVIVTILACWFAAGVVFGFAALKPVLVAEGVYRD
FT                   LCTADELREGVEVCSEQDLRLNLFFTIGSITANVSALPVGTILDRYGSRICGFAGCLLL
FT                   ALGSSLMAYSFSQPQFDGYVAGNFFLALGGTFIFVPSFQIANAFPKYAGTIVALVTGAF
FT                   DASAAVYLFYRIVYETTGGSFDPGKFFLGYTIVPGLILVALITLMPSRDYQGTHELEVK
FT                   IEKAEDATRDIHDSDDDIESDTELRRVRSERAERRRNKMRKIAKVLGDEDERKEREQRE
FT                   EDRHAASAVWGALHGQPAHKQMATPWFILITLMTVLQMLRMNYFIATIRAQYAYMLDSD
FT                   ELAVQINSFFDVALPVGGIISTPFVGLLLDHVSVPAVLAIIVVLTTVIGILNSIPVLWT
FT                   GYVTVTLFVLLRPLYYSAMSDYATKVFGFATFGRVYGTIICVSGMVNFAQYGLDALTHG
FT                   PFDGNPIPINSFFAVAGFVVGTALVSFVYVAGRRLRAREQELEEDEERQRLIREESEEE
FT                   DYED"
FT   CDS_pept        join(382473..382719,382780..383217,383273..>383985)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117444"
FT                   /orf_name="An14g01430"
FT                   /product="Remark: C-terminally truncated ORF due to contig
FT                   border."
FT                   /protein_id="CAK41923.1"
FT                   /db_xref="HOGENOM:HBG023629"
FT                   /db_xref="UniParc:UPI0000EFC7E2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2P0"
FT                   /transl_table=1
FT                   /translation="MASISINAPGATGFIYNNANLGTARVCISAETPDFDTETLRAWAD
FT                   EGFDVVYAPYNNGGKEYEARLKSVKEGLGVGDNYAVIAFGDAASYCLDYYLKSTNCSRL
FT                   AALIAYYPTTVPDTRSRFPFSVRVLTHLAGDTVDVVTIPTVIGLQGKKHRSTKQITPGI
FT                   GTGERLQIGWPAFTYESAQPGFAEHDLEEFDRLASDLAFSRTLQVLRKAFGKDLDLENR
FT                   WEEQLEARFFSMNLTGTMEPYVGHLNPTLTCTPTMSGGIGTHALRRFYEQNFLRKLPPS
FT                   MRLRLISRTVGADRIVDELYATFEHTQEIPWMLPGVPPTNRHVEIVLVSIVSLRGGRLY
FT                   SEHMYWDQASVLVQVGLLDPKYIPEGAPQGVDRLPVIGREAARRIVEEDPEAEGRDYHN
FT                   RLIRRAKAKRGKDKPVEESGTELAKSDTEKVESKPAGESKGKTVQREQNGNGADALENH
FT                   GMEENEKD"
FT   gap             383986..384085
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(385478..385879),complement(384952..385424),
FT                   complement(384481..384892),complement(384304..384417))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902846"
FT                   /orf_name="An14g01440"
FT                   /EC_number="1.2.1.24"
FT                   /function="succinate-semialdehyde dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41924.1"
FT                   /db_xref="GO:0004777"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000EFC7E3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2P1"
FT                   /transl_table=1
FT                   /translation="MSNAIRTLSPSTNKVIFEHPGLSLEEARQIAQASQDAFRTYKQTT
FT                   LAQRKEIVLKALDLIAANKDTLAEELTTQMGRPIAFSAKEIETFRKRGDHILSIAEESL
FT                   KSLPGTPENGFRRFLKKEPVGPTLIITAWNFPYLVTINALVPALLAGNTVLLRPSPQTP
FT                   IFGERLLTYFTQAGLPPNVLQLVHVGSPDVLDQIVQLPQIQLISFTGSTAGGFRIREAV
FT                   ARRIVPVNLELGGNDPAYVRPDADIPYVAAQLVDGAVFNSGQSCCAVERVYVHADVHDK
FT                   FVEEVQKELATYKLGSPHDKSTTTGPVISQAALKNIQSHIDDALSKGAVNATPKNPTFE
FT                   NTPAEGNYQVPTVLTNVTHDMVVMREETFGPVMPIMKVSSDEEAVALMNDSDFGLTASV
FT                   WTKDIAKGEDLIEQLDAGTVYINRCDYPSPDLAWIGWKNSGLGCTLGPEGFNAFYKLKS
FT                   FHIKEQQA"
FT   CDS_pept        join(complement(386780..387005),complement(386496..386722),
FT                   complement(386128..386418))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000238441" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813233"
FT                   /orf_name="An14g01450"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK41925.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG593654"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI0000EFC7E4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2P2"
FT                   /transl_table=1
FT                   /translation="MSQSLRIAILECDTPIDPIKAKYGPYGDIFESHLKEGLTRINANV
FT                   SLQLSKINVVQPFAEYPKPEDFDAVLLTGSKHDSYKDESWILTLTRFVQDCYHIYQKPV
FT                   IGICFGHQIIARALGARVGPNVSGWEVAVESVELTSAGKRLLGRDTLAIHMMHRDIVYE
FT                   VPPECVNLGATLICGIQGLYVPKRILCVQGHPEYNEFMVSELLKLRRGMLGEVVYEDGM
FT                   ARVGREHDGLVFCETMCRFALGILE"
FT   CDS_pept        join(387645..388059,388121..388383,388435..388487,
FT                   388538..389222)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000005159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902847"
FT                   /orf_name="An14g01460"
FT                   /product="Catalytic activity: ATP + L-glutamate + NH3 [-]
FT                   ADP + phosphate + L-glutamine."
FT                   /EC_number="6.3.1.2"
FT                   /function="glutamate-ammonia ligase activity"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="CAK41926.1"
FT                   /db_xref="GO:0004356"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="HOGENOM:HBG553755"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniParc:UPI0000EFC7E5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2P3"
FT                   /transl_table=1
FT                   /translation="MATTITAEDLPNLLANDIKVKVAGVDCDGILRGKVMAKEKFLGIA
FT                   QKGFGFSSAVFGWDMQDVLYTTEANIAPADSGYVDFLAVPDLNSFRRIPWEDDIPFFLV
FT                   RFVQNDKPVSADGRSMLRSICDKLAANNCKGMAGVELEFMNFQTPSEDGYGANGSQTRD
FT                   IAAFLDKNAPGALRPLTAGSFSYSATRPVAYKKYFYDIFDTSARFNCGIEGWHTEGGPG
FT                   VYEAALKVCDVSDMADKVSLFKLLAKSIGVEHGITPCFMAKPMQGQPGSSGHIHVSLTD
FT                   LEGKNLFARDTPDPNAPWSDAAGLSDLGRHFLAGVLEALPDIMPLFAPTINSYKRLVEN
FT                   FWAPVNISWGLEDRMASVRIITPPVCKPGATRFEVRIPGADLHPHYALSVILAAGWRGV
FT                   EKKLDIKVPPVNVQKAEKIKAELLPNTLEEALKRFSDKGSVAREILDPEFVDFFTATRE
FT                   HELRVWREAVTDW"
FT   CDS_pept        join(389538..389708,389783..389899,389959..390502,
FT                   390574..390967,391028..391076)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902848"
FT                   /orf_name="An14g01470"
FT                   /product="Similarity to hypothetical protein SPAC1039.06 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK41927.1"
FT                   /db_xref="HOGENOM:HBG324429"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="UniParc:UPI0000EFC7E6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2P4"
FT                   /transl_table=1
FT                   /translation="MDFSLQSHASFIGRPASDLPTPSLILSKPVLEKNINRLQQDVQEL
FT                   GLSFRPHVKTLKTLEITRLMLANGLHRGLIASTLSELRGVLPLAEEGILNEALYGLPIY
FT                   PSALPHLHSMRQSHPNLNILIMVDSPQHIPVIEAFNKSTPNVRPWPVFIKLDVGSRRAG
FT                   VDVYSPDSGPELEELVNVVEESSAVELYGFYCHAGHSYSSKGEEEAGRVLGSEVGGVLR
FT                   AVKLINSEGKGEKKRKIVLSIGSTPTAHVVRQVKQYLTAERSLNSAVDVDVEVHAGNYP
FT                   TNDLQQLSTDLITPADLAVRVLAEVCSVYPRRNEALINAGTVALSKETSAVPGFGRLVD
FT                   KPEWGVVRMSQEHGILGLLNGESEGEGKKVDDVFHVGQKVMLHCQHACITAAQHFVYYV
FT                   VDGEEVVRETGEVNAIGKIIPLTSK"
FT   gap             391207..391306
FT                   /estimated_length="unknown"
FT   CDS_pept        join(391711..391760,391874..392414,392507..392767)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20660432"
FT                   /orf_name="An14g01480"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46461.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC812"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2P5"
FT                   /transl_table=1
FT                   /translation="MVGRLAGKNALVTGAAGGIGLETTILMLREGASVLMTDISGPGLE
FT                   KALNKVNEVVPERSGKVETRVVDVSKEAEVEAAVAHLDAWGGLDVIFNNAGIMHAKDGD
FT                   SEETPEAIWDLTMNINVKGVWYGCKHAVKSLRKHGKKKGSVINTASMVALVGAATPQLA
FT                   YTASKGAVLALTRELAIVHAREGEFAATAALLYLDEANEYSTPLLQDWLGDDKEKRFRR
FT                   EVHFPTGRFGEAIEQAHAVVFLASDESSFVNATDFVVDGGLTKAYVTPEGPATEAPKNL
FT                   GQ"
FT   CDS_pept        join(complement(393700..394512),complement(392827..393654))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217282" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902849"
FT                   /orf_name="An14g01490"
FT                   /product="Remark: UME6 of S. cerevisiae is also called
FT                   CAR80"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46462.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG327393"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EFC813"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2P6"
FT                   /transl_table=1
FT                   /translation="MPPSRRPRTDPIVRVRTGCWACRRRKKKCDEAKPVCGGCVRNKLT
FT                   CQWPTIIPGQPKANNISFMPEDDDQQNRPGGEEGPSRQMSVNRETSSSIESRSTSPSSP
FT                   EEILRESESPEDTSRASSAPCPSISMDLAQIPAIGSSQVLGTSATVSNLLPRSLSMFPG
FT                   HGPDSYELLSHYLATTADCMANGSTPINPFLVQIVPLAFSSDLLLQLVLTQSAAHRAFR
FT                   CHMESDEVAQRHYTSALQLFRKGVTEFIDGKESNPLMLTVGALVMCFTETAKGDMNGTI
FT                   FDHLTAANSLLIRLLSQSDTAVPKDLKDFVIEYYTYTAAVSMISVDARVSTQLFLNFDL
FT                   EQRARQLLQSEYVGNLCGCWLELLLLIPCIFDLGRQWMMHDGRPAMPTADDIAMFSSLQ
FT                   VQIMRWTPYASVSPEVFLAGRIFQQAMLLYLYTALGGFSRAENGMYQGLIETAIAEAMS
FT                   YLDQLSGTARINSGLCWPIAVVGSCLSNAEHQDSLRRRLTVMVNTFGLGNMQRTLLILE
FT                   HMWQMPLDEAGPWNICRAMQRNQIWISFA"
FT   CDS_pept        join(complement(396196..396387),complement(394951..396126))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902850"
FT                   /orf_name="An14g01500"
FT                   /product="Similarity to hypothetical protein SPAC1039.06 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK46463.1"
FT                   /db_xref="HOGENOM:HBG324429"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="UniParc:UPI0000EFC814"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2P7"
FT                   /transl_table=1
FT                   /translation="MDFPTRPPPSQESLQRYYIGKDISSVPKPAVVLDVAIIKRHCASM
FT                   LDAVKALDVGFRAHVKTHKTPQVARLQAGEDKSIPANFVISTLLEGETLLPLFKDLRES
FT                   GRKVNVLYGIPLVPSQVPRLAALARELGEGSISVMIDHPDQVQYLTEFRQLAGHAAAVF
FT                   LKVDSGYHRAGLPPSMLNKGGLIEKVIEGEREGTLVLLGVYSHNSLSYGGDTPEEVMGF
FT                   LMQEITGCREALRKNKDSFALPGGKGRELVVSVGATPQVVVVKKLLEEEGQLNEEARRL
FT                   KNLLHEKDVDGELSIKVELHAGVYPVLDMQQLGTNIHPTGDAEKEVGISVVAEVCSVYN
FT                   DAERSKPEALVAAGSLALGREPCKSYPGWGVVGDWRREKGSSRLIVDRISQEHAIVAWE
FT                   VGDGPAIPLKVGQTVRIYPNHACVTGAMYGWYLVVDSSRDGDGSTIVDVWPRPTGW"
FT   CDS_pept        join(complement(398858..399909),complement(397469..398807))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813234"
FT                   /orf_name="An14g01510"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK46464.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EFC815"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2P8"
FT                   /transl_table=1
FT                   /translation="MEGDIKEVAQQCVNLFTQCLKIPTLMENEWAENRLADMNLWISGT
FT                   GACARGRASLDWRLASRPEARDVIVNLLRLLSTVIEDCTIRSRNQGFSRSYHDEEDLAS
FT                   SEHEKPGRSFSPWSDDSSSDSQSTDRHELRKPSGNLLYESMYNIESMLDQLSRVAVAIR
FT                   RSGRRSRWQKADQLFNATEHQELEGHLVGMLLFQLKGRTQERDPSKLDEVQLRLVHCNL
FT                   KRRNRFLYSQKHAMGLDVGCVRHTPVSKPAGSAQKETPERKPSPKSSGNSPVHANKTII
FT                   TGTSASRLSDGFQLPHLDHAISVTSSAVSSTALNIDYPRPPQLKDDARLFRCPCCCEAL
FT                   PVTMTENIRWRKHIEDDLSPYTCVLAGCDQPYVLYNTKDSWRQHMLKDHSSVTYWTCFV
FT                   CGDGSQFSDRDAFVQHTETFHAATIPPAHIAVLVELSKKTMPSAIRRCSLCNWPDDDGV
FT                   EVEKEALFNHIATEVHSFSLRALPWADSNGRGSDEIIYNSSEKVYDWLIKNDIQVNPSI
FT                   ERPPCEKMLWYDDYFQQNAYFDCSSEVSSSNELDPDGSRQNELDGLRKADEIESRGQKS
FT                   EANAESGLSSSTSNTEEDDGEQTKKLEIPMESRKIKLIEKNSDAQQASSKASATTSRQK
FT                   PVRGFSQLAYFFAEGSEKISARVVLDTTSEDSFMSYRIATQLGVPFQLVLPKVLVPFRN
FT                   DAVNQTSFTTQYQIKVDWHFGQKAKSYTTNFLVLDMDEYDVVIGRRAISRFGFIRRRTH
FT                   LSPTPRIERGMEQEAEQGDLPVKPDSSRSFVEKVRSWFEEKPG"
FT   CDS_pept        400144..401037
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902851"
FT                   /orf_name="An14g01520"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An12g09920 - Aspergillus niger"
FT                   /protein_id="CAK46465.1"
FT                   /db_xref="UniParc:UPI0000EFC816"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2P9"
FT                   /transl_table=1
FT                   /translation="MAQQPTYILSPDFHFKPGTGPIGLGNIISHPLRPHRALTTVDATT
FT                   LEKVYPRVERFTDYDRSIERRDSRDVSMSLWTEFLQTVSGELSGGRGKDVRSNYTMDQL
FT                   QTEYFVTDPPLEEIQARLKAPRVQVVTKAGRIPGFRTPVYMVTGLMIAKGFTASMENTK
FT                   RHNGEINVGGNIPSPGIQVGAGANLAKSTSTEESDTWRAGEDIVFAYQLLKIEVKGWKG
FT                   DRVKYDELRHKAAYLSKDDDDETDDDDDAVEEIIISSADASTLSSDHDQGGMTVTEVGD
FT                   GNSRISCIYSITGSDL"
FT   CDS_pept        join(complement(403590..403811),complement(401712..403532),
FT                   complement(401221..401662),complement(401109..401155))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966403"
FT                   /orf_name="An14g01530"
FT                   /EC_number="3.4.21.-"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK46466.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="UniParc:UPI0000EFC817"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q0"
FT                   /transl_table=1
FT                   /translation="MASEDPIDFAYTAIAQVANIASLLGVESKRPLCGRLGAELFLVAN
FT                   YIDTAGLDQERRLRLRISKLLRDVEAMCNWPKDIPRNGYPLLEAIGRSLPGVTSYEKAR
FT                   KSIRRGLDQLTSCPRDAEVAISHVQKFIERNRKSTRRDESGDLSSRKRFARPERSDLAN
FT                   ELAHRVLREQMCCTCQSNGVRRQMERGHLVCLLLQPPSQSVASNNLAQFDMLFSSKPFW
FT                   DQSQLTHWQDVELLVPNDHTPSKKCVRFLDEDVGNDDQHASKTTAKRRHRTDKGQFCRL
FT                   LDLATGWRLCLSIEDQELYHRFGPHKQVVDHTPGISLAKILSTYYLTARMKLVLAYIIA
FT                   YSVWQYYDTDWMRTRWTSETIQFMRESNSSGDGGRGKLFTWKPYVSVHFNDEDPLCYEQ
FT                   YRIAGMVHVYPRIRALGIMLVEIGLGFPLPKREEQGRPLAAEVNTELLTAINYARDEEH
FT                   WKNFDYPDYKSSICHCLEPGTFDQAPCVESLSASEQKQNLKQRRNILYEKVVFPLENLL
FT                   QGTKWIDNYEKIGPLHVLSQDAAIQEATVPVNSDKGKAPERRRKRTESEKNASNWLLDV
FT                   KEFNRELAQVAPAAGLHGLSRRVRIAILDTGYDDNAPFFFSPDVMERLKGWKDWADGSI
FT                   QPEDCHGHGTHLVSLVLKCAPDADIYVARIAKRPQQLLSASEKVAEAISWASEQWEADL
FT                   ISMSFGFAEEQPCISDAIREALYKRKDSILFFAAASNYGANDREMFPARHESVMSIRAT
FT                   NSNGLFADFNPPKHEDEPVVFGTLGIDVPSAWPNCDGEEYRSGTSIATAIAAGIAGSLL
FT                   GYISSHPPEKPFYDAKTRLFVPDGTGLDRHS"
FT   CDS_pept        complement(404253..405672)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660433"
FT                   /orf_name="An14g01540"
FT                   /product="Putative frameshift"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46467.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC818"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q1"
FT                   /transl_table=1
FT                   /translation="MNPSTEHLTVRDDFELQPPGQADSNESLENATNISTVEDIPPNGG
FT                   YGWVCTFCVFMINVNTWGINSAWGVILDYYLSNSTFPGASHLDYAIIGGLSVSLCLLIG
FT                   PIVTKSNELLGTTITLLTGTALIFTGLFAASYSTQVWHLVLTQGIAFGFGMGFIYLTAT
FT                   SILPKWFSTKRSFSSGIAASGAGLGGLAYNLAAGRAIQTMGVQTTYRILAFCALGSHLV
FT                   SSLLLKDRPRSRAQPRQRTFNHRDLXATFEVLLVIVWGISTDLGYITLLYSLPNYASSI
FT                   GLSPQQGSVAGAILNLGLVLGRPVVGYISDTYGRITISMVMTASCAILCLAIWIPAHSY
FT                   ALLLLFAVLCGMVCGTFWGTVAPVLTDVVGLNRLPSTFGMVCLMLVAPNLVAEAIALSM
FT                   AGGGAGYLSAQVYVACMFVLGAVCLWILRSWKFYELEVKGVREGGEVRNGAGMAGVQGF
FT                   MRWMRPGKLFLRGRV"
FT   CDS_pept        join(complement(407184..407375),complement(406092..407114),
FT                   complement(405999..406034))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966404"
FT                   /orf_name="An14g01550"
FT                   /product="Catalytic activity: acid phosphatases also
FT                   catalyze transphosphorylations."
FT                   /EC_number="3.1.3.2"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="CAK46468.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG736259"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniParc:UPI0000EFC819"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q2"
FT                   /transl_table=1
FT                   /translation="MFTKQSLVTLLGGLSLALAQTTTEEYPSLAEIRAAQATVQPYSPV
FT                   SNVKGTSFNRFVNIWLENTDYDTAAANEHLAELAKKGLLLSNFWAVTHPSEPNYCASAA
FT                   GDTFGMDNDDFHQIPSNVSTIADLFDTKNIAWGEYQEGLPYPGYQGYRYPESGANDYVR
FT                   KHNPLILFDSVTEDALRLRQIKNFSSFYDDLENHRLPQYMFITPNMTNDGHDTNITVSG
FT                   AWTWSFLSELLENDYFTKDTLIMLTFDETGTYEIGNNIYTFLLGGAVPDDLLGTKDDTF
FT                   YTHYSVIASLSANWGLPSLGRWDCGANLFSWLAEKTGYVNYDVDTSNLFMNETHWGPLS
FT                   DDDYSEYYAGWPVPTTDASCSAGKGILSTVKKTYKGLTATFNYTTPFPYDSRSGNNVGV
FT                   KYSRTLKNGKVESGISE"
FT   mat_peptide     join(complement(407184..407318),complement(406092..407114),
FT                   complement(406002..406034))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q2 "
FT   sig_peptide     complement(407319..407375)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q2 "
FT   CDS_pept        join(complement(409562..409714),complement(409364..409504),
FT                   complement(408264..409313))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902852"
FT                   /orf_name="An14g01560"
FT                   /product="Complex: zuotin of S. cerevisiae is a component
FT                   of the RAC"
FT                   /function="heat shock protein binding"
FT                   /protein_id="CAK46469.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG383362"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0000EFC81A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q3"
FT                   /transl_table=1
FT                   /translation="MATVQTINVTLPSLPSGWSADKDFKAVGTVSAATQRNLEPVGPHF
FT                   LAHARRKRHHRTFSEDERIQAQQNVKSTEDEEDDDISEDEDPMMLSRDAKDWKSQDHYQ
FT                   VLGLSKYRWRATPEQIKRAHRKKVLRHHPDKKAAMGDRDENDSFFKCIQKATEVLLDPT
FT                   KRRQFDSVDEAADVEPPTKKEAAKGNFFKLWRPVFESEARFSKIQPVPQLGDENSTQEE
FT                   VETFYNFWYDFDSWRTFEYLDEDVPDDNENRDQKRHMEKKNANARRKRKTEDTTRLRHL
FT                   VDDCAAGDERIKKFRKAARADKDRKRLEKEAEIKRLAEEKEKARLEEEQRKKDAEEAAK
FT                   AEREQNKKAKEAAKNAAKKNKRVLKGSVKDVNYFGEGGEPSAAQVDSVLGDVDLVISKI
FT                   DAEELAGLAGRLSAAGKDAAAVKNVYAEEVKRLVGAGKLKEGEAKFFA"
FT   CDS_pept        join(410170..410245,410305..410481,410547..410641)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902853"
FT                   /orf_name="An14g01570"
FT                   /protein_id="CAK46470.1"
FT                   /db_xref="HOGENOM:HBG396608"
FT                   /db_xref="UniParc:UPI0000EFC81B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q4"
FT                   /transl_table=1
FT                   /translation="MASQTALSARSAYRQLLRATRIAFQDDVRVMIAARQEARRNFDSH
FT                   RREGIDTPMQINHALEVANILRHNIVQGVREQDDENAKWELRIHDDIERGDNDTIRVKG
FT                   KTVKVDKACSS"
FT   CDS_pept        join(complement(411973..412113),complement(410903..411919))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902854"
FT                   /orf_name="An14g01580"
FT                   /product="Complex: SPCC550. 02c of S. pombe "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK46471.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG736998"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EFC81C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q5"
FT                   /transl_table=1
FT                   /translation="MPPPQIKQDLNRSGWETTDFPSVCENCLPDNPYVQMLKEDHGAEC
FT                   KICTRPFTIFRWKADRTARQKRTAICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKMV
FT                   APGPESTINREYYAQGHEKEIEEGRGAVEEYEKTDEKARELLRRLANSEPYYRKPRQIE
FT                   AAPQDEEGASAGPSDAPVVHSRYGNGPGPIRTSESRRGTPLPGRGRGGMRGGRGGRPFP
FT                   SAAQVPPSAEDILPPADPNITSLFVTGVEDDLPEHTLRTFFTQFGQLRSLICSHRAHSA
FT                   FVNFATREGAEAAAKQCQGRAVIQGCPLRVRWGKPKPLDNMDREERLKNAREGRQAAGP
FT                   RGADSGKKAITAAGEEIGKEQKQRSYAVAPPPGAGEVQYSSLSGD"
FT   CDS_pept        join(412994..413197,413265..413299,413366..414260)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902855"
FT                   /orf_name="An14g01590"
FT                   /EC_number="2.1.1.41"
FT                   /function="sterol 24-C-methyltransferase activity "
FT                   /biological_process="steroid biosynthetic process "
FT                   /protein_id="CAK46472.1"
FT                   /db_xref="GO:0003838"
FT                   /db_xref="GO:0006694"
FT                   /db_xref="HOGENOM:HBG316404"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="UniParc:UPI0000EFC81D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q6"
FT                   /transl_table=1
FT                   /translation="MAPAALEQENHARDAEFNRVLHGKSAEAQGGFAAMRNKDAAAQKA
FT                   AVDEYFKHWDNKSAEEETEEIRAARRAEYATLTRHYYNLATDFYEYGWGTSFHFCRFSP
FT                   GEGFQQAIARHEHYLAHQIGIKSGMKVLDVGCGVGGPAREIVKFTDANVVGLNNNDYQI
FT                   QRATRYAEREGLAHKLTFEKGDFMQMKFEDNTFDAVYAIEATCHAPELEGVYKEIFRVL
FT                   KPGGVFGVYEWLMTEEYDNNNAEHRKIRLGIEQGDGISNMVKVSEGLDAMKGAGFELVH
FT                   NEDLADRPDTIPWYYPLAGSFKHLTSPWDFFTIARMTWWGRGIAHRFVGAMEKVGLFPK
FT                   GSQKTADSLALAGDCLVAGGEKKLFTPMYLMVGRKPE"
FT   CDS_pept        join(complement(416542..416773),complement(416081..416402),
FT                   complement(415957..416031),complement(415689..415909),
FT                   complement(415281..415631),complement(414986..415176),
FT                   complement(414729..414875))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902856"
FT                   /orf_name="An14g01600"
FT                   /product="Induction: in A. parasiticus expression of the
FT                   hxtA gene"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46473.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG327399"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC81E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q7"
FT                   /transl_table=1
FT                   /translation="MAVGARKPVDRRALEDTTVVSNKQGPWWKDTGLRKLNLMLFFLMF
FT                   SEFTQGYDASLINNVQELNVWQEGMSSIDFAARNIVGVVFISFISDRLGRRYCLFFGAI
FT                   LCLAGTGMATGASSAGLFIAARLLLGMGGVVVAAIGPVWMGELAYPAHRATATSMSNTT
FT                   YSAGSIIAAWITFGTFRLANAWAWRIPTVFQALPSIIQVIGAFVLPESPRWLISRGREQ
FT                   AALAILAKYHGNGDAQDIVVQQEYQEMKETIELEIAAKKTSWKELINSRGNRWRSFILI
FT                   WCGICKQWSGNGLISYYLSSMLKSAGITREVDTTLITATSQMFSFACALAFAFLPGRVG
FT                   RRPLLLWSMGLIWLVFALITACTGVFVETGSQSASYATVAFIYIYNGVHNLGWTGAMML
FT                   YVVEILPYSIRAKGIALFWLVTGATGAFNTYVNPLGIDAFAWKYYFFYVGWIIVEFVVV
FT                   YFFFIETKGPSLEQIALLFDGKDAVVSHANPVAEEFLDEKEKEGAEAKEIEVAR"
FT   CDS_pept        join(complement(418111..418607),complement(417217..418060))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966405"
FT                   /orf_name="An14g01610"
FT                   /product="Similarity to hypothetical protein BAC75132.1 -
FT                   Streptomyces avermitilis"
FT                   /protein_id="CAK46474.1"
FT                   /db_xref="HOGENOM:HBG327400"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="UniParc:UPI0000EFC81F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q8"
FT                   /transl_table=1
FT                   /translation="MAIPSITALGDDPNTEHRLNACAYQQSAITTSGSIQYVAFYTPRE
FT                   ESDSRRVTIARHDLQDTSSNWQYLTFEDYDQTTDDGHNTISIGICAGDGTIHVSFDHHC
FT                   DALKYRISRSGLANDTSKSSWVASNFSPILDHLPGCDGLLDVTYPRFIPAAREMYFECR
FT                   IGKAGAGSDVLYRYSPDTAQFVHLGTYLVGRQCNPYPNGMSYHLPTNSLHVTWTNRHFI
FT                   EYEGAKDGASTAHKAQAGPNGPENNEGLYYAYSRDNGATWNGPSQKSVTVLSARPGTGL
FT                   ESQDSQLLVRNIPRNSGIMNQEAQYVDSQGGVHVLNRENTTGKETWMHYYRSSSDNQWA
FT                   FFALPEIYPTPTGPRGKLVHSEKLNSVFFILPSNTGNELLIARRSMTDIDGEFRVVWRE
FT                   HGYSGEPLIDEEAFTKFELLSVLILRDDKEGKRKVTVIQFDINELAQ"
FT   CDS_pept        join(419185..419315,419365..419484,419541..419680,
FT                   419762..419869,419923..420291,420340..420431,
FT                   420495..420528,420588..421033)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234978" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813235"
FT                   /orf_name="An14g01620"
FT                   /product="Similarity to heparanase - Homo sapiens "
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK46475.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG327401"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EFC846"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q9"
FT                   /transl_table=1
FT                   /translation="MDALIALTLLLITGSGVNGLAFEIPSSAPANSSGQLDAAPVGVSF
FT                   EFFAFPEYFQQLPLTNSCLGQLQDASGSYSPIRIGGTTQDRATYNASLSSAVSYSVDSP
FT                   DDAPESLTFGDSFMEIAAAYEGAVTIGLNRRLDNIDNTIAAAKIAKSNIANLYAIELGN
FT                   EPNFFTSSDPIADGQSWTAAADAASQVSWQASVGSALDETSFAQAGVFFGVGTFNVSNL
FT                   AEKEEETDSTQYVRSFCHHYYPQSASTADLVELMSHTEIVERVSEFQSQIVAAQELDKD
FT                   FVMGETNSATGGGGGISPTFGAGLWILDYVMQATILGVKQLFFHQGTIGNCPYCWWDES
FT                   VNAPFYGAYTAALALSGASKIAQLDTGDSRFAAYAFYDSSNQPIRVLLYNSEYYTSGTR
FT                   SSVSVTLSGIPSATTSVSALRLTGDAATTIVGEGAITVGRQTFANATCELQGTKDMEAT
FT                   AVTAGRATFTVQASEALLISV"
FT   sig_peptide     419185..419241
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q9 "
FT   mat_peptide     join(419242..419315,419365..419484,419541..419680,
FT                   419762..419869,419923..420291,420340..420431,
FT                   420495..420528,420588..421030)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Q9 "
FT   CDS_pept        join(421548..421656,421714..422790,422840..422991)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813236"
FT                   /orf_name="An14g01630"
FT                   /protein_id="CAK46476.1"
FT                   /db_xref="HOGENOM:HBG327402"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniParc:UPI0000EFC847"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R0"
FT                   /transl_table=1
FT                   /translation="MAEAGDKAEVPPAAVSFFDPALKAVRRSVFFQWGRTVLILCVFIL
FT                   CILSLFWAVQFHAESRFSALTVWVVDFDGQLEPYRNETPIVGPIVTEVVDHILDTSTEH
FT                   LGYTIKSPADFNNDPWAVRQSVYDEHAYAAVIINANATALLRNAVINGNSSYDPYGAAE
FT                   FVTISARDPTTYYDYINPFLYDLDMAVRSSFGLRWIQYVAQQGYNISQVPQAINPGIGF
FT                   TSVDLRPFAPAVITPAVSIGLIYLIILAFFNTPFMMPIHIQFIKGNHPPLKIPQWLLWR
FT                   ILSNIGTYFFLSLFYSFVSLAFQIPFSNPSAPDTQVAYNPNGYGHGSFVVYWMLNWAGM
FT                   CALGFPCENMAMIIGLPWSALFLIFWVITNVATGFYALDLAPGFFRWGYAWPLHRIVEA
FT                   IRTILFDTHSRIGLDFGVLFAWIGFSICLFPLAAAFMNWKIKRGWA"
FT   tRNA            complement(423486..423593)
FT                   /gene_name="tRNA-Met (CAT)"
FT   CDS_pept        join(complement(426002..426070),complement(425784..425891),
FT                   complement(425546..425683))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117445"
FT                   /orf_name="An14g01650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46477.1"
FT                   /db_xref="UniParc:UPI0000EFC848"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R1"
FT                   /transl_table=1
FT                   /translation="MSGGGQVSVFVVMRPHRHRQGSEVHASIGRLRSHALSSPFTWRRT
FT                   FSACSTRTLKMREMLGPSSFDNNRMPIGVQADTRKLSKKPHEGKMGQAADSDDMAALMR
FT                   "
FT   CDS_pept        426147..427787
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887457"
FT                   /orf_name="An14g01660"
FT                   /EC_number="1.14.13.-"
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46478.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG655952"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI0000EFC849"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R2"
FT                   /transl_table=1
FT                   /translation="MAHSEHPTDTCPVKYDILIIGAGFSGIFMLYHLRKLGYSCRIYEA
FT                   GSDLGGTWANHIYPGVRVDSESWVYQLSMPEVWEDWSWSEVYPSGQELRRYFAHVDKKL
FT                   HIKKDVDFRAKVVKAQYIREKSYWRTETEDGRITQSQFLISCTGFASKSYTPAFPGMED
FT                   FKGEIYHSEHWPKEDVNIQGKKVAVIGTGSAGIQIIQEWAKEAGTLTVFQRTPNRALPM
FT                   RQRQLPQEQEVIKSMYPHVFRDRGRTFAGHVATQVPKRTFDVSPEEREALYEYVWKKGG
FT                   FHVIIGSYIDVLTDLQANRALYDFWARKTRSRLHDPRKRELLAPLDPPHPIGAKRSSLE
FT                   LNYYEVYNQLNVHLVNVREEKIVEFRPHGIVTSSGAYHELDAVALATGFDGLTGSLTSL
FT                   GLHNTEGRSLKEEWRDGAKSYLGLTLSGYPNFFYMCGVHGPSALSNVPSTMEVQGQIII
FT                   NIIQRMRANRLASVEATPEAADSWSNGADEIANATLFTQADSWYMGANIPGKKRQMLNF
FT                   CGGIPAYEQACKEALETWKGFRTVQMANL"
FT   CDS_pept        join(430309..430522,430574..430772,430896..431346,
FT                   431401..431895,431946..432167)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962541"
FT                   /orf_name="An14g01670"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46479.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFC84A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R3"
FT                   /transl_table=1
FT                   /translation="MSSPSPSSEQPQSRNRPGSACTECRRRKMRCDGKHPQCNNCSNAG
FT                   IICVFNPQPSRRGPKKGHLKSLQVRIANLENTLFGRTQDPLSTEISTDGDAAAQSAMHG
FT                   WESQLNIPLNEFNIPAGAPKLGTVPISDLLHAELDDSKSISRTCLQYAMWTITTSKSAQ
FT                   LEHLCEPLYQSARELLGCLQVTAENSNIDRIEHVQALLILAVYEFTHHTFQRGWMSAGQ
FT                   GIRLVQLMNLHKIDLNKEGRAGPDEASGLDDPVCTEERRRVFWIAYILDRLISLRHESP
FT                   LTFDERVIATRLPAREEAFQMGQLNQMTGFLSKAITEDGPLPKAELSEMVILATLCGRT
FT                   VLHRQQAAAEQADCGISNSFWERHRRLDAILVKKGQVISTLQPVATMMPAELASLIPNL
FT                   MIQSALLYHCTTLQLLADGIESSEMVLQCRQRAILAAQEIIRLTEAVLQLNYFEIAPFT
FT                   PLPVLLCAKVLMMYQDADPSCALQLQEVLGMVQNLANTNHLCREWAIQHRDLFGSESDF
FT                   VHIEEESHG"
FT   CDS_pept        join(432589..432734,432783..434073)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164922" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887458"
FT                   /orf_name="An14g01680"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46480.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG327405"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC84B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R4"
FT                   /transl_table=1
FT                   /translation="MASQKVEVELSDRSRSAAEQEQVAPLPQNTNQASSSRNGPVPEPV
FT                   YSQWHYATVVAAGFIVMITTCAFVFSFGVYQSLYEEMAREPNTPFTGSTTALIDLIGTL
FT                   AIALMSMAGPFAMSWAKLFSPQAVIIAGGWVFGIAYILASFSKALWHFALTQGLLLGIG
FT                   TCMAYVPTMAVAPTWFTKRRGLAMGIIISGTGVGGMIWPPALRAMISHVGFRNALRISG
FT                   CISLTTVTAAGSILRWEPKFHEQVKLQAAGASRSSRARPKWIQLFSVPLVNWRVARSKR
FT                   FTAQALGCFLQSAGYSTPLFFYAAYAQALGYSATTAANFITLSNASNFVSRIIIGYAAD
FT                   KLGRINALAATTLLSTVAVFAFWLPSSLVSSAAAHGLFIVFTILYGAFASAYISLFPAS
FT                   LVELFGVQHFTSVNGALYLVRGVGALLGTPLTGLLIPRGSALTESGIYERAAITVGVLL
FT                   FAATVACFWVRAEVHGKWRV"
FT   CDS_pept        complement(434267..434734)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656685"
FT                   /orf_name="An14g01685"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46481.1"
FT                   /db_xref="HOGENOM:HBG324425"
FT                   /db_xref="UniParc:UPI0000EFC84C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R5"
FT                   /transl_table=1
FT                   /translation="MSTTTATATTSAASCTSTGNLYVLPVQDAACAIPNTKNASAIMDK
FT                   CCSPASPTKYDNDCGIYCLAQGQDVKELLSCIQSNGAVEDPFCSGNLTATATASVTGTK
FT                   ATGSTKTGTSTGSAASETGSSAAVPMKQAGVSKVGLGMLGMVLCSAVLGGF"
FT   CDS_pept        complement(435711..436640)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171121" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887459"
FT                   /orf_name="An14g01690"
FT                   /product="Putative uncharacterized protein "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAK46482.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG324426"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000EFC84D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R6"
FT                   /transl_table=1
FT                   /translation="MSTTNNSLTTSITTTEPDQIASLHLIADSIAQQRQLAARSMLTHP
FT                   AVLSCLTFSLFITYFFTRALSTTGEDNWPYLLLITWPACIMVYLLAAAHTTHPYLEKAG
FT                   RTGTWVWLWKGGTRYKHRRREPPPPQSPPPSASSSPSTSRAGYKTPMKRDHHGAEDNEE
FT                   EEEEDIMLVTKYHNRVIGTLVLRIIRTEEELWGHVRDAVVREELYQTPSIPGTGSTTST
FT                   TSSGSCQPVGVIRAWTVEQHLRGVGVGRNLLENAIRICRQRGIKGPVFSDCHANEVLGL
FT                   PVVCNGELVRRERRAREVLEGVKREVVF"
FT   CDS_pept        join(complement(438245..438765),complement(437734..438202),
FT                   complement(437012..437691))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887460"
FT                   /orf_name="An14g01700"
FT                   /product="Putative frameshift"
FT                   /function="inorganic phosphate transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46483.1"
FT                   /db_xref="GO:0005315"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004738"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC84E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R7"
FT                   /transl_table=1
FT                   /translation="MAASGTAAFPNYNVDLSHVEDPNERRRLALARIDDAPFGWRHARA
FT                   IVVAGVGFFTDSYDIFAINLCSSMLGVVFWQHATTRPGKMPYSSDTAIKVSTSAGTVIG
FT                   QLFFGWLADIVGRKRMYGIELIIIILATLAQCLSSNSPAVSITGLLVFWRTVMGIGIGG
FT                   DYPLSSIITSEFANTKHRGAMMGAVFAMQGFGQFAAAIVALIVTVGFKGSLEXCQLAVD
FT                   KMWRVVIGFGAVPACLALYYRLTIPETPRYTFDVARDLLKADEDVEAYILGKHEGHPDE
FT                   VKRVAVLQSADIRLRTPRASWSDFCSHFTTWKHGKVLLGTAGSWFFLDVAFYGLGLNNS
FT                   IILTAIGWNGGGTVYEYFYRNAVGNLILICAGAIPGYWVTVGTVDRLGRKPIQMTGFVI
FT                   LTIIFIVIGFAYEPLKKSDHGLLALYVVAQFFFNFGPNATTFIVPGECFPTRYRSTSHG
FT                   ISAASGKVGAIIAQCVFGPLAHRGAKGGVNSSDTPWLNHVMQIFALFMLCGCLTSLLIP
FT                   ETKRLTLEYLSGEEPTPTPTVTPSRQEREPKRDEETRER"
FT   CDS_pept        join(complement(441151..441406),complement(440272..441104),
FT                   complement(439635..440226),complement(439525..439598))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182178" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656686"
FT                   /orf_name="An14g01710"
FT                   /product="Function: NapA of E. hirae "
FT                   /function="solute:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46484.1"
FT                   /db_xref="GO:0015299"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG325088"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniParc:UPI0000EFC84F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R8"
FT                   /transl_table=1
FT                   /translation="MASSGSDAAFAYHEPSISTLLNQGGLLVVLNLINVCLDKLLYCGL
FT                   IGQLFIGILWGTPGAKWLDTETERVIQQLGYIGLIMLVYEGGLSTSIKSMRANLLISLC
FT                   VALTGIGVPMALSFILMKLVSASPLQAFAAGASLSATSLGTTFTILSTTNLIPTRLGTV
FT                   TTSAAMLDDVVGLVMVQIISNLGGGTSSFNVVTVIRPLFVSIGFALGVFILCAFCFKPI
FT                   LKRALNMRGNLPQFMGTMQFAFLAQTSVLVGLVAGATYAGTSSLFAAYLAGVITSWFDG
FT                   LAADICGINTNKAHNMPVSESGVLGEQTTSEQSTSQDLSNNSTPDTRQTHPCRPHIKVP
FT                   TGIEVYEKYYREPVNRILLPLFFASIGFAIPITKMFRGDVVWRGVIYAILMMIGKMVTG
FT                   LWLVRFSLPSATTLISILGRPLSWALVSCASRKTEDKRKKQSKKQGPRPRIQSAVRTEQ
FT                   SDQNTNATNLDQNRRNSPSPNHNEPVSGTEPQNPSASPSRTMSLPPKPKSLYPPFILGL
FT                   AMVARGEVGYLIASLAESQGMFSSGSNGEISEIYLVVIWAISIFKRVKKLQQSRESLGA
FT                   DPLGVWGI"
FT   CDS_pept        443084..443269
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887461"
FT                   /orf_name="An14g01720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46485.1"
FT                   /db_xref="UniParc:UPI0000EFC850"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R9"
FT                   /transl_table=1
FT                   /translation="MQFTLITAFATAFLASFVAANPAPAPAPFEIGIGANAAANAAAEV
FT                   AANAGLGAGAGIHFKA"
FT   sig_peptide     443084..443143
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R9 "
FT   mat_peptide     443144..443266
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2R9 "
FT   CDS_pept        join(complement(449557..449585),complement(448870..449475),
FT                   complement(448809..448830),complement(446934..448759),
FT                   complement(443766..446874))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194492" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887462"
FT                   /orf_name="An14g01730"
FT                   /product="Function: DEAD-box helicases are involved in
FT                   various aspects of RNA transcription "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAK46486.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG324100"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000EFC851"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S0"
FT                   /transl_table=1
FT                   /translation="MADPQKVLFWYNGLYSRTVDLVGDYAGSELFIIEGDSLLLHCFAD
FT                   DQLEFANGFQLLHATYIVERSLEQLRRRNCNFHIVFFSENSAASISPHVHQSSLPKYRL
FT                   AREAILQHLQQNAPKVFPSIQVRCFDTYNCPEFEEYLTLEGVYFIMCHDGAFSSHSGHD
FT                   RALHESLEESEDLKVLSDGTSDTDSDETFDNALTSFWPNRVTLRSMIHCLECRDTKVFT
FT                   MVLEGSAERARNLFGVDSEDPDIEEDTESSDSDTEEVDSGISMVHGHVEAGTSDSKRCP
FT                   ASSSVELTLRNFLGILNTTGSHALTQREWVTTLTASALLNSGPLEENEMLGLRALLLHT
FT                   IVLSECKLGNRVYGPKYCRPGESLLVKYAEVSWSIITSQLWHEAMSARPMSCDVADLID
FT                   GRLFLETLQMAYSSDLEGFFSQSIMEKFSVLTSLVKALCGAELAISKVCNKASGSKASR
FT                   NEETNHSGNRPVNSRIKTTAVLPFNNPDFDRHLKPISLAIDESVAGKDLAVSRIFEEIT
FT                   HWHNHRRPLDQRNTVPPSKWLLRRNQMFMAETEQYAASLTDAKPESIFLKAKADLKALP
FT                   GKGPASGAMERDRASQSAKNGSKQAKKSKISVSASVKAKAEVHFQEQRNNNFERQLEAW
FT                   KNKRHDIEHSDNLVQRYQAAYEYLHSLKRKGDCLIEPEILAYLIMTLAQIWKQKCETEK
FT                   DRPMAIVALVWFMILRLSKAKQVITFDIRCLIEDVIRALNLPYIDIPCDVSGKATSAST
FT                   PLASRHANLQTGLSPVEFQLVHAGPYFDRNMESAPDHRVHDFEPDRWQREILDQIDAKA
FT                   SLFVVAPTSAGKTFISFYAMKQVLESSDDGVLVYVAPTKALVNQIAAEVQARFSKNYKH
FT                   AGKSVWAIHTRDYRINNPTSCQILITVPHILQIMLLAPSNAKSWASRIQRIIFDEIHCI
FT                   GQSDDGVVWEQLLLLAPCPIIALSATVGNPEEFNDWLRLTQNANGHDLKMIEHKTRWSD
FT                   LRKFEYRPPTSFIFKGLSDATHLAALGLDACPNMSFIHPVTSLTNRSRGIPDDLALEPR
FT                   DCWTLWKAMDKYKTADYPLDNALNPSNALPGVIAKANVLEWEAKLKLVLKHWMINSDSP
FT                   FDSVLKELSQGSHLEKSRDVQVSSGERGQSDKPRPVKNNLLDTTLPLICSLHDQGALPA
FT                   IFFNYDRSKCEEICQQIVDELEQSEDRWKASSSSWANKISEWKEWKKLEEKRAKHKKPS
FT                   KVKSRVGDNDGNMSKADKMRDTASAESSWHESFDPEKPIPRFSLADEKKLADSDFEEYA
FT                   QALQQRQVPSWLIDALKRGIGVHHAGMNRKYRQVCEILFRKGYLRVVIATGTLALGINM
FT                   PCKTVVFAGDSVFLTALGFRQAAGRAGRRGFDFLGNVVFQCIPDSKIYRLLSSKLPSLN
FT                   GHFPLSTSLVLRLFILLQKSNRSKFAVKAINSILSCPRIYLGGPEAKHTVLHHLRFSVE
FT                   YLRRNQLLDANGLPLNFSGTISHLYYTENSSFAFHALLNGGYFHRLCKNIFRNPKETVL
FT                   TLMLVMSHLFGRRHLPPVTLENFRTSEKKSPSVVVLPSLPKKAARILRSHNEQTQDIYT
FT                   AYVTTFVEQHIKDPDCFLPLTGIKCGGDKSPEEISHSLPITPPTQVTSSFVSLSGHGDN
FT                   WSSIPDLCQKVRSGVWLEQAVVPYVGLYPEEGQLPLNAYLYDFFKHGNVKALEKWNMIR
FT                   KGDIWFLLNDFSLVLATIVTDFENYLKLSPNIDVDLLDVAGSGDVHEIDLDDNAYDAKE
FT                   PQPGTAVKSAHLAQAPVQATTKPPLTSVSANSKKAKVADSWEDEQSDDEGRGNENNIPE
FT                   RGGGSKATSKLTSSASPGQIEEKGFLQVLKAFKMLRDDFNEKFKAMWA"
FT   tRNA            450739..450820
FT                   /gene_name="tRNA-Gly (TCC)"
FT   CDS_pept        join(451189..451583,451615..451618)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962542"
FT                   /orf_name="An14g01750"
FT                   /product="Function: OXRD-4 of H. sapiens contains a
FT                   nitrogenase Mo/Fe metalloprotein domain. "
FT                   /EC_number="1.-.-.-"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46487.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI0000EFC852"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S1"
FT                   /transl_table=1
FT                   /translation="MARVRLAPLSSLTQTRYVLHLSDGKRLVLFRLPTIETPKTKDKPR
FT                   ARNDANGWSYYAMEAECPHAGGPMKDSSIDIEDSAYIVSCPWHAYDFNVETGESSVGIK
FT                   ACTFPVDVSDEDMVVVEYTSEKLGEGVE"
FT   CDS_pept        join(451715..451733,451826..452571)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809341"
FT                   /orf_name="An14g01760"
FT                   /EC_number="2.3.1.41"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase
FT                   activity"
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46488.1"
FT                   /db_xref="GO:0004315"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG325299"
FT                   /db_xref="InterPro:IPR007402"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011197"
FT                   /db_xref="UniParc:UPI0000EFC853"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S2"
FT                   /transl_table=1
FT                   /translation="MQRCVNDKPMVIGDRTNVDLPDLPPRDGVKDVNRQAVPKPGRGGT
FT                   QKSRINMLHALANIEQWAIDLAVDICVRFAKFQTNSADALGLPRAFFHDWLKVANDEAK
FT                   HFSLLRTRLEELGSYFGALPVHHGLWDSATVTAHDLRARISIIALVHEARGLDVNPVTI
FT                   DKFRKAGDGDSVDTLEIIHNDEITHVTTGHRWLTWICAQEETDPVQVFRGNVQKYFRGP
FT                   LREPFNTEARLQAGLDKRYYEDLSGYEGIQPA"
FT   CDS_pept        join(complement(455464..455599),complement(454275..455412),
FT                   complement(453128..454175))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887463"
FT                   /orf_name="An14g01770"
FT                   /EC_number="3.2.1.21"
FT                   /function="beta-glucosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK46489.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008422"
FT                   /db_xref="HOGENOM:HBG749096"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EFC886"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S3"
FT                   /transl_table=1
FT                   /translation="MKVSLTLYAAALQLADAAVVQKRTVDVAELEHFWSYGRSEPVYPT
FT                   PETSGLGDWEEEFTKAKSLVAQMTDDEKNNITYGHTSTTNGCSGMTGSVPRLGYPGMCL
FT                   QDAASGVRGTDMVNAYASGLHIGASWNRDLAYEHAHYMGAEFKRKGANVALGPVVGPLG
FT                   RMARGGRNWEGYSNDPYLSGSLVQNTIRGLQESVIACVKHFIGNEQETNRNTPQLLDNS
FT                   YNQSVSSNIDDKTIHELYLWPFHDAVKAGAGAVMCSYNRINNSYGCQNSKTLNGLLKGE
FT                   LGFQGFVVSDWNAQHTGIASAAAGLDLVMPDSVYWENGNLSLAVRNGSLSSTRLDDMAT
FT                   RIVAAWYKYAELEDPGFGMPISLLGPHVPVDARDPASKTTILQGAIEGHVLVKNTGNAL
FT                   PLKEPKILSLFGYDAIAAQRNTMDDLTNPSENGPGVALNGTMISGGGSGSSTPSYIDAP
FT                   FDAFQRQAYEDNTFLAWDFASQSPVVNPASDACLVFINEAAAEGWDRPYVADPYSDTLV
FT                   ENVASQCNNTMVIIHNAGIRLVDRWVENPNITAVIYGHLPGQDSGRALVEIMYGKQSPS
FT                   GRLPYTVAKNASDYGALLNPVVPSGTMDLYYPQDNFTEGVYIDYKAFEQKNITPRYEFG
FT                   YGLTYSTFDYSGLKISVHSGVNTDYLPPNSTIEEGGISALWDVVATVTCSVSNTGSVAA
FT                   AEVAQLYLGIPGGPAKVLRGFEKKLIQPGKHTKVQFDLTRRDLSSWDVVNQAWGLQKGD
FT                   YSVYVGKSVLDTQLTGTLTI"
FT   mat_peptide     join(complement(455464..455548),complement(454275..455412),
FT                   complement(453131..454175))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S3 "
FT   sig_peptide     complement(455549..455599)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S3 "
FT   CDS_pept        455781..456176
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962543"
FT                   /orf_name="An14g01780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46490.1"
FT                   /db_xref="UniParc:UPI0000EFC887"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S4"
FT                   /transl_table=1
FT                   /translation="MVEHDDGGMDRTRNVKNERPRVSGQSRHDSQLDAVLSVTFVGLAC
FT                   MVNKSRGRNRFPVGSTKSVLEYGALNCGDSTLGISETSAFCTPERENVTRMPAEFRQIV
FT                   PPCWIMLGLQARQVKLAVVRPFVPWSS"
FT   CDS_pept        complement(456593..457189)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887464"
FT                   /orf_name="An14g01790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46491.1"
FT                   /db_xref="UniParc:UPI0000EFC888"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S5"
FT                   /transl_table=1
FT                   /translation="MISAQVPASSTLVSAEIPLTAGSSNTITINTSIPIDAIHVTPPNG
FT                   TYYPCTNFTLAGSTTLTTCGSGYCQPVGSKVGYISPSGTAKATISATTSGSKYLEIDWI
FT                   NNDIAFDSSWGWGSNSRNLTVTVNSEDPVRIEVPLSGRHSELFGPGLGWWDTSTLGLLT
FT                   SGWKEGLNEVVVGNVGGDEGFQSYGADFVGIRVLD"
FT   CDS_pept        join(complement(458670..458773),complement(458322..458620),
FT                   complement(458210..458266),complement(457325..458160))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113547"
FT                   /gene_name="aglD"
FT                   /orf_name="An14g01800"
FT                   /product="Probable alpha-galactosidase D "
FT                   /EC_number="3.2.1.22"
FT                   /function="alpha-galactosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK46492.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG424315"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EFC889"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R2S6"
FT                   /transl_table=1
FT                   /translation="MLLHFILYAALSSVVTSVSLQPRLQDGLALTPQMGWNTYNHYSCS
FT                   PNETIVQSNAQALVDLGLSSLGYRYVTTDCGWTVADRLPDGSLTWNDTLFPQGFPAMGD
FT                   FLHDLGLLFGVYQDSGILLCGSPPNETGSLYHEEQDARTFASWNVDSLKYDNCYSDAAT
FT                   GYPNVNYAPSTSPEPRFANMSHALLQQNRTILFQICEWGISFPANWAPALGHSWRIGND
FT                   IIPDWRTIFRIINQAAPQTDVAGPGQWPDLDMLEVGNNIFSLPEEQTHFSLWAILKSPL
FT                   IIGAALKDELTAINDASLAVLKQKDVIAFNQDALGKSASLRRRWTEEGYEVWSGPLSNG
FT                   RTVAAVINWHNESKDLTLDLPDVGLQHAGTVKNIWDGTTARDVLTSYTATVAGHGTMLL
FT                   ELQNTTAVGVYPRGVFGVSSGYVRPCSKHACF"
FT   CDS_pept        join(460487..460846,460998..461325,461361..461533,
FT                   461578..461724)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000011592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887465"
FT                   /orf_name="An14g01810"
FT                   /EC_number="6.1.-.-"
FT                   /function="ATP binding"
FT                   /function="D-alanine-D-alanine ligase activity "
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /protein_id="CAK46493.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008716"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="HOGENOM:HBG427092"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI0000EFC88A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S7"
FT                   /transl_table=1
FT                   /translation="MATESLKIALIYELREAYKALGYSNADCDRFEVGEAAEHIAAALK
FT                   NLGHEVVLVPDIHSLVKRLAHGEGSTWDLAFNTTEGLHGLAREGQVPALLEAYQIPFTF
FT                   SDAATMTLCLDKGRTKVSLDEILSMIRMSRHSETLLSQYPLFVKPLAEGSSKGIGATNK
FT                   IKSIESLCDVVNSLRDSSPSSLGVLVEKYLPGREFTVGILGTGEDAWVVGVDEIYGAAK
FT                   SRRILTPTDDWAGEADEIKIGWDDQEADLACQTALRAWTVLRCRDGGRIDIRMDHSGSP
FT                   VAHVMEIQINPLAGLLPHWSQLPMIAEHNNVSYNELIEYILKSALQRRRGRVLN"
FT   CDS_pept        join(463544..463835,463905..464167)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178274" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809342"
FT                   /orf_name="An14g01820"
FT                   /product="Similarity to hypothetical cell wall protein binB
FT                   - Aspergillus nidulans"
FT                   /protein_id="CAK46494.1"
FT                   /db_xref="HOGENOM:HBG327411"
FT                   /db_xref="UniParc:UPI0000EFC88B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S8"
FT                   /transl_table=1
FT                   /translation="MQLKNLIFAAATAAALPATDAATNEPFGVISIHSGSGVQYAPINA
FT                   ALGSIFAGLKSQNASCSNPQDQTATFFLDDGALYLYDQSATPQELYVDRSGMGQGKIGY
FT                   TTGAQPAPKNGERKGWSIDANNHLQFGGKDLIACPNSIEGAWSIWADAGVAKPGYNEGC
FT                   EGIAARVEVSKNPNVCSYTSN"
FT   sig_peptide     463544..463606
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S8 "
FT   mat_peptide     join(463607..463835,463905..464164)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S8 "
FT   CDS_pept        join(complement(466263..466440),complement(465767..466055),
FT                   complement(465612..465677),complement(465479..465547),
FT                   complement(465130..465374),complement(464831..464883))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656687"
FT                   /orf_name="An14g01830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46495.1"
FT                   /db_xref="UniParc:UPI0000EFC88C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2S9"
FT                   /transl_table=1
FT                   /translation="MDKCLATVAMRSTRQPANEIASQIAKWMVEPSVFDGTRHRGSTMR
FT                   TYDFLGPRNSGQGLVSTCGCGVARLGCPYWFTVTVHHSQSVIIPVHTVSCWDCTATTEI
FT                   EIFRKLRILETSWFVRRVGNWLSSRFAHFAVVALTSCHRMTGNWVLPVQDTGLGMLYTG
FT                   RVYRPGWERIVGVVGDFASADSSTLRESAVQLGCRWKGHRRVTDCLLPVAVSSCRAYVA
FT                   LKPLGPATDRESVLSFDGHLTRPLMPQVMECRCLRWLSVPCLHPCNLIETQPNFTITGT
FT                   MGPFYPAAPLDALRTSVI"
FT   CDS_pept        466729..467325
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171311" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887466"
FT                   /orf_name="An14g01840"
FT                   /product="Remark: the systematic gene name of TIR3 of S.
FT                   cerevisiae is YIL011w."
FT                   /protein_id="CAK46496.1"
FT                   /db_xref="UniParc:UPI0000EFC88D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T0"
FT                   /transl_table=1
FT                   /translation="MKYALSTILLTTLLATPSLSTPAPDVVSDAIGVAQTIVSGGESVA
FT                   TNIANDATSIASDIRTGGGAAYSSLTSDAGDVASNAESWGTSVASNARSDASAAASDIR
FT                   SKASDVASEITSKWESATTLTGSNGQPTSTETVSGKTTLTASTASATGTSASGSSASAT
FT                   SSTSEGAGVAMATPGVGLGLGVAGVAGVLGVMAAL"
FT   sig_peptide     466729..466788
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T0 "
FT   mat_peptide     466789..467322
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T0 "
FT   CDS_pept        join(complement(469415..469505),complement(469206..469351),
FT                   complement(469103..469150),complement(468901..469048),
FT                   complement(468234..468853),complement(467777..468161),
FT                   complement(467505..467692))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171300" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113548"
FT                   /orf_name="An14g01850"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK46497.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG324420"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EFC88E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T1"
FT                   /transl_table=1
FT                   /translation="MAAKASPTAVSANSGAEEAGLSDPGDSQLLAKMGYKQELRRQYST
FT                   VQIFAVAFSIMGLVPSIASTLSFSLPAGPAGMIWGWFTASILIFFVGLALADMASAMPT
FT                   AGGLYWWTHYFAGKKYKNVLSFLVGYSNTLGLIGGICSVDYTLALMILACVSITRDGTY
FT                   SASNGTIYGVYVGLILVHAVVSVYSGPIMPRIQTFCIFINIAIIIATVIALPVGKVTRG
FT                   ESLNPGTWVFGHVDNESTWPTGWNFILAFLAPIWSIGFFDSCVHMSEEALHAAKAVPLG
FT                   IIWSSGCACVFGFLVLSIIAAVMNQDVNATINSVFGQPMAQVYYDALGKKGALGFMGVL
FT                   IVIQFLIGLSLITAASRQAWAFSRDGALPFSNYFRHVSHRIRYQPVRAICGLVAVSIVF
FT                   GLLCLINSVAANALFSLFVASNYVAWATPILCRLIWGKERFRPGEFYTGFMSRPIAIVA
FT                   VLWLAFGLMLSMFPTTGPNPSPSDMNYTIVINGFVWVACMTYYFLFARKWYTGPKMTVD
FT                   GVEEERTESETEEKRDEAHTGASY"
FT   CDS_pept        join(complement(472230..472360),complement(472119..472175),
FT                   complement(471401..472052),complement(471139..471348))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887467"
FT                   /orf_name="An14g01860"
FT                   /product="Function: RIM2 of S. cerevisiae is essential for
FT                   mitochondrial DNA metabolism"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46498.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000EFC88F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T2"
FT                   /transl_table=1
FT                   /translation="MQPVAHQSGGASGDPLPPSLPTEAIEEKASVSSLGPWNHLVAGAT
FT                   GGMVTAIVTSPLDVLRTRLQTDYYQTQGVNRSIPTHAHVRQSFVRTSIRHFRETFGILF
FT                   SIHRVEGWRGMFKGLGPSLTGVVPASAVKFYTYGNCKRLLPEILGCDKDTTLVHAMSAA
FT                   CAGIATGSATNPIWVVKTRLQLDKAGARRYKNSLDCTKQILQQEGPKGLYRGLTASYLG
FT                   TIETTLHLAMYERIKGLISKEVNLDKNSDSNKFVQGLALSGASGLSKLFACLIAYPHEV
FT                   IRTRLRQAPMADGRQKYTSILQCARLILKEEGVIALYGGLTAHLLRTVPSAAITIGTYE
FT                   LVLKVLEGR"
FT   CDS_pept        join(complement(475289..475415),complement(473697..475174),
FT                   complement(473325..473645))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656688"
FT                   /orf_name="An14g01870"
FT                   /product="Similarity: contains a ATP binding domain
FT                   reminiscent of AAA family ATPases "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAK46499.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG325301"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI0000EFC890"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T3"
FT                   /transl_table=1
FT                   /translation="MSMRRMDRVSKRRRPLLQRLPPRSSSISDPNHILIDISEDIISND
FT                   SRSVQYAPAGSICETLNLYQTEPSYNGNKSWTREPAAGIVEPVRAPESGQYALLVRNIK
FT                   CSSGHGRLEVDSIVVQSEHLKGVLARVMDGYPGITMSLERVEFSKPFQPFVHRWELFSE
FT                   ARDDESGAQAKAHIDLLYGVLATELSDIITNKQNLVLNGMITFDMLWTIFEPGQIVLST
FT                   VNDCKRAFRLETCWVDSDYEIQAVYIDYNGYEIGYRKYTLYIPAFEGTKPIMSLPMIPF
FT                   MFHNDKDILRESLILRGKLWYQYEGHHHKHYQGLALTSYGGQEIRYKINSRVIIDTEAY
FT                   LAFHSDKNSISLIDISDSPSDEDFLIATPVLRGYSLKDRKWLELCIDGVSDIVWKSRPF
FT                   KSLVLPDGEAKDLKDLVLALATSQSKKSDVSDDLLQGNGRNVIMLLHGPPGVGKTLTAE
FT                   CVAEVMHVPLYVQNAGALGTTAAQIKESLSFVLRMVPKWGAVLLLEEADILTQKHNPSD
FT                   PQKKALSHVFLPLLEYFEGIIFLASNRVEIMDPALESHIDVAIHYPELDSASRRHIWIR
FT                   LLGKSDRKAFSGSELFDLEEYKLNGREIRNVLKAARVLARYQETKLGYEHVSKVLKLRY
FT                   SERDEY"
FT   CDS_pept        join(complement(478087..479330),complement(477734..477842),
FT                   complement(477592..477651),complement(477359..477485),
FT                   complement(476166..477280))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887468"
FT                   /orf_name="An14g01880"
FT                   /product="Catalytic activity: phosphatidyl-L-serine  "
FT                   /EC_number="4.1.1.65"
FT                   /function="phosphatidylserine decarboxylase activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAK46500.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0004609"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI0000EFC891"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T4"
FT                   /transl_table=1
FT                   /translation="MFSIINLPSRSSGAVSSTSSSKMRYAPIVNELLQLLDKSFPYASG
FT                   MEALEQAIQSALQYRIVEMESYGLTSAKGFLNFATWMVDGWIPTESAKGRDIYYILCIF
FT                   YFVFDQVPLKDCQTAIRPESVGQDLSELSQWMVKFAKEVGSHMDRPESLNEASLTSFWN
FT                   APSFHVFEADESKTEGGKWKNFNQFFCRHLKDGARPIDGEGDDSIVIFPADSTFSGYWD
FT                   ITDDSLVELKGLPWHIGDLLGPYKSDYGDSFKGGVWLHSFLNSFDYHRQHAPVGGTIKV
FT                   IDTIDGAAYLDVEYQPDSRSLMPKRPMRPVYSSGPVFRGAEATDKEGYQFLQARGIIII
FT                   ENDKIGTVAVLPIGMAQVSSVVVRDDLKPGATINKGDEISHFEFGGSDIVVMFQGGKID
FT                   PHTLPQPLSRKSEEPFPNCGRMARQILFGFCGVGEIRRVVSIDVKSDHSWPNPSAHSRC
FT                   CAWNPVADISHELSAMPPQTRAIQHSESVGEKKRKPLRRDPEKRRQQNIQAQRRYREKL
FT                   RERLGRLEALAESAGQTPAIKSTPAAGIQPSGAITASGLPNTSSSIVPKTLPLYDASDV
FT                   SVPSTSVATLGNCQQLIPASAESPSALYTSDSTITPYLYSDESPSALTVWDPPSCVDPS
FT                   LLVSDKPSDSLELYWTTTIDCGCTSPHFRIQTECPDLLGHNEVRVFRFGTNTTTADPYT
FT                   NSLRIDRVCTIAAILDLVRHVGVTEEALCADESLSPFFRPTAVMVDEAAKRNLIRTVQE
FT                   TFKSLKPDLRPFQEQITIEHHPMIDILPFRTLRRNLITRQHDIDEDEFFDDMLSGLVCW
FT                   GGAGIGKRDRQVSTGYASTGTPWDVRSWEAKVWFLKKYWSLLGGEDGELVRQSEWWRSI
FT                   RGDDIEQENMWLG"
FT   CDS_pept        join(complement(480283..480460),complement(479833..479921))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887469"
FT                   /orf_name="An14g01890"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK46501.1"
FT                   /db_xref="UniParc:UPI0000EFC892"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T5"
FT                   /transl_table=1
FT                   /translation="MEVAWADPGRTEPMRLCPNGLNFVIADDRMMNKIRYNEVIRSGGL
FT                   QEELGCSHEVVFKSGYMKWLYDYDRAIQDGPSTIQQTSILSII"
FT   CDS_pept        481109..>482164
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113549"
FT                   /orf_name="An14g01900"
FT                   /product="Remark: ORF truncated C-terminally due to end of
FT                   contig."
FT                   /protein_id="CAK46502.1"
FT                   /db_xref="UniParc:UPI0000EFC893"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T6"
FT                   /transl_table=1
FT                   /translation="MSEGRRSNESSSSSLISYHSVERPNADSDAEKRHDLTPDSDSSPS
FT                   GPRTHRVHFGADRRFEYGDWDTDERVLSPGTSRLRRRSSTQASVDITDSSHRGPPSTST
FT                   NGRDEENEKKQQHTTTTEKRSRRERLKAFKDSIKEKAANLAARLGRPDDINEDDLQPID
FT                   HRRRNTEPDLYLREEDQNQTCSTEAHRIVRELAHEASGRRPSARRDSALHRAAGVSAQD
FT                   DDSGNEAIPRRSSGSGGVLSQLLRLSGGWDQFQKGARGLHLASDTFYPFGGSTPGTTTP
FT                   RKEKVRWYKKHGNVSASTLVGGGSASGASTPVTGELLSAASRRRDKSRRHSMRLEEEIQ
FT                   VTLQIAEIIARQ"
FT   gap             482215..482314
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(492865..493498),complement(492161..492802),
FT                   complement(491425..492090),complement(489289..491392),
FT                   complement(489029..489228),complement(486778..488983),
FT                   complement(486021..486718),complement(484783..485959),
FT                   complement(484038..484732),complement(<482315..483978))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162255" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962544"
FT                   /orf_name="An14g01910"
FT                   /function="acyl carrier activity"
FT                   /function="binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAK41928.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG333356"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI0000EFC8C1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T7"
FT                   /transl_table=1
FT                   /translation="MNVPNEPIAIVGSACRFPGGCDTPSKLWEMLKQQRDVIKKIPKDR
FT                   FNTDALYHPEPTHHGTSNAQYSYLLEQDIGEFDANFFNIHPKEAECIDPQQRVLLETVY
FT                   DGISAAGLPMEKMRGSDTAVYVGQMCDDWAGILQHQVDEAPPYTGTGTSRSIMANRVSY
FT                   FFDWHGPCMNIDTACSSSLVAVHEAVQTLRSGHSAVAVAAGVNFLIHPMYYVSESNLRM
FT                   LSTSGRCRMWDASGDGYGRGEGIACVVLKTLSQAQKDNDHIECIIRETGVNQDGRTSGI
FT                   TMPSNIAQAQLIRDTYRRAGLDVRNPLDQPQFFHAHGTGTKAGDPQEATAIYRAFFTKE
FT                   TEPEQKLLVGSIKTHIGHTEGAAGLASVISTSLALQHGEIFPNMHFNELNPDILPYYGA
FT                   FEVPTSVQEWPALKPGQVRRASVNSFGFGGTNTHAILEAYIPSEPTHSEPPRSSTLYTP
FT                   LLFSASSADSLREMITKHLDYLVENPETSLRDLAWTLQHHRSTLPFRKAITGSNYEKIV
FT                   AQMHSVVSAEPADLKTRFAQYSEPRILAVFTGQGAQWPQMGARLLQSSSFVRDKIAFLD
FT                   ECLATLPEDDRPDWALSDQILAAGKFSRVTEAAISQPLCTAVQIVLVDLLQAAGIKIGA
FT                   VVGHSSGKFPYLHTGEIGAAYAAGFLSACDAIRVAYLRGVCAKLAASPSGSKGSMAAIG
FT                   ASAEEAHDLCNSEKMKDRITVAALNSGSSVTLSGDEDAINAAVDIFSRQGKFARRLRVD
FT                   TAYHSAHMQPCVDPYLKAMERCGVSVQQPLGDRPTWFSSVYPNTAMSADTLTTEYWVHN
FT                   MVQAVLFSPALITAAKGGQPFDMGIEVGPHPALKGPALDSLGQIDMQIPYTGLFARGED
FT                   DVDELSAAMGFLWTQLGSGVVNFDGLERALNSDKEPKKLLVNLPSYPFDHQNRYWAECR
FT                   TWRADRLSGKPPNPLLGSVLATTRSSSNAQWKNILKPTEIPWLQGHRLQNQLILPATAY
FT                   IVMALEAITAVAGDAAIALFRMTDVLLRRAIVFNDDNSSVECISSLRILESNESRIRAK
FT                   FTVESASQGDLSLRLNVESFIEVELGGSIPDKLPLLEHDRYYNINEQNAERFYSEMQMI
FT                   GYHYSPPFRGISSIHRRLNFAHGTLIDQSGDAWEDQLILHPGMLDTAVQTIIVAYSAPQ
FT                   DGRLWSLHVPTRIASIEFNPHFVFSRTSKQELIRWESNVADQAASVIEGSFHLLTQDRK
FT                   HSFLQAEGIVLSPFSPAQAQDDNQLLGHMEWQPAIPNADIEAAEASSALDSSVTRDVER
FT                   MALYYLRKMCETSTEKHRNNALPHHQQLLRWASSTLDRVSAGKHPFIAKEWISDSEQQI
FT                   QQLTRYHHDSVEARLVAEIGSSLPYVVQEQGVLAHYISIDEEAPTIKMVHERLANLVKQ
FT                   INHRYAHMNILEIGSGTGAVAEIIVPSLGTSFSSYTFTDVSDDLFSEAEFRFGQYADRM
FT                   VFRTLDIQQDLAAQGFIAGKYDLVLIGNNLQMAQDQEKALSNIRQLLKPGGYLIGASPI
FT                   TDDSLRLGVFMSDCPEWWAGADAGRMTLDSWGSLLRQCQFAGIDTCTPIQDALHDVPVW
FT                   AAQAVDERVRLLRDPLAASQEFPEEMPHLVIIGGKSMATVQLIEQISALLSTKYSNVTR
FT                   FPSLEALNRDSVPPKATVLSLADLDGPVMKSWTSDKLEALKALWDQAAKVLWVTKGAYS
FT                   SEPYSTMIAGIARVVRAEKIELNVQLLDIAFLDQRTASLVSETLLRHHYLLTWSPENST
FT                   EKLLWSSENEVAFDGQQMLIPRVRINETENLRMNSARRSIVHEVDPSTAALRLASSGES
FT                   YQLEEVSSLRVAPTLPTIRVRQSLLQFLKLGSNGSFMLCIGTKQDDSQATVLAVTQTAE
FT                   SLAPVEPGWTIEIPTSLDIAHLALVTVATYIVSQQILAMVPYNGALVVHEPDKFLYAAL
FT                   SDAAEKSRINVWFTTCQPGRDSNWTYLHPALPARLVKERLPSEVSAFINFESPKGPGSR
FT                   VAEAIAGCMPPHGVQASATTLFTNQLYTRSGADPTVLSKLLHDTWQIASSSSLAFELNE
FT                   PIPLGEVSCHNPVEEAIQLVDWDVPVVPVHLRQIDNDPIFRRDRTYLMIGLTGEVGQSL
FT                   CHWMARKGAGFIVLASRNPKVTPAFLQKAEDLGATVRSLSLDITSRNSLQRCLREIRRS
FT                   MPPIAGVANGAMIMEDVLFDDLEFESMERSMKPKVLGSKLLDEAFYDTPLDFFIMFSSV
FT                   AGVVGNTGQGTYAAANMYMAGLVLKRRKRGVVGSAIAYSPLMGLGYINRTDETMGDKFR
FT                   SMGISLLSETDFHYAFAEAIKEGQAKCHDRAELITGCSPMVLADVVRGRIRSDIRFSHL
FT                   NLERTTGKAGSGSGANSSVKAQLQQASSLEEVQDIILGSFTARLKSLLRMSTEQSLDVN
FT                   SSLVDQGIDSLVAIDIREWFGRELEVDMPVIRILGGSSIAVLIEDSLQYIPKTVLDLNS
FT                   LSGEGQNEPVEQMSPAASATEPQKKPAATLDSLDAEPSTSFSDHKDSGSSSSDSESVDT
FT                   PSNYGTSDTEPDEENTYEPLIDIDLRQSTIQSATEKIAPMSFNQARFWFMQHALQDPSA
FT                   LNMAHCWHVEGSLDLPRLRKAVTTVGDRHEAMRTRFFWGGENHNVPMQGILSRCIVQLE
FT                   IKGIANKEEVYRELDAMRHHTYDLNDWQLVRTRLLTLSDKEHYMIIGNHQITFDGNSAS
FT                   LLLNEMNEAYLGQSLPMLSKASQYSSFAEKQLQHYSQGYFQEHVDYFKSIIHEDNPPLE
FT                   LFSFATAKSRPVRSQYRTHRSDMLLSPKQTSLLNQVSQKIQSKTFDIYTAVLGVLLFRL
FT                   LPNIKHVLIGIDANRSDLSWDKPMGCVLNTLPIRLDRPETNTKLGPFLGKVRDAINGVL
FT                   EHSSVPFDVLVNELKLDRSANCSPVFQVMIQHRIESQDRVTWCNATRSRGKSLKPCTGF
FT                   DLHLEIVENAEGNSVVSLEMQQGLYSQEHTDLLVKTYVNLLEQLTTIPEAPLETAELWS
FT                   SEVTSMALRVATGPVAPMRWPQTVVHRIDQMVQLYGSKPALKDGSGKILTYNDMGRRVD
FT                   SIIAALRQAGAPKCSVIAAMQEPSVDSICSMLAVFRAGAVYMPLNTRLSTEQIKCTLQS
FT                   HKPVLLLVDQATSNTAMSLQDLKPKVLNVSSVPTRRQIQRAPNLADGNSAAAVLFTGGS
FT                   ASEPKGVLVNHASMIAQLEASSMQYNFSDERPLIALQHSDHSIGLSLTQAFDALCNGGS
FT                   LVILSADRQGDPIEIAKTVREENISYTLATPSEYQSWLSIAAGELLKCPHWTLAAMAGG
FT                   EVSHKLLQSFRSLESASLQLLNLYISPGMCFGSTWQGRIEYRKSVLELPLAAGYPSPNQ
FT                   AIYIVDTKLRPLPIGVPGEVIIGGAGVTSGYVNPDAATKGKFIESPFSHLDTNFTTNKW
FT                   TSVYRTGDYGYLRKDGSLVLVGRSNSDTHVNVRGFQVEPAEIENALVEAAGGLLADAVV
FT                   TLREHDEDQFLAAHVVFTSQVIPSDSEEFLDNLRMRLPVPEYMVPSAIVPLAKLPLNAH
FT                   SEVDRLAIHQLPIDESNVVTWSSREMTPMEASLAEI"
FT   CDS_pept        join(493735..493860,494073..494096)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887470"
FT                   /orf_name="An14g01920"
FT                   /protein_id="CAK41929.1"
FT                   /db_xref="UniParc:UPI0000EFC8C2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T8"
FT                   /transl_table=1
FT                   /translation="MLLGLQALLLPFFFFFFFCFFLPHVMYLIRYTEYFLVFSYARSLP
FT                   QAQG"
FT   sig_peptide     493735..493797
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T8 "
FT   mat_peptide     join(493798..493860,494073..494093)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T8 "
FT   CDS_pept        join(495055..495061,495212..495324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887471"
FT                   /orf_name="An14g01930"
FT                   /protein_id="CAK41930.1"
FT                   /db_xref="UniParc:UPI0000EFC8C3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2T9"
FT                   /transl_table=1
FT                   /translation="MFSVPSLTFVGDDEVNHRTELNVSVDIKSKLLPNRIGDY"
FT   CDS_pept        join(495907..496030,496125..497074)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113550"
FT                   /orf_name="An14g01940"
FT                   /EC_number="1.3.1.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41931.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG447528"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC8C4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2U0"
FT                   /transl_table=1
FT                   /translation="MVGISQGQLAVVTQGPRKAALVTNRSIPRLRDDYILVRTVTVALN
FT                   PTDWRHIDFVPSNGCIVGCDFAGIVEEIGPKVTKYQKGDRVLGLTHGCNAVEPEDGAFA
FT                   QYIMVKGNGQLKIPDGMSWEDACTVGVGYTTVGQSLYQNLGLPVPGKPRSPTTPKTVLI
FT                   HGGSTATGTLAIQCAKLSGMEVITTCSASNFELVKGLGADAVFDYTKPNAAAAIRKYTR
FT                   DNLKLCFDTVAMASSAQFCAEALTSRSGARYHTLQELRCPRRDVRSTVSMAYTVVGEPY
FT                   TMGPQKVPAKPIDMKHHLLWQSVFQDLLDQGKIKTHPVSKQPYGLKGVLSGLDLLRENK
FT                   VRGQKLVYRVDETPHQF"
FT   CDS_pept        join(497992..498022,498083..499434)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887472"
FT                   /orf_name="An14g01950"
FT                   /function="alcohol O-acetyltransferase activity "
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAK41932.1"
FT                   /db_xref="GO:0004026"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="HOGENOM:HBG327419"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniParc:UPI0000EFC8C5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2U1"
FT                   /transl_table=1
FT                   /translation="MDKLERLRPAGHLEKFFLARGLAGHSNVAVSATYVLPNTFTRPLK
FT                   EYAYRACETVITKNPILSAIPVKDSHDTWFFRLPGIDLTQSVSFQRRGHDYPTEDQPDI
FT                   ELCNLLQVQQKSEFTAPLPFWRLIILTEPTERRFTAVYIFHHAIGDGISGKAFHETFRE
FT                   ALHDAAAYLAQGGITRQVIPSPKVPLLPSLEALHPCSISFTFLLKKVLQIKLWPYRDPG
FT                   LWTGPKSYTPVDIEIRQIVISETISTTLRKKCRQNHATITSALHTAVARSLLAHLPEEY
FT                   TRLQAIGAMSTRRWLKEEGGVTDQSMGVWVMDFKESFFREEMDQHPPDSFLWGVARKSC
FT                   TTIKEVLSRKGKDSSVGLLRYLDGHGFIRGKIGKDRDGSFKASNLGVLEAGQERVSWPQ
FT                   IGRMMFAQPFDGVSAPLAVSSITGGDGCLVVTITWQKGLADSTMFDGVVDMIARELRHA
FT                   AR"
FT   CDS_pept        join(complement(502209..502302),complement(501989..502142),
FT                   complement(501637..501931),complement(499914..501575))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113551"
FT                   /orf_name="An14g01960"
FT                   /protein_id="CAK41933.1"
FT                   /db_xref="HOGENOM:HBG327420"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniParc:UPI0000EFC8C6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2U2"
FT                   /transl_table=1
FT                   /translation="MGLFAGHGALDQAELDNFGVDWVIHYSFEDVELSQAIQEFRTLIH
FT                   DLQEAHLQVQVRHGYGASLLVCIRVPPDLLGNLVHKSRVKDWLHGIIHEFPEGGDEGET
FT                   DADTPAEALRSVYHAVTWQKHLGGAGITPKVGQWKNITAAIPLHDRSANAELLRKWSRT
FT                   IFLTAEDLDAIRALYGEKVAFYFAFIHCYSCFLIFPAVWGIFSWFYLGPYSITCAVVTC
FT                   IWGIVFIEYWKTRELDLSLRWNVKDVGFLKVNRPEWVWDREFQNPHTGETIRVFSAHRQ
FT                   FARQLLMIPFATVASLALGSLIILSFALEILVSEVYNGPMKAYLEFLPTVLFSLSLPSI
FT                   TNILTEFAKRLTDYENYRTQDQYDLAQTAKTFVMHFITAFLPTLLTAFVYVPFGSRIAP
FT                   YLDTLRSYGLLSANLAREIHIDTSRLQQEVIYLSATAQILNFGEEIVLPYVKQTLMHKW
FT                   RDWREGRDSSRPRGYSQRTDQLLVDAPEEAGFLSRVRDEIDADEYDVHEDILEMCVQFG
FT                   SLALFGVAWPLVSLGFLANNWLELRGDFFKLSLECQRPAPIRADSIGPSLLGLEVLSWL
FT                   GTLSTAAIVYLYRAGLQEVNMSSLLLTLLLAEWAYVGVRFIVRSGLERISFISLRREES
FT                   KRYAMRKRFLEATSGRVSPRAKPRVRFQDRVSVFSSSTDVPGTKEDFLHPGHHHEMGRG
FT                   GRFWSWAPNETADAGVRLIKALNTNMDGSKTGPVKGAKGA"
FT   CDS_pept        join(complement(505899..506618),complement(505283..505840))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887473"
FT                   /orf_name="An14g01970"
FT                   /product="Function: aflR of A. parasiticus is a
FT                   transcription factor"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK41934.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG326851"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI0000EFC8C7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2U3"
FT                   /transl_table=1
FT                   /translation="MRSSQSKRRQQPPPRKKACQSCTKSKVRCDLDRPACSRCRSLGRT
FT                   CEYLTHPPVTSPLSEPNYTSPTDTTDREPVLPIYSTPQIAPISELPIPLPYTFSSPAWT
FT                   PPHPPRRLVADSVRGESNELDFTGIELVPSVNAESIRDRWLRPYILPPLGRDEVPKAYH
FT                   PFTLQYISRILSTYPRFMLKDGDVPPIIHRMQIVGRRMPRALANCYSLVRMWEQAAEGS
FT                   ETLVVETVEKEMDRLASEEPPSLDDFDLLAIFQAYLIYSVMLYFSPIAGANAVNDKIMI
FT                   TLMELAFRTARNGLFCTAEMSHTRPSWESWIVAAAKRRSLFTMYLFCSVYNADRLLPNF
FT                   IADEMTGVFAPEAKALWEATSRETWAKEYDRHLLNWEDGMLEISELWRSAETGTPRRRE
FT                   RIERWLRTVDEFGMTMFGVTAHVHGC"
FT   CDS_pept        506849..507649
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000252117" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113552"
FT                   /orf_name="An14g01980"
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAK41935.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG398028"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0000EFC8C8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2U4"
FT                   /transl_table=1
FT                   /translation="MTTYTTDHAQAVLQTHGWRTISNSVPYVLPYLKPNMTILDIGCGP
FT                   GSITVDFARHVPEGHVTGVEYVSDPLDQARNLASSQGITNITFQVADIHSLPFADNTFD
FT                   LVHVHQVLQHIADPVLALREMRRVAKPDGGIIAARESSAMTWYPENKGIELWLDIATKM
FT                   AREKGGNPHPGSKIHVWAEEAGFPQERIKKTAGSWCFSSPEERRYWGGSMAGRAANSGF
FT                   AAQAVEGGFATREQLDGIVKGWEEFMECEQGWFGLLHGEIVCWK"
FT   CDS_pept        join(complement(508738..509407),complement(508505..508656))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171381" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113553"
FT                   /orf_name="An14g01990"
FT                   /product="Remark: a splice site was detected upstream of
FT                   the START codon"
FT                   /protein_id="CAK41936.1"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI0000EFC8C9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2U5"
FT                   /transl_table=1
FT                   /translation="MSYYPPPQEPYYGGRPPYERPPYDRPPYEGGPPPERPPYDRPPYE
FT                   GSYERPPYDRPPPERYNSGPPPPERPPYDRPPYGDRSPYEGGERGFDSPAPRPPYTSPP
FT                   PSARPPPVPPPPLPMDWAQEWEPSVRRAYYVHIPSGRTEWELPADMSRDMPPPGPPPAG
FT                   GPGYYGSPPPPQEGGYYPDPQAQQISEEEQKKKDRKNMLLGGAAGVAIGALGAAFVSHE
FT                   IHEHEEKEEEEEREEQQSYDYDRPPVVYERETTIIERGEEPAYENYDEDGW"
FT   CDS_pept        join(complement(510529..510862),complement(510353..510435))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887474"
FT                   /orf_name="An14g02000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41937.1"
FT                   /db_xref="UniParc:UPI0000EFC8CA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2U6"
FT                   /transl_table=1
FT                   /translation="MIPCKSRSDARYLTHRLPSQIDFLAQDSAVGNEALILSSHAVHTV
FT                   STLLAQRCQDRSDCDDCIRNAQRQMWLSLSLLPRTEYEVVYYYDSGLYSHSVRHTWLLQ
FT                   SGAIGGAGNFLFFCRMLSSTIGKRVKCGYAYPER"
FT   CDS_pept        join(complement(513900..513903),complement(513285..513753),
FT                   complement(513148..513166),complement(512988..513095),
FT                   complement(512861..512932),complement(512733..512810),
FT                   complement(512551..512680),complement(511513..511767),
FT                   complement(511275..511461),complement(511157..511220))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000083011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887475"
FT                   /orf_name="An14g02010"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK41938.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG738140"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI0000EFC8CB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2U7"
FT                   /transl_table=1
FT                   /translation="MHRIHSWAKAHASTPNTQSQGQNQSNSQSSEDASAQDAQVKEGIR
FT                   DPACPESEKDANQTPERGMFVRMKDGIVRFTGHTKRALCHSWVNVLLVFVPVGIAVEAA
FT                   GLNPGLIFAMNAIAIIPLAGLLSHATECVASRLGDTVGALINVTFGNAVELIIFSIALV
FT                   KNEIRIVQASLLGSILANLLLILGMAFLLGGLRFQEQIYNSTVTQMSACLLSLSVMSLL
FT                   LPTAFHASWSDSGDADKYTLKVSRGTSVVLLLVYVLYIIFQLKSHAYLYASIPQQIIDE
FT                   ESHPGVLAEFMNKPEMSRTAAVVMLLVSTGLVAVCAEFLVDAIPTMIESSSVSEAFIGL
FT                   IILPIVGNAAEHVTAVSVATKNKMDLAIGVSVGSSIQIAIFVTPLVVILGWCMDKDMSL
FT                   YFTLFETICLFVTAFVVNFLVLDGRSNYLEGSLLIAAYVIIGVAAFYYPGSGQSSDLGT
FT                   AGG"
FT   CDS_pept        join(514613..514830,515091..515192,515302..515443,
FT                   515528..515563,515678..515992)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887476"
FT                   /orf_name="An14g02020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41939.1"
FT                   /db_xref="UniParc:UPI0000EFC8F7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2U8"
FT                   /transl_table=1
FT                   /translation="MEFSTSGPRIHRGKSQRISPFPESVHEMHTYDINSGASETRVKGV
FT                   NGSDKIIRFCDSISGAVACRGKGEKRPPSQPRFGSISPDSGIPYPYFTGILCGLFVVAL
FT                   GNAISLTRPPWPLSAVPYNPLTHDLDHGLVIPIRLRSSVAEPKLMAVPWTITVADCVSG
FT                   LAHEDACPDVIASDRLGQWVGAQRIVTTTRAHMRGDVLAYAGTFRGMMCPSTRHHVALE
FT                   KCQPTTRTPALCIENWLYRRIGALSWRDHHSSSMKDCDDSHSVFGSRA"
FT   CDS_pept        join(516645..516694,516753..516854,516908..517192,
FT                   517245..518892,518945..519016,519100..519911,5
FT                   19993..520095)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171370" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113554"
FT                   /orf_name="An14g02030"
FT                   /protein_id="CAK41940.1"
FT                   /db_xref="InterPro:IPR018820"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="UniParc:UPI0000EFC8F8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2U9"
FT                   /transl_table=1
FT                   /translation="MAPSRSAGGGRMVKLLSILNPLTWRQRLDLDARSFLIMLKGALPP
FT                   TIVIAIYQSSAISDITLTIGYLSALISVLSQALTPRAKFMRIMFFDLLSTCVSASLCCL
FT                   AIFCAVRARQHNTPPDASEAVRNGFSSDACAVSAIWLIFMIWAANTVRAWRPQELQDPM
FT                   VAFSIFSSVTITRGGMFTTLSEGLSFVSRLLKGFMLGFAIATGVSLLILPITSRGHVFD
FT                   DIRGYVAQIDNVLQSQIDFVKGTSEVWTGNQGLLKRTRTARSMRDMQNSPISDLEAKQK
FT                   RLTASITKLNGLHGKLQSDLLYSKDEIAWGKLSAGDLSRIGGLLRGILLPLSGMAMLPE
FT                   VLDMIIRNEGTRNSSLRSVDAEEDSLKQTEMQKVAQTLQGRLVDSSRLVTVGLQYVLLA
FT                   LGLSKRKKIEKQYSGKTDEEGTGELLTPLEPEFAQRFEQEMRNYFSRRRDLTRNLASLE
FT                   AFTVSEKPDNATSQEDLAAIATDPDVRQEFFLILFMGHLQDNLLTATLDLIRFADDRIQ
FT                   DGTMKRSRLILPRLSTIRRWLSLETEHDTKSGPDRRQSSHVDPSSAFGQTEANNFPDPE
FT                   HLPPANWFEKGSLALRYLSHIISSEQSIFGFRVAAAAFSVGILAYLRKTQDFFVHQRCI
FT                   WAMIVIVIGMNPTSGQTMFGFIARIAATAVSLVLSLIVWYIVDQKTPGVIVFLYLANVF
FT                   EYYFYVKVPQYFGASVIAIVTLNVIVRKLGIEVATSNGQPYYPIYLFGPYKLAAVAAGC
FT                   AISFFWVIFPYPITAKSTLRKTLGRGLFVLAKFYSCMHTTIELWLTGELGTTEDDVRSA
FT                   SATLQRSRHKVFKEEMLLLNSLRMHSHFSSFEPPIGGKFPRATYDQIIGQIQRMLTSMA
FT                   LMAHTTQNMDALSAITDDTNNNNNNKWISRLASIALQSSGFKSHKITSLLCHLSASVLN
FT                   SQPLPPYLETGDTFPLARELQRIDEELLSIRHVEDPAFSAFVCLEVLRSVVSFTLDDLL
FT                   RNVKSLVGELSFDLHVRDAAESQRLMSGPETQED"
FT   CDS_pept        complement(520364..>521158)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887477"
FT                   /orf_name="An14g02040"
FT                   /product="Similarity to the N-terminal region of A. oryzae
FT                   mreA"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAK41941.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="UniParc:UPI0000EFC8F9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V0"
FT                   /transl_table=1
FT                   /translation="DSGITGTIMAATGESASTYTGLDEVLPGPAVIISLIAYNSTVQAM
FT                   NTTLHNLSTQLTNHTTQINTTLTPPTSYSYWSYIKPNFLASQSAGASSLFTSRLLGKSE
FT                   LSSLPQPDLIHYLQQISASQSGDGTLLIFGLQGGRGTANVPEQRRGSVLSSWRSAYAHV
FT                   MAYGGSVNDTGDPAASLAEAAEWYESVLEPVWRDWAPNMGAYMNEGNPFSSTWKRDYYG
FT                   DGYERLAEVKRRYDPNGSLWVYAGVGSDLWEFDLRSGLLCRV"
FT   gap             521159..521258
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(<521322..521632)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213025" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962545"
FT                   /orf_name="An14g02050"
FT                   /product="Similarity to the C-terminal region of A. oryzae
FT                   mreA"
FT                   /protein_id="CAK41942.1"
FT                   /db_xref="UniParc:UPI0000EFC8FA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V1"
FT                   /transl_table=1
FT                   /translation="MLPKLASLIALPALAAANCKTAPGDAAWPSIEEWSALNQSIGGSL
FT                   IRTSPAASSCYAGNPLSSPYNCSSVKDHWSYAAYHAAWPESNDYSIYNNNSCVPPGVSG
FT                   "
FT   sig_peptide     complement(521576..521632)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V1 "
FT   CDS_pept        join(522251..523431,523521..523564,523804..523970)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171403" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962546"
FT                   /orf_name="An14g02060"
FT                   /product="Catalytic activity: trans "
FT                   /EC_number="4.2.3.9"
FT                   /function="aristolochene synthase activity"
FT                   /function="magnesium ion binding"
FT                   /protein_id="CAK41943.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0045483"
FT                   /db_xref="InterPro:IPR005630"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI0000EFC8FB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V2"
FT                   /transl_table=1
FT                   /translation="MSILSTSRAFLCHPRLLRPVSLLRILSSNTPQCRRLTQTLQLGDS
FT                   NPIYYPRPISYAFDPATPANQSDPIPQTFSFLHSPNLTQTSEYQHSIRLNPQDLKVPWP
FT                   TSLPCALQSQYWREAEDAASDFLQTLFASNNNPKGDKYLTAVTDAVVSYAINLIPLCGL
FT                   ARIKLLSRTFVLAFLHDDAVDAGNVSDNNVLIPIERNSPTPHKAFDILSEEILAADPIN
FT                   GAILVEDILSWGSTSRNHQQGPTHFNSLDEYIAYGLEDFGATLILRCVEFSITTPCSSS
FT                   SPTDLQSVSYLKSLCAKHLLLTNDLYSYAKEVASGDAGLNAVRVVQDLMGVSDSSAKMM
FT                   IRFMLRDLERQMDEEYTRLLTSSSMNVNEVQLKHARAMIIAVAGNMFFSATCDRQYTLQ
FT                   LSMTIPSHTGATGRDSRQPHIYDNINNYRIPGLSSSCLMYARSDFSMQAKSGIKPQPRQ
FT                   VPLRP"
FT   CDS_pept        join(complement(525693..525928),complement(525565..525601),
FT                   complement(525503..525508),complement(525090..525244),
FT                   complement(524950..525043),complement(524846..524905),
FT                   complement(524562..524798),complement(524173..524499))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809343"
FT                   /orf_name="An14g02070"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK41944.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG324032"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI0000EFC8FC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V3"
FT                   /transl_table=1
FT                   /translation="MRLSPIYALSWALQASATILQNGQVREDPYPGQAKAISLDDGSWR
FT                   TYQPDASEIAYKGRWDSKYVSCEPSRADYIIWVLLPGIKLGFTGEQLASQTGAMDKFID
FT                   PSSRCLLTFRTVQLAGVSVASDSQLVTVPQYNKTVEIIGDSFASGQYGTYEGLSSWAYN
FT                   YAAGLGDVEYSITAYPGICLTDEQCYADKARGMTHQWFYASDAGVRANATYGNQPEKWD
FT                   FSAHRAADLVIIDLGTNDHRAVNDIPGSTFYDSYVELVTSVHETWPDAQIVIMSLWGNF
FT                   TRSGDTYVQSPFYVSEIQRVAEHFQDDGFVYYFDTKGVLQHNDIDPQEHPTDVGHIKVA
FT                   SHLMQWTKLKLGWEFGATGPEVQHDTLYWNNEDSYRRSFTGSY"
FT   mat_peptide     join(complement(525693..525877),complement(525565..525601),
FT                   complement(525503..525508),complement(525090..525244),
FT                   complement(524950..525043),complement(524846..524905),
FT                   complement(524562..524798),complement(524176..524499))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V3 "
FT   sig_peptide     complement(525878..525928)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V3 "
FT   CDS_pept        527489..528931
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000148525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656689"
FT                   /orf_name="An14g02080"
FT                   /product="Catalytic activity: prolidase of A.
FT                   esteraromaticum hydrolysis Xaa-|-Pro dipeptides. "
FT                   /EC_number="3.4.13.9"
FT                   /function="dipeptidase activity"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="CAK41945.1"
FT                   /db_xref="GO:0016805"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG705868"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI0000EFC8FD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V4"
FT                   /transl_table=1
FT                   /translation="MVRRIASATPMVQSPMSPLGTTYCVRPNPVSLNLQRRPLVIASTD
FT                   EAKVTIIYAGLLIPGDGEPLRNAALVISDKIIAFVGSEADIPKKYLRSTQSTHRVPVLM
FT                   PGLWDCHMHFGGDDDYYNDYTSGLATHPASSGARLARGCWEALQNGYTSYRDLAGYGCE
FT                   VAKAINDGTIVGPNVYSSGAALSQTAGHGDIFALPAGEVLGSYGVMNPRPGYWGAGPLC
FT                   IADGVEEVRRAVRLQIRRGAKVIKVMASGGVMSRDDNPNFAQFSPEELKVIVEEAARQN
FT                   RIVSAHVHGKAGIMAAIKAGCKSLEHVSYADEEVWELMKEKGILYVATRSVIEIFLASN
FT                   GEGLVKESWAKLQALADSHLKAYQGAIKAGVTIALGTDTAPGGPTALELQFAVERGGMT
FT                   PLEAIKAATANAPLSVGPQAPLTGQLREGYEADVIALEENPLEDIKVFQEPKAVTHVWK
FT                   GGKLFKGPGIGPWGEDARNPFL"
FT   CDS_pept        join(complement(529974..530247),complement(529832..529915),
FT                   complement(529598..529764))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113555"
FT                   /orf_name="An14g02090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41946.1"
FT                   /db_xref="UniParc:UPI0000EFC8FE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V5"
FT                   /transl_table=1
FT                   /translation="MARKFPVDSAGPDIVRDYIIQTLIRKHEATPEYAEKLATCWQLGR
FT                   VRELRSATLKHLQDDFGNDVGLCIYRAIREDMLEDWQETTAAAVTIWSVSTATMIHLVV
FT                   VGLFILPELGLMQPCERIRVAKSPASWLLFGFAYLNYHYQRQDIEEPGHISLAGPIGLL
FT                   SISVGLYLFSV"
FT   CDS_pept        complement(531875..532741)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171414" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809344"
FT                   /orf_name="An14g02100"
FT                   /protein_id="CAK41947.1"
FT                   /db_xref="HOGENOM:HBG331717"
FT                   /db_xref="InterPro:IPR021054"
FT                   /db_xref="UniParc:UPI0000EFC8FF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V6"
FT                   /transl_table=1
FT                   /translation="MKFTAALFTLLATSVMANPTKVAREPTLVERDAASITSVLSDINT
FT                   QVQALDSAINSYSGGDPSKVESASSSLVSEINSGVSTVNGGSELSATDALTITGPVQDL
FT                   TKEVQTTIDDLISKKSDFVSAGAGATVYSQLQKQYTASKNLADAITSKVPSSLSSIASS
FT                   LSSGITDAIQKGVDAYKDVATSSASSSSEASSATSAASTADATTDATTAATTAASTTES
FT                   SAASTSSSPVIPSSPNSSASASATPSSSASASASASPSLYTGAANVERFSYTLGGAAVA
FT                   AAIAIAV"
FT   mat_peptide     complement(531878..532690)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V6 "
FT   sig_peptide     complement(532691..532741)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V6 "
FT   CDS_pept        join(534583..534628,534740..534972)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887478"
FT                   /orf_name="An14g02110"
FT                   /protein_id="CAK41948.1"
FT                   /db_xref="UniParc:UPI0000EFC900"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V7"
FT                   /transl_table=1
FT                   /translation="MMAMSHPGQLGWLISVYLEQVYYSTHSFVVDKHQGKKACAPAQWP
FT                   QTARLQDTAAFNLPQGSDSSDVLAVTQCWSLLHDSHNHTALTAVVIV"
FT   CDS_pept        join(536345..536361,537002..537030,537101..537219,
FT                   537348..537485,537539..537562)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887479"
FT                   /orf_name="An14g02120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41949.1"
FT                   /db_xref="UniParc:UPI0000EFC901"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V8"
FT                   /transl_table=1
FT                   /translation="MLSNSWLLEIHQESHIQLQAYWELNTIIKKVGYYTVTTYSGSMLD
FT                   ARRRRLVNGLPLLILNSKSLKYKPCTSMYCKDEIFVNVYLTSDYKLNKKTNSSNTRSSD
FT                   PQWR"
FT   CDS_pept        join(537833..538086,538141..539452,539885..540111,
FT                   540172..540422,540558..541429,541553..541615,
FT                   541670..541727,541786..542187,542393..542547,
FT                   542600..542661,542708..543998,544055..544222)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962547"
FT                   /orf_name="An14g02130"
FT                   /protein_id="CAK41950.1"
FT                   /db_xref="UniParc:UPI0000EFC902"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2V9"
FT                   /transl_table=1
FT                   /translation="MAGAKETSNTPQRGRRASKGCRTTGPVAAGGNNGLAGKENTLPHN
FT                   NTGKRSQKGKSRGRGRDNIVRPEPADRDSRAGKTSRSGYRPLPGTSRVSSSEAPASDEL
FT                   SAAQMQVFLEAGLAMIDESPDTRRTFIESLATESGLRKVRQIVETDFAISYSVLKPMFD
FT                   PHCILFFQLVSHNEVLSSLILEKAVGTIYNVIYGPGGRRAIGFFTKVTDYLTQFKSDGR
FT                   SPAVVKHVATPSEVLSLVSRVLLGTLTLNHEAAIQVDLKKIADKLYDCCHADNADARAG
FT                   DDNLQLAYENILKIQEIFSMGDSIPMSQKPDQVQKIKSNQQDSTRYIVDLPGELSDHGP
FT                   RHDNDKTAISDIQILPTKSEILNADRPEFLPARCATGSANMHHEWGIRRLLDSQFRLLR
FT                   EDTSGVLREGIRLIIHAWELIVHGTDWRLKRKFLRDKMPTPVRVYSGVEIRQIKSEQFK
FT                   GIEVNLEFDQLPRLKNVSPAKRKQWWFDSKALKKGPTLLALLDAEDVDDTSAIYLLVSK
FT                   RETSYILSMSLSHDPRMLSADLSRATDLDEGQANAFIWALRRKIALIQGPPGTGKSYVG
FT                   LQLARCLLHNKDVLDLGPILCVCYTAHALDQFLDGLLRSSVTNIIRIGPRSASPHIERL
FT                   SLDMRKQEPGPRIKGLPRLKDESRVKLLSISSRIDELLKQAQSGCHTNIERSIDRLLQE
FT                   DVWTLKASERTRLLNYWQEAALAEISQQVLTLLEAHSAEKERYTSAFSLSDVQRLNNCQ
FT                   VVGVTTTQLANNAELLRNLNAKVLICEEAAEVLESHVLTALIPSIQHAILIGDHLQLRP
FT                   RISNLRLSMDYERENPKYNLDESLFERLANFRFGESTSSGTGGQNQQEYSFPVMQLSHQ
FT                   RRMHPSISELVRETLYPKLQDHPTMTSYPLVPGIARRLFWLDHCNVEDPTDPTEPMQSK
FT                   TNTWEIGMVTALVRHLCQQGKYGPGEIAVLTPYVGQLRMLRNRAPQKGSLLDAIRLATV
FT                   DNFQGEEASVVIVSLVRSNRPRNFVSSTRWMMDDADCISSRAKHGMYIIGDASTASTAP
FT                   MWSSVIHLLEKGANIGPKLELRCDRHPSNGFYVNCPNDFTIHAPEGGCAEKCGLRLDCG
FT                   HTCPVKCHSERQHKAVKCMELCTRMKSCGHACPKKCHEQSQCLADIPVGGYAGSVDTQR
FT                   AIPTTSIMAIAEAHAAGDSQLARTAVAKHVIRPLCKDLQRIVPSMRRDMRMGLNIPCDL
FT                   RCKKKLTSCGHQCPGLCGERCPDSRLCRICGGPDILEQNVDLIELKPYKDINVDEDPLV
FT                   FLSCGHFYTASSLDGIMGMSEHYEVEPSTGRILGPKLNHRLFDSGRPKGCPQCRAPLRD
FT                   IDRYNRIIKQAFLDEATKKFATHASIKFGHLVEEVEGYEKDIIGEKSKFVSDWYQETVE
FT                   TRSADDVRRSVDVYRGRGNRILNKIKEFTKSVAKSEQPFGRVSEMLASVAARKAGTSAT
FT                   PFQYNESDIQTGFQSRGHVLALRLTWVLFWNYDSIYSNKRIDPRIKVTLAQVVAKQIGG
FT                   LLSQCEALTKYCQEAKFLQQEVETRTYHVLFSVLSLSNGEARGNPVSGTTEAKIREKAL
FT                   KELEACDAICLRHSKILWSLHEDIDKARRLVNGGTFYSCVTSEERRQVYQAMAAQFNGT
FT                   GHWYYCENNHPFAVGECGMPMEESRCPQCEAPVGGLNHEFAQGIRRADDMDVEFGGSLS
FT                   LEAHTDL"
FT   CDS_pept        join(545578..545595,545642..545698,545749..545764,
FT                   545812..545928,545976..546043)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113556"
FT                   /orf_name="An14g02140"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAK41951.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0000EFC903"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W0"
FT                   /transl_table=1
FT                   /translation="MPQDLKNAHYSYDYLHGLREKYEKSAQDFCRGMTFEDALAHVNST
FT                   GRTDFTREQLEAFDTNHDGSINFAEYMELMLNNDKELAFRNAKFIA"
FT   CDS_pept        join(546525..546609,546653..546798,546844..547264,
FT                   547327..547995,548045..548118,548193..548234)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962548"
FT                   /orf_name="An14g02150"
FT                   /product="Function: cpdS of A. phoenicis removes acidic "
FT                   /EC_number="3.4.16.-"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK41952.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG327432"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI000004F608"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W1"
FT                   /transl_table=1
FT                   /translation="MWLFLVCSILLPLGVVNAQSQYFNNKTKEFVVNGSAIPFVDFDIG
FT                   ESYAGYLPNTPSGISSLYFWFFPSSDPDASDEITVWLNGGPGCSSLAGIMLENGPFLWQ
FT                   PGTYRPVRNPYAWNNLTNMVYIDQPAGTGFSLGPSTVVSEFDVARQFMDFWRRFMKTFD
FT                   LQNRKIYLTGESYAGQYIPYIASQMLDQDDDEYFRVAGIQINDPYINELPVLQDVATVN
FT                   QHRSLFPFNDTFMSQITKLSDDCGYTSFLDDALTFPPRSQFPSVPYNASCNIWDIINNA
FT                   SLALNPCFNRYHIPDACPTPWNPVGGPIVGLGPTNYFNRSDVQKAINAYPTDYFVCKDG
FT                   IFPTANGLDTSPPSSLGPLPRVIEQTNNTIIAHGLMDFELLAQGTLISIQNMTWNGKQG
FT                   FEREPVEPLFVPYGGSSGGGVLGTAHTERGLTFSTVFSSGHEIPEYAPGAAYRQLEFLL
FT                   GRVANLSTIIEQVQITEQNG"
FT   sig_peptide     546525..546578
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W1 "
FT   mat_peptide     join(546579..546609,546653..546798,546844..547264,
FT                   547327..547995,548045..548118,548193..548231)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W1 "
FT   CDS_pept        join(548630..548778,548854..548939,549007..549044,
FT                   549113..549168,549253..549410,549460..549659,5
FT                   49821..550210)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962549"
FT                   /orf_name="An14g02160"
FT                   /product="Catalytic activity: an alcohol + NAD(+) [ "
FT                   /EC_number="1.1.1.1"
FT                   /function="alcohol dehydrogenase (NAD) activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41953.1"
FT                   /db_xref="GO:0004022"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC904"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W2"
FT                   /transl_table=1
FT                   /translation="MSPTSIPTHQTAACIDNPSPGATLTIRHDIPVPTPGAGEVLVKLE
FT                   YTGFCHSDLHNINGELVMTTNVPGHEGVGRVVKVGPNTPAEMMGRRMAVQKLHEVSDMQ
FT                   GAVYELMFLGHFNVRYLLFHFEKEYSAKNGIEYVVSPANFVSLIPEDLNPEAVAPLLCA
FT                   GLTMYGALSKIEKLYEKGDWVVIMGAGGGLGHLYAFRARCFGQSVNDEQGPSNRQGNGI
FT                   QHDRSRQLIAKIQSLTDGVGAHASLIVVGSEKAYEQGVALLRPLGTLVCVGFPRPDFHV
FT                   PVAPQHCVDSGLRIIGSAVGTETEMQALLEMARAGKVSTHYEVFDLEEINDVVERMRRY
FT                   AVSGRAVLRIPEASVARI"
FT   CDS_pept        join(complement(551192..551386),complement(550860..551077),
FT                   complement(550398..550773))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887480"
FT                   /orf_name="An14g02170"
FT                   /product="Probable cutinase 1 "
FT                   /EC_number="3.1.1.74"
FT                   /function="cutinase activity"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK41954.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0050525"
FT                   /db_xref="HOGENOM:HBG567328"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR011150"
FT                   /db_xref="UniParc:UPI00003502D2"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R2W3"
FT                   /transl_table=1
FT                   /translation="MAPLKSLLLGASLATLALSTPLATDAENLYARQFGTGSTANELEQ
FT                   GSCKDVTLIFARGSTELGNMGTVIGPPLCDNLKSKLGSDKVACQGVGGQYSAGLVQNAL
FT                   PQNTDPGSISAAKQMFEEANSKCPNTKIVAGGYSQGSAVIDNAVQELSTTVKDQVKGVV
FT                   LFGFTRNVQDHGQIPNYPKDDVKVYCAVGDLVCDDTLVVTAMHLTYGMDAGDAASFLAE
FT                   KVQSSSSSTTSSSSDAASSSSAAGTSSSGLSGLSSFFGGL"
FT   mat_peptide     join(complement(551192..551329),complement(550860..551077),
FT                   complement(550401..550773))
FT                   /product="Probable cutinase 1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R2W3 "
FT   sig_peptide     complement(551330..551386)
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R2W3 "
FT   CDS_pept        join(complement(553949..554225),complement(553520..553880),
FT                   complement(553088..553464),complement(552691..553033),
FT                   complement(552582..552642))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809345"
FT                   /orf_name="An14g02180"
FT                   /product="Catalytic activity: UDP-glucose + D-glucose 6-
FT                   phosphate ["
FT                   /EC_number="2.4.1.15"
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="CAK41955.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG559076"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniParc:UPI0000EFC936"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W4"
FT                   /transl_table=1
FT                   /translation="MTKRNLIVVSNRLPLSLKKVDGGYESSLSSGGLVTSLSGLTKTTT
FT                   FSWFGWPGIDITDETEQGQIRKSLDEHNAVPIFLDNELANNHYNNFSNAILWPILHYQS
FT                   GINFEEGPWEAYQRVNEIFADTIAEAAQPGSLIWVHDYHLMLLPRLLRDRLAGKNCAIG
FT                   FSLHTPFPAGDFWRNLPVQKDLLRGLLASDVIGFHTDEYKRNFVLCAESLADAKVKESG
FT                   TLEYEGHEVVAEKFIVGIDPQKFTDALQNEEVQNRIRDLQRRYMGMKVIVGVDRLDYIK
FT                   GLVQKLKGYDAFLDQYPELSNKVVLIQVAVPSREDVKEYQDLETELSTLAGRINGKHST
FT                   ADGCPLIYMHRSVNFSELTALYSVADACLLTSTRDGMNLVSFEYVACQAQRHGVLVLSE
FT                   FAGAASFMKEGCLTFHPANMSEMVDAVHQAVTMSGDDRKSRYETLRHFIETNTSAKWGE
FT                   TFIETLTKHVEGGR"
FT   CDS_pept        join(complement(556159..556273),complement(555187..556088),
FT                   complement(554805..555140))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171504" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113557"
FT                   /orf_name="An14g02190"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK41956.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG327433"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="UniParc:UPI0000EFC937"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W5"
FT                   /transl_table=1
FT                   /translation="MDKRTAESPMDFEWQTRAPGDVTSPFYQLSMQHDNQKKRPHSIFD
FT                   SPEKKSMPALREPNSQPFLFSQPKPQQPPSTPKPFFNQSAFMTPRKFDVDFSSGAENMS
FT                   SPEHADNEDTPEQPKAHRNSLFSMYGRFAPSPGRGEIPRVSHYSNALARRVQKRRRRDK
FT                   ALDLQLRRDSDDESDRPSSTELKPTKQRQKPGQGQQETPQTGSRLTSFSDFFALLEAHP
FT                   NVPSILSWWAQLVVNLSLFSLAVYVVFGFVSAIRAEFEQAAEEVSDTILAEMAACAKSY
FT                   VDNRCAGGDRLPALESVCENWERCMNRDPAKVGRAKVSAHTMAVIINSFIDPISWKAIM
FT                   FFLATISTVTVVSNWSFRSFRNRLNQHDYSAPPSYSRQSSGQHPSLAPSQFPYQQNSMG
FT                   YMGAPNHGATGFDKAEAPLMLEQAATKDFVSDRTRERGSRLRTPSPSKRMR"
FT   CDS_pept        join(complement(557577..557752),complement(557150..557528))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962550"
FT                   /orf_name="An14g02200"
FT                   /protein_id="CAK41957.1"
FT                   /db_xref="HOGENOM:HBG327434"
FT                   /db_xref="UniParc:UPI0000EFC938"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W6"
FT                   /transl_table=1
FT                   /translation="MSDSLLDIRRAGVEAKRAHDHKAKWAYGSRSTLPRYNQDVHSHVL
FT                   HKARPRMPATHYTTLTRHMRFQRKAETNHQLSDAKIALRADVREALDSGTSDSSSDDID
FT                   DPAAAEKIIDDAEGKDTLPDYDVAGHTILSDAVSKAVEKFETKETERIVKEYEMISYEG
FT                   ENALGYMADDDDFELVDRIKL"
FT   CDS_pept        complement(560023..561048)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171537" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887481"
FT                   /orf_name="An14g02210"
FT                   /product="Remark: IgA-specific metalloendopeptidase "
FT                   /protein_id="CAK41958.1"
FT                   /db_xref="HOGENOM:HBG736619"
FT                   /db_xref="InterPro:IPR018609"
FT                   /db_xref="UniParc:UPI0000EFC939"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W7"
FT                   /transl_table=1
FT                   /translation="MSSLADYLAKNYLNADPAPDRPKKKRKKNTKASDSTPTGLIIADD
FT                   DPPDLRSGGNNLLNDDEDAPSIVTNARTGEFRRKKTSGWKTLTPGDGGAEQDAADKILA
FT                   DAIVEGEERRREQGGGDEEDDDAPVVEGVEEDEEGVRMESGARAGLQTAAQTAAMVAAQ
FT                   ERKKKADAAKYKESALGEKAQETIYRDASGRIINVALKRAEARRAEEEKKAKEEEAKEA
FT                   LMGDVQRKEREERKQQLRDVRAMPLARTAEDEELNDELKGKLRWNDPAAQFLTSVKEGG
FT                   TSRTGKPLYKGGFAPNRYGIRPGHRWDGVDRGNGFEKEWFLARNRKGRLEALDYQWQMD
FT                   E"
FT   CDS_pept        join(complement(561640..561702),complement(561459..561546),
FT                   complement(561346..561417),complement(561194..561264))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809346"
FT                   /orf_name="An14g02220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41959.1"
FT                   /db_xref="UniParc:UPI0000EFC93A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W8"
FT                   /transl_table=1
FT                   /translation="MRNHPPGINHPLPRHIPRMEEYDAVGGEEKVGEYEDDGGNSGDLN
FT                   GDERGGRDSSPGDLLDRGVDGVDEVFGFVGVVLRRGVAALCRCRCRSYMLPA"
FT   CDS_pept        join(complement(564291..564484),complement(563356..564146),
FT                   complement(563219..563306),complement(562938..563169),
FT                   complement(562447..562884))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113558"
FT                   /orf_name="An14g02230"
FT                   /product="Function: dsk1 of S. pombe encodes a kinase "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK41960.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000EFC93B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2W9"
FT                   /transl_table=1
FT                   /translation="MDGVDITKAVLNKGKQMASSVAASATNGNGGKKRRKGTDLKPIVT
FT                   NEAATLGVDPATTTTTTTEGVPAYGVPPSRSSSSSSGEELETTAEEEDSEDYCKGGYHP
FT                   VSVGETYNNGRYVVVRKLGWGHFSTVWLSRDTTTGKHVALKVVRSAAHYTETAIDEIKL
FT                   LNRIVQAKPSHPGRKHVVSLLDSFEHKGPNGVHVCMVFEVLGENLLGLIKRWNHRGIPM
FT                   ALVKQITKQVLLGLDYLHRECGIIHTDLKPENVLIEIGDVEQIVKTYVKEEAKKEQKED
FT                   NRNGRRRRRTLITGSQPLPSPLNTSFEFKHSSQNSHSSLSQMVSESSVTPNAESTSMKE
FT                   MLGIKDDDEKQKQREKTADLLEREVSGISLDKSQSSEEQEPECDIISVKIADLGNACWV
FT                   GHHFTNDIQTRQYRSPEVILGSKWGASTDIWSMACMVFELITGDYLFDPQSGTKYGKDD
FT                   DHIAQIIELLGPFPKSLCLSGKWSQEIFNRKGELRNIHRLRHWALPDVLREKYHFSVEE
FT                   SMRISEFLLPMLEVTPDRRANAGGMASHEWMRDTPGMDGIDLGITPGSRGEGIDGWAME
FT                   VKRR"
FT   CDS_pept        join(566362..567457,567566..567616,567784..567803)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656690"
FT                   /orf_name="An14g02240"
FT                   /protein_id="CAK41961.1"
FT                   /db_xref="HOGENOM:HBG385841"
FT                   /db_xref="UniParc:UPI0000EFC93C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X0"
FT                   /transl_table=1
FT                   /translation="MSSPFHRRPFPDYFLSSPLATLIYPLHQLLNHLRGPPHLPPPNAR
FT                   PIRVVCISDTHTLEYPDVPDGDLLIHAGDLCNDGSAREIQAAVNWLRSLPHPHKVVICG
FT                   NHDSYFDTRSRLPEDRIDASSSHNNTSSTYATISSSTASLRSLDDYLTDDPHPRIDWGD
FT                   DIHYLQHSSITLTFPPTTASSSSSSSITSTTPLRPRTLTIYGAPQIPAIVPFGPEHAFT
FT                   YPPHHDAWSNTIPASTDILVTHTPPQSRLDLSPVYSAGCPFLLSELWRVRPALHVFGHV
FT                   HAAYGIERVFYDEAQRAWERLCASRKSRARLSRFSSLFGFLRDLFDLSGLVDSARVVLY
FT                   GVLGVVWARVWGGENRDAGWVVNAAFFHVIFLVYKGEPRRGKVYTQMQ"
FT   CDS_pept        join(complement(569380..569488),complement(569014..569327),
FT                   complement(567877..568956))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217463" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887482"
FT                   /orf_name="An14g02250"
FT                   /product="Catalytic activity:"
FT                   /EC_number="1.1.2.3"
FT                   /function="FMN binding"
FT                   /function="L-lactate dehydrogenase (cytochrome) activity "
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41962.1"
FT                   /db_xref="GO:0004460"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG517781"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI0000EFC93D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X1"
FT                   /transl_table=1
FT                   /translation="MSKGKLTGAAVAEHNSKDSCWVIVHGKAYDVTEFLPEHPGGQKII
FT                   LKYAGKDATEEFDPIHPPDTLDKYLDSSKHLGEVDMTTVEQEEKTADPEEEARQERIKC
FT                   MPSLAACYNLMDFETVARSVMKKTAWAYYSSGADDEITMRENHSAFHKIWFRPRVLVDV
FT                   EHVDFSTTMLGTKVSVPFYVTATALGKLGNPEGEVVLTRAAHTHDVIQMIPTLASCSFD
FT                   EIVDARQGDQVQWLQLYVNKDRNITKRIVQHAEARGCKGLFITVDAPQLGRREKDMRSK
FT                   FSDVGSNVQASGGSSVDRSQGAARAISSFIDPALSWKDIPWFQSITKMPILLKGVQCVE
FT                   DVLRAVEMGVQGVVLSNHGGRQLEFARSAIEVLAEVMPILRERGWENKIEIYIDGGIRR
FT                   ATDMLKALCLGAKGVGIGRPFLYAMSAYGQPGVERAMQLLKDEMEMNMRLIGATKIEEL
FT                   NPSLIDVRGLVGGHSAPVPSDTLTTGAYDPLQAPRFSEKAKL"
FT   CDS_pept        join(complement(571730..571775),complement(571284..571675),
FT                   complement(570840..571160))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656691"
FT                   /orf_name="An14g02260"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="CAK41963.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI0000EFC93E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X2"
FT                   /transl_table=1
FT                   /translation="MSSSLEAKIVVLGAQGVGKTSLVDRYVKNDFNPSATASTVGASFV
FT                   TKRVLDSSSDTIVRLQIWDTAGQERFRSISRLYYRGANACLLCYDITDEQSFQEMTGWL
FT                   AELKKNIVEDDPIVIHVVGTKTDIVTLDPSRRRVPFERTIAYDIGWDCCHEISAKDGEG
FT                   IEEVFRVITRKLVEQRNKREAGTSSSQRSSTVFDGTTSSLTPGNIDGNGSFRLGYGDKR
FT                   RSWLGFPPSSVGDELEDIVEGPKRKGGQCC"
FT   CDS_pept        join(572094..572147,572193..572432,572523..572675)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962551"
FT                   /orf_name="An14g02270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41964.1"
FT                   /db_xref="UniParc:UPI0000EFC93F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X3"
FT                   /transl_table=1
FT                   /translation="MTGQCADQPITYEPFPGQDEDNEDKDKWMGWKRMKEESNQSPMKN
FT                   DSAPAESTSNPSWPLTCFLAYPPLFQPQTLSRIWKSYSTTSYLVFVLSHVNPAPQVPKV
FT                   WVIPGHRPLDGTTVPRALIVHNDGGFSIQLVRPKQSATVHLDHR"
FT   CDS_pept        join(575835..575837,576236..576633,576699..577268,
FT                   577348..577405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887483"
FT                   /orf_name="An14g02280"
FT                   /product="Similarity was not found in patent database "
FT                   /protein_id="CAK41965.1"
FT                   /db_xref="HOGENOM:HBG327437"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniParc:UPI0000EFC940"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X4"
FT                   /transl_table=1
FT                   /translation="MARYEMRLSYRIGAAALIILAIILIKRHLDLVQDDARVQSGWSFS
FT                   SFSAESAADGSSNNVNSGNDGVSTPKNSKPILTGSDNSNSNGKTKGSSDSAVSRPLYET
FT                   TPIIVPNDRVIVMAKLSTEDTSWVSNDLAEWRNVIYTVDDVTAPRHTPKNKGRESLAYL
FT                   QYIVDHYDDLPSTIVFLHSHKDGWPGAWHTDTMAYSNVDSIRALQTDFVQRNGYVNLRC
FT                   QQTPGCPDEIRPFRDPPQFGKTAERVYAQAWVELFNNTNVPDVVGVACCSQFAVSREQV
FT                   LKRPLEHYTWFYDWVLNTGLSDDLSAHVMEYTWHIIFGKDPVYCPDAYQCYQDVYGNPY
FT                   FW"
FT   CDS_pept        join(complement(580689..581352),complement(580369..580639),
FT                   complement(580081..580321),complement(579649..580025),
FT                   complement(579235..579583),complement(578600..579186),
FT                   complement(578213..578530),complement(577851..578151))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000265622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113559"
FT                   /orf_name="An14g02290"
FT                   /product="Induction: the mRNA for the alpha 1 isoform of
FT                   the NKAA1 gene from R. norvegicus "
FT                   /EC_number="3.6.3.9"
FT                   /function="ATP binding"
FT                   /function="sodium:potassium-exchanging ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK41966.1"
FT                   /db_xref="GO:0005391"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006069"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000EFC941"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X5"
FT                   /transl_table=1
FT                   /translation="MRQETVNERRLQRQKAMSRPVCFHSVADPLSGALRADDSFLDLSN
FT                   LDWHMISPEEIQKRWRVDISQGLSHDQVQQRVREFGKNALSPLPHQWFWQIFGYFFKGF
FT                   GGILLIGCILVFISWKPLGQPPAPANLALAIVLLAVFFIQAGFNAWQDWSSSRVMASIT
FT                   AMLPESCLVLRDSSLVVVSAPDIVPGDVVHLKAGNKLPADVRLVEVSNDVCFDRSILTG
FT                   ESLPVNGTIDSTDDNYLETHCIGLQGTHCVAGSAVGVVVSTGDSTVFGRIAKLTSEPKK
FT                   GLSTLEKEVLRFVLLIVIIMLTMIIIVIVVWATWLRVDHPGWINVPTLIVDCVSVAIAF
FT                   IPEGLPIALTANLTITANLMSKNKILCKSLKTVETLGAVSVICSDKTGTLTKNKMFVTD
FT                   CALSMSHFSTELARDEMVIKGRKTGMHQLRGVAGLCNGAEFDASSLNKPLHEREIHGDA
FT                   TDQAVLRFSEGLGSVAELRRTWRKTYELAFNSKNKFMVRTFSLVESAGLSLGMSAAESA
FT                   HLLTIKGAPDILIERCTQVVDTDGSVQPLDGRILAHIKSVKDQWSSEGKRVILLARKVL
FT                   PVSDITPLPSSREFESHVMSHAKTGLILVGLVGIVDPPREEIPGVVRTLRRAGVRIFMV
FT                   TGDYGLTALAIARQCGIVSTHGPVDTASSLKRLLEYDEKPPSTPSTMAITLSGSELMSL
FT                   NDHQWEQLCQYQEIVFWRTTPEQKLRIVREFRARDEIVGMTGDGVNDAPSLKAADIGIA
FT                   LGSGSDIAIEASDMVLMESFSAIVEAVQYGRVVFDNLKKTIVYLLPAGSFSEFWPVFTS
FT                   VVFGLPQVLSSFLMIIICCFTDCAAATVLAYEAPEADVLLRPPRKPKQNRLVNWKLIFH
FT                   AYGILGMIETIASFAMAYWYLERNGIPFSALWFKFGATPSNIDSDWLNARLNEASSVYF
FT                   INLVVMQWFNLMAVRTRRLSIFSHPPAFNKQTQNLLLFPAILFALAMAVFWLYIPPLQR
FT                   VLDTSSVPVEHYFLPAAFGLGILILDELRKAGVRRWPGGVLDRFAW"
FT   CDS_pept        join(complement(583409..583716),complement(582714..583359),
FT                   complement(582193..582657))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887484"
FT                   /orf_name="An14g02300"
FT                   /EC_number="1.14.-.-"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41967.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000EFC942"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X6"
FT                   /transl_table=1
FT                   /translation="MSKPNSQRPLHVIIVGASIAGLTLAHCLSNTGVKFTLLEARSDTY
FT                   PDGAGLAILPNGARILHQLGLYQEMLVQGQCMVSHSTWLETGHLLRRVDAGRIRSFRRT
FT                   DYPVLVISRRALLGILYTRLQSSRLFFNRPVVRIVSSADNVTVHSADGTSVSGDLVVGA
FT                   DGVHSTVRKQMWHHIREANGAIASSRWLSEVPLTNSFAGVFGVAQSIPRLYRGDVHRTY
FT                   GHGWLTVIMVGADSRVCWFMSIARTMMPVLNSRHTSDRACVSRIVEPFLEKHVTSDVTF
FT                   GEVFNRSESCILASLEEGFQNRWSWGRFVGIGDGVHKMAPNIAEGANCAIESAASLANH
FT                   LVSFTDESPSLYTEERLTPMLKAWEDSRKRRARGLFLVSWCAARIETTTSWVLKVQQVF
FT                   LAQFHATGIGLLTSITSRTARVDHLPLPLPQKSSTQQVPKNKEHESVWNLHVLLLPLAA
FT                   ATSFMFYALHALVM"
FT   mat_peptide     join(complement(583409..583641),complement(582714..583359),
FT                   complement(582196..582657))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X6 "
FT   sig_peptide     complement(583642..583716)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X6 "
FT   CDS_pept        join(584697..584744,584914..585159,585232..585295,
FT                   585348..585463,585550..585633)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962552"
FT                   /orf_name="An14g02310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41968.1"
FT                   /db_xref="UniParc:UPI0000EFC943"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X7"
FT                   /transl_table=1
FT                   /translation="MPRMRFGEDKNHSVYLKVWDGTGSIPHLQYNDPANKKIHIHHQQG
FT                   SETTTIGGWKGREREVLCASRLNCSDPVAAVNPSRIRTGIWSIAAGPGLDQLQEGMSDF
FT                   RLLRLYESGARGMEPDWTGQPLNVARCPWGTRQPGYRLDAIGTTLITNPLSPYREGMND
FT                   KSPDKTNAPANSTRFNDSHACR"
FT   CDS_pept        complement(585819..586838)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175429" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656692"
FT                   /orf_name="An14g02320"
FT                   /product="Similarity: the similarities are mainly based on
FT                   repetetive structures"
FT                   /protein_id="CAK41969.1"
FT                   /db_xref="HOGENOM:HBG327440"
FT                   /db_xref="UniParc:UPI0000EFC944"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X8"
FT                   /transl_table=1
FT                   /translation="MPAQMDALGAFTHLTENIPSWIDRLAELSAHTAAKHAEYAEAYRR
FT                   HVSVRPRRRKNSSVCSIRTEDLRSSAPETETRPQSSAAATNTTVTTPNTSQHEANVNPR
FT                   KRGAEDAPSMEARDRDLLVSTRNNLIIHYDGHTQHVLEEMVRHIGTARNNIRKGRMTQL
FT                   PLPGYRSKMLDRSARMNSLAPSLSPSESGEDDVLSSIRKARTRGPPVPRAPEMPRESPF
FT                   DMAEKQLELVHGVCETAAYQFLRSGDCSTELSSVESKFKSLLDLATNEVRRLKAEQPQE
FT                   PTVEEDETEAPAMEPATTTIEVDRQSLSKMDTIEVDDSAQSVESIDLTAFRANRLRRG"
FT   CDS_pept        join(complement(588516..588895),complement(588326..588431),
FT                   complement(588169..588231),complement(587904..588068))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887485"
FT                   /orf_name="An14g02330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41970.1"
FT                   /db_xref="UniParc:UPI0000EFC945"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2X9"
FT                   /transl_table=1
FT                   /translation="MIMKCINILPDLPLAAGPGECSGTNLLHSSKVPQGWGKPRNAVES
FT                   ADRNDMVAEYLVHRNPGIMDEQVIMPRTVLQDYLGSQHNMPREQSQPCLMALSSHGSVR
FT                   DDRRSRSPIQQEEQDIMGGILGGSLPGRGHRPLRVMTFLGKVAVSESWMTFGFDRRFQG
FT                   WLVRGVKGRVLCDGLVLCQHESFQNATHGDLISGRPCCWCRSGFICDGSSSRGFLRTQP
FT                   DTTAAAAAARSPAPH"
FT   CDS_pept        join(complement(590038..590220),complement(589730..589982),
FT                   complement(589166..589677))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962553"
FT                   /orf_name="An14g02340"
FT                   /product="Similarity: the similarities are mainly based on
FT                   repetetive structures"
FT                   /protein_id="CAK41971.1"
FT                   /db_xref="UniParc:UPI0000EFC946"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y0"
FT                   /transl_table=1
FT                   /translation="MSSSTEGDRLICPVCRGYCDVSDNCPTCTAAEPAMLKAEISDSQD
FT                   DTALKMAPSAEDSPQQDNSEASSATAKATSAPQSPSAPQSPQAPPPPPAAPKKTSKTVK
FT                   MSKKMESSSSSSNSPQKEKLTPACAPCKKAKRRCVHRSVIPDAEGQGTSQPPKKRKQTA
FT                   ESGANPKRARKDCGDASGDNDTGSEGGQPIKLKFKNVEFETAETGESSTPKKRGRPSKT
FT                   LPGNAEVGTLPSIEEEEEEEEEVPRKRAKDKNYGFPKDSLLAASRVTAFKHLDKQLQDK
FT                   IVDCEDKWKAAKDTIEEIRYILNKWMELWEHGKV"
FT   CDS_pept        join(complement(591023..591557),complement(590715..590959))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656693"
FT                   /orf_name="An14g02350"
FT                   /function="FMN binding"
FT                   /protein_id="CAK41972.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG327443"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI0000EFC5E1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y1"
FT                   /transl_table=1
FT                   /translation="MPPKPGPYLPLLSSHLTSSPTSTSISLTTLSTHPITRTPQPRSRT
FT                   VEFRGFFPTLNLHSSAIQSLKDQHIGLNPDIYESEMIALTTDKRMEKVQEMESSGGVVE
FT                   AVFWLKEVGNQWRVRGRGVIIGGDPEDQGEREGRGFIEKGLRRKEDGGNGEGDGEWSWE
FT                   RQVDMYFANHSPGMRGTFKNPPPGTLRSQDPGNPELKLGQKVEDLKDKVARENFRVVVI
FT                   RPEEVERLDVNDPSNPIRTRWTAVRDGEEWEEVDLWP"
FT   mat_peptide     join(complement(591023..591485),complement(590718..590959))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y1 "
FT   sig_peptide     complement(591486..591557)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y1 "
FT   CDS_pept        join(complement(593551..593629),complement(593420..593460),
FT                   complement(593074..593334),complement(592612..592992))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175472" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887486"
FT                   /orf_name="An14g02360"
FT                   /product="Complex: the human U2 snRNP-specific protein A' "
FT                   /EC_number="1.1.1.7"
FT                   /function="propanediol-phosphate dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41973.1"
FT                   /db_xref="GO:0050216"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG747960"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="UniParc:UPI0000EFC5E2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y2"
FT                   /transl_table=1
FT                   /translation="MRLTVELIQNSLSYINPLKDRELDLRGHKIPAIENLGIAKDQDAI
FT                   DLTDNDITSLGNFPFFPRLRTLLLARNRVKQIQPTISTSVPNLSALVLTANNMNELADL
FT                   DPLRNLAQLTHLVLLENPVTRKEHYRYYVIWRIPSVRFLDYQKVKDAEREKATELFGTA
FT                   EEPSALASKIMGIKSRTFDVPSGAGGADRGAPADKAVRVKLTEKERKRVEKMIREAKSL
FT                   QEISRLEKELNEGRIPGGALDYADSDEEMQT"
FT   CDS_pept        join(complement(596494..596503),complement(596392..596426),
FT                   complement(596217..596337),complement(594172..596144))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175473" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656694"
FT                   /orf_name="An14g02370"
FT                   /product="Catalytic activity: NTP + H(2)O [ "
FT                   /EC_number="3.6.1.5"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK41974.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG327444"
FT                   /db_xref="InterPro:IPR000407"
FT                   /db_xref="UniParc:UPI0000EFC5E3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y3"
FT                   /transl_table=1
FT                   /translation="MGKHRYGVVLDAGSSGTRVHVYRWLDNAVAREKGKHLQTLPEVKT
FT                   KSDWTKKIHPGVSSFATKPEEVGPEHLAELLEHAKQIVPDDAVKDTPIFLLATAGMRLL
FT                   PGVQRNLLLEQICSYVGSNSDFLLPDCGVHIQVIPGVTEGLYGWIATNYLLGSFDSPGT
FT                   HDHGKGHHTYGFLDMGGASAQIAFAPNATESEKHANDLTLLRLRNIDGSTQEHRVFVTS
FT                   WLEFGVHEARRRYLESLQAASAIGDVNELPDPCLPSGLRTTIDGKLLATDDIDGMHLLG
FT                   TGKFDECLRQTYPLLDKDAPCPDQPCLLHGMHVPAIDFDVNHFVGISEYWHTTHDAFEM
FT                   GHKDKAYDFATYQERVRSFCSQDWATVENGLEAHQWGKKFDRESASEICFKASWIMNVL
FT                   HDGIGIPRVGLEDITGSGHNGTKEVLSHGQSKGYLDSFQAVNNIDSTEVSWTLGKMVLY
FT                   ASSQVPLEAEEALPVGFGSNVAGVPSDFQYPSVELLPSPEGIHGTTWHDALLEGSSSRR
FT                   APGFILFLLIVILVAFFLCGRGRRLKVYHKIKNVFGWGGPSHPNYPKRRRIFGGKLPFF
FT                   GPRSPTYERVLEEGAQEFDLGVSGSSRSSFDGGRPSEADAARFTAPKRASSWGSGNTTP
FT                   TFKYGLDNSSSGTIGLGISAGSGTNAMDRHGLVVRTESRDHLAPLALGPTTNGRRSRAG
FT                   SPSRSHPKSPLMTPLADD"
FT   CDS_pept        join(597428..597516,597652..597725,597808..597938)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887487"
FT                   /orf_name="An14g02380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41975.1"
FT                   /db_xref="UniParc:UPI0000EFC5E4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y4"
FT                   /transl_table=1
FT                   /translation="MMTDVPDQRVKMVSLNPEIDTNQLNDLPFALLTTLPILERGCTTA
FT                   GFKAMGSVTWNQSEIRLHSIDPTYEESQDFLRSISAMLLSSFPRAESGQRHH"
FT   CDS_pept        join(complement(599973..599981),complement(599685..599899),
FT                   complement(599447..599627),complement(599081..599401),
FT                   complement(598327..599025))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809347"
FT                   /orf_name="An14g02390"
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK41976.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniParc:UPI0000EFC5E5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y5"
FT                   /transl_table=1
FT                   /translation="MTEPVYNSSTPEGGDPTQVDVNAQYTGFEYNYVYITTCTFIVFLI
FT                   LPGIGMLYSGLSRRKSALALLFQAFMVLAVSTFQWLFWGYSLTYSRDGGPFIGTLKNFG
FT                   LMDVLVAPSPGSAVLPDVVFCLFQLLFCACTVMIVVGGAFERGGIVPSLIFSFFWATIV
FT                   YCPLARWTWSSNGWLYNLPAIDFAGGGPVHIASGCTALAYALVLGKRRDHGDPSLRKPH
FT                   NTTLVFLGTVLIWTGWLGFNGGSSLNASMRAMVAVFNTNTAGCTGILGWVLVDMIRYKG
FT                   KFTVVGACEGAIAGLVGITPAAGCVSLWLAACIGFITAIVCSSLKNVNEWINVDEGMDV
FT                   FKLHGLGGMVGAFLTGLFASEKISALDGSTLSPGAIDGNGVQVGKQLAEICAIASYSFV
FT                   VSYIMLLILKYIPGMQLRVSDEDEMLGLDRTQFFDEQIGDWSMAMPGSASPTLVGVPKE
FT                   SSTSVTECRERKGSEI"
FT   CDS_pept        join(complement(600806..601004),complement(600637..600695),
FT                   complement(600435..600560))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887488"
FT                   /orf_name="An14g02400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41977.1"
FT                   /db_xref="UniParc:UPI0000EFC5E6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y6"
FT                   /transl_table=1
FT                   /translation="MIVAACLKAKSWGHVAAWKTPTRLKREIVVDHRRCGLIGDHEIVS
FT                   YPAPIPHVWTTVSSLGPPLNEPLQPLQLRFRAPMLVIGAEQDGLRMHGLHPTALTSSVF
FT                   LRYPKPQKDVRSGVFNRANQSWL"
FT   CDS_pept        join(601918..601997,602070..603618)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809348"
FT                   /orf_name="An14g02410"
FT                   /product="Similarity to hypothetical conserved protein
FT                   encoded by 17E5.150 - Neurospora crassa "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK41978.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EFC5E7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y7"
FT                   /transl_table=1
FT                   /translation="MGVQETAPKKRTRVSHTKVRTGCRTCRIRHKKCDETRPICRMCSS
FT                   TGRICDGYQQTIDRRTRASRLRLASTSPSSTSSSSSTVSVPSLVSDLILHTNEIDLTRQ
FT                   ERWYLDFFRRNTSFQCSGYFDDDFWLRLVHQVTEAEPAVRHAAIALSALHCNFERTSTG
FT                   QGAIDSRLPLQQCVKAISSLRHQLAGGGVLSRSNMQITLVTCVLFVSFMFLQGDTHSAY
FT                   CHLRGGLKLLKEWRSTDMPGYSTTGAVLMKVFAHLQLQWSTFADEVFIEEVDSNRFDVP
FT                   YIEINDLSLEEPTDSLEKAGSLLVSLGRLVLTPRPPGTSSPGYCTVLDSRRMAILNKLQ
FT                   HWTTELDNSMTCAGNTLILRDNTILTVLKLWSEIIYIMAATETRLGGSETRFDAFHLNF
FT                   GRAVALAKILLLSTPAQSTMPNFSIGMGIIPPLFFCAFKCRDWYIRREALQLLRSCQRQ
FT                   EGLWTTPGAVLVLERLIDIESKGLMPGDLVPESRRVDSIHVNILPDDHKIGLWYRRSGM
FT                   GVGLDGYMDVGSGMWEKALLEYHVG"
FT   CDS_pept        join(complement(606638..606993),complement(604755..606590),
FT                   complement(604075..604702),complement(603848..603916),
FT                   complement(603676..603687))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887489"
FT                   /orf_name="An14g02420"
FT                   /protein_id="CAK41979.1"
FT                   /db_xref="UniParc:UPI0000EFC5E8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y8"
FT                   /transl_table=1
FT                   /translation="MPLFNAKTLLAGLCAASIVSPSLGLPQSSHPGSSAVANTQGRASS
FT                   ESHPSWTLESDSTAATVSTSNTPLYSPSSSATASLGATQGSLTDDHDGASKSSTRSYGV
FT                   TTISYSSAPVNNPQSAHDASASPSTPSGPHSHTTTLSSSSAGVPAQSQTTSSSRSHSVV
FT                   SKETSTRSPSSLFTPSASTETPTNPSHTPSTYTISTHSFSSSEHASSESATSFHAVSTS
FT                   KHTHTHTPTSSTSSSNTPTRSSALTQHETSTSSSTPTRSHTHTASTPASSKANTSSSIK
FT                   THTTHSHTEDTTSSSASHTPTSSKSSSSSAEDVSSSPASHSPTPSTHSITTTTNTDTSQ
FT                   SASITSGPSTTPNSTITTTSSTTTSSVDVYAIIKHLYKLVKDTYPVIKKWKEDPKSVKA
FT                   SDLIKPLKRVIPVADDVLDVLGAPSSLSSSSGDSESVLDSCSSGGGLLGDLIGIASCIS
FT                   STADEAVSILGSSSDSDSSDESTLSSYFDAFETEGSSLSAVGVTATGSTASSTGTTTTT
FT                   SSGDTSSKSTKTATSTNTDSDTSTQSTKTKTSTKSTTTSDSSSSAGSGGHSASASASPT
FT                   STKSSTSTKESSTSTKTKTKSNTESSSKAASSSAAASKTDSSSSSAKSTSTDSTSTKKT
FT                   TSTKSTATSSSAPLSASSSAHTSSIATTNTTSTSTNSKSSTSTDTTTIIIHTHSGTASG
FT                   TTTHHTSTVTPSPSRNQTATTLVTTTSSYTPPLCYNHADPDNGAGNVCICTRSNGDYTT
FT                   LSELPSGSGCSYTSIPTPTTTSTTKTTSTKTTSDPPFTVTELNSDVIVCATSTLSYFST
FT                   FTYTQCAGSSSTIYTAPTPTPTAQVVIAYLSDVYSFWSFFTPDIGSSIDFCNDAEAGEL
FT                   EASGSIKVIDPPYPDGTKELDFEIHDMKDCVYKGTSDEPGTFTCPDLAKTVDCESYGEN
FT                   KVHDCYGALSDGGVVYEEGIDCASIGSVEVQAENGI"
FT   mat_peptide     join(complement(606638..606921),complement(604755..606590),
FT                   complement(604075..604702),complement(603848..603916),
FT                   complement(603679..603687))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y8 "
FT   sig_peptide     complement(606922..606993)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y8 "
FT   CDS_pept        join(complement(608440..608881),complement(608376..608410),
FT                   complement(608192..608239))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113560"
FT                   /orf_name="An14g02430"
FT                   /protein_id="CAK41980.1"
FT                   /db_xref="UniParc:UPI0000EFC5E9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Y9"
FT                   /transl_table=1
FT                   /translation="MPIPTDGIYFRLLNYQSRNVLVANKGIGESKLTDFNSVDKHYDNQ
FT                   IFELIPRGDGTFYIQSVYVPSSGTKGRIFSISGGVGISFLASDADSTRFTFEEGSGYLA
FT                   GWYRLVTPAFDLVLTDKSGYGPSNYRANGEKYEDQYFQFQTNYPMSNSYGVIFIQMFWN
FT                   KHYLVLYYLND"
FT   CDS_pept        join(complement(610524..610532),complement(610127..610331),
FT                   complement(609959..610026))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887490"
FT                   /orf_name="An14g02440"
FT                   /protein_id="CAK41981.1"
FT                   /db_xref="UniParc:UPI0000EFC5EA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z0"
FT                   /transl_table=1
FT                   /translation="MLGAGRIDPSNSIKCDIMSCPRGINTLLIIFAVYASLRLEFAVHY
FT                   INGVYKGQHKYLSLDHMSFSKRKTRERTAQPDRQHPPFSSLPPASWYG"
FT   CDS_pept        join(complement(611706..612032),complement(611359..611655),
FT                   complement(610901..611290))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113561"
FT                   /orf_name="An14g02450"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK41982.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG705794"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="UniParc:UPI0000EFC5EB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z1"
FT                   /transl_table=1
FT                   /translation="MGPQQWFRKRNPDSQTAPMYRSSNNQLPMLHLADTTRNNFIAAVG
FT                   EFVGTFLFLFFSFAGTQVSNTPKPAPGSPPNTSNLLYSSLCFGFSLMVNVWAFYRVTGG
FT                   LFNPAVTLALCLVGGLSPIRGVILFGVQLIAGIASAGVVGALFPGDLNVGTRLGGGASI
FT                   SQGLFIEVFLTAQLVFIIIMLAVVKHKSTFLAPVGIGLVFFVTEMGTTILAAHSTRRDH
FT                   SVLTSSTAVSPGTTGSTGSVRCWEVSSHVASSPSSRCSSTTVNPGQDYNEWEAKMGSGG
FT                   PGSWDMSMHRPSYNSEATTVEQPQSPSAGRRNHTPTNSQPQNNPNIPNIPHGAEQV"
FT   CDS_pept        613729..614982
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000238921" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887491"
FT                   /orf_name="An14g02460"
FT                   /product="Cofactor: FAD and protoheme IX were bound as
FT                   cofactors by fhp of A. eutrophus"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity"
FT                   /function="oxygen binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="oxygen transport"
FT                   /protein_id="CAK41983.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG623097"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI0000EFC5EC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z2"
FT                   /transl_table=1
FT                   /translation="MGLTQEQTDIIKATVPVIKEHGNAVTSVFYKNMLAAHPELNAIFN
FT                   SSNQVNGHQPRALAGAVFAYAANIDNLGALGPAVELICNKHASLYIQPEHYNIVGKFLL
FT                   EAMGEVLGDAFTPAIKDAWAAAYFQLADIMINREAALYNEADGWTEFRDFRIAKKVPES
FT                   SEITSFYLEPVDGKPLPSFRPGQYISIQLFVPQLNHPQARQYSLSDKPRSDYYRISVKK
FT                   EAGLDATEPGAEAHPGLVSNILHDLKKEGDIIKVSHPQGDFFLSDAEKQSSSPIVLLAA
FT                   GVGLTPLTSILNTVLETESETQRKISFVHGARTSAARAFKPQIRELATKVPNLQAFFFT
FT                   SHPAAEDKQGEDYDFAGRLDLSKLDAKRDLFLDDATTQYYVCGPESFMLDVKNKLAAEG
FT                   VSADRIKMELFGTGGVPA"
FT   CDS_pept        join(complement(617181..617292),complement(616137..617113),
FT                   complement(615319..616065))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887492"
FT                   /orf_name="An14g02470"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK41984.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG324076"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI000004F607"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z3"
FT                   /transl_table=1
FT                   /translation="MLSSLLSQGAAVSLAVLSLLPSPVAAEIFEKLSGVPNGWRYANNP
FT                   QGNEVIRLQIALQQHDVAGFEQAVMDMSTPGHADYGKHFRTHDEMKRMLLPSETAVDSV
FT                   RDWLESAGVHNIQVDADWVKFHTTVNKANALLDADFKWYVSDAKHIRRLRTLQYSIPDA
FT                   LVSHINMIQPTTRFGQIQPNRATMRSKPKHADETFLTAATLAQNTSHCDSIITPHCLKQ
FT                   LYNIGDYQADPKSGSKIGFASYLEEYARYADLERFEQHLAPNAIGQNFSVVQFNGGLND
FT                   QLSSSDSGEANLDLQYILGVSAPVPITEYSTGGRGELVPDLSSPDPNDNSNEPYLDFLQ
FT                   GILKLNNSDLPQVISTSYGEDEQTIPVPYARTVCNLYAQLGSRGVSVIFSSGDSGVGAA
FT                   CLTNDGTNRTHFPPQFPASCPWVTSVGATSKTSPEQAVSFSSGGFSDLWPRPSYQHAAV
FT                   QTYLTKHLGNKFSGLFNASGRAFPDVSAQGVNYAVYDKGMLGQFDGTSCSAPTFSGVIA
FT                   LLNDARLRAGLPVMGFLNPFLYGVGSEKGALNDIVNGGSVGCDGRNRFGGTPNGSPVVP
FT                   FASWNATTGWDPVSGLGTPDFAKLKGVALGEEGGN"
FT   mat_peptide     join(complement(617181..617214),complement(616137..617113),
FT                   complement(615322..616065))
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z3 "
FT   sig_peptide     complement(617215..617292)
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z3 "
FT   CDS_pept        join(complement(621690..622012),complement(621584..621639),
FT                   complement(620988..621104),complement(620782..620865),
FT                   complement(620558..620704),complement(620244..620337),
FT                   complement(620039..620134),complement(619402..619647),
FT                   complement(619138..619309))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887493"
FT                   /orf_name="An14g02480"
FT                   /protein_id="CAK41985.1"
FT                   /db_xref="UniParc:UPI0000EFC5ED"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z4"
FT                   /transl_table=1
FT                   /translation="MCLGALAYYWYFVAHSRDLINAPMSNENFLSALKPVIGTQLFSIS
FT                   AQLAPEDSREQSQPRPVSNMHQALSPILQGCCSKRITHQCDTTISQGWKMVAKSRLRSA
FT                   GAFRAIVSSGEEITSQGTAELAGIVALTPTATKTTFGEGVLWVDIHPVSQPAQNAHHSK
FT                   ITGRIRYPDFKTSGHCQTEGCGVAASDTDDVSAQDALIYGDNELTPSTIATNLFLGLTL
FT                   SSLARLNLYPVNYTTLLTSRSCAARVPVLKPRDSSVLAIHRLFYLGIVPTKQPSASQLR
FT                   FEQKLVLQPEMVNICTSVWKASTKSHPVLIQGNCIANFKPAFHSSELRYTRYSNASEPS
FT                   NTSLDPCPDRSFQATLHQKSIKTDPYAKRPSYPPEKHALTIGNANNPVVLNPIHRPGIG
FT                   NQDIDVEGLPGQSTKPFSMLQQADTDPYSDIQHYIKPRESNDFSV"
FT   CDS_pept        join(622777..622951,622998..623380)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887494"
FT                   /orf_name="An14g02490"
FT                   /product="Similarity to protein from patent WO200056892-A1
FT                   - Streptomyces albulus"
FT                   /protein_id="CAK41986.1"
FT                   /db_xref="UniParc:UPI0000EFC5EE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z5"
FT                   /transl_table=1
FT                   /translation="MFSPKHPRACALAANPQLLEDITFFPLDKSLYHTSHSDFPIDLTD
FT                   ILHFPQLNFIPPQEYKMSRARRESFQALKKWVFDRNSQVKKIAAGQGIAGTRAAPSQSG
FT                   SNDSKIGSRLDNGETFTKDGKEYKRYKWQINKNAENATLKDIASKDSHKVWAEADIPIT
FT                   SDNSKAKATVSQLFDDLEESMK"
FT   CDS_pept        join(623881..624240,624309..624657,624747..625669)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113562"
FT                   /orf_name="An14g02500"
FT                   /product="Similarity to hypothetical protein YER080w -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAK41987.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0000EFC5EF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z6"
FT                   /transl_table=1
FT                   /translation="MSPHPDRLSNTNLGKPFHTDWNTIHDWHSYTRGRFLLNEAHELRI
FT                   RRADFNMNELAKCAAEAVGFTFSDCVRIEKFSDGMFNKAFLFTMQDGTQVVGKVPNPNA
FT                   GRPHYTTASEVATMDFVRNELSTPVPKVLAWSSKADGNPVGSEYIIMEKVGGVQLDKIW
FT                   PQMDIKKRFELIKTISRYQKAWMSKSFTQYGSLYFSSDLQDHRGCIIVNEDGSQSEYDR
FT                   FAIGPTTGREFLDDGNDLLSYKSAVGFRELACVQNMTQLPRSLLGLYGPGTYQPSRPKK
FT                   VAAIQDYLSLVQFFLPTDDSICSAFLWHPDLHTENIFVDPDRPSEVLGIIDWQSSEVLP
FT                   LFDHARQPYLLDYDGPPATGLDPPEFPENFDQLDPPEKAKAERLYLNISLATLYRKLTY
FT                   AKNKKLFGAMEFQQTSSFDMMLFAQNLLIDGEALYRARVLELGDEWPCLPGVQASGNPP
FT                   FPLEYSPEEVNSIEEDANGATRSMALMQGVKESLGELWPEKGIVPPERYDDARKLLKQV
FT                   KTELIDQLAQSDAERLEWEKAWPFDD"
FT   CDS_pept        join(626619..626983,627033..627294,627420..627654,
FT                   627793..627998)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962554"
FT                   /orf_name="An14g02510"
FT                   /protein_id="CAK41988.1"
FT                   /db_xref="UniParc:UPI0000EFC61A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z7"
FT                   /transl_table=1
FT                   /translation="MELLGRRVRPLIEDFCRKVKDATPGSLIPNTWKFGQRSLRVILDK
FT                   ESWSRLLTYFDVPTGLTVERARSIRTANSLAELRIAFREYYMSCLPPSHRIAFHKFRED
FT                   GLLLPFGHPRHEFRVPNPTLFHSRDIWPVRDNADPREGWEWKQVHDTSSGPATADIYGK
FT                   LFYHVRGVLQSFLCRVSDLELSLTLHHLDALELPNYLPVNHFDRVDVSNVSDQGYLGIH
FT                   RTLNATVPLLQTPVDNPHATLITFFLNAVNETLTAQDKAKETFELHTNKHLSGYLPSEE
FT                   QSIITQFKHRMREAAKSMGTVMKQSHTIVEKWPFRMKLQPGQPVTQAEFDQCLAIGVTG
FT                   KERYIEWKRIQHVAN"
FT   CDS_pept        join(629471..629488,629535..629711,629801..629931,
FT                   630019..630184)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113563"
FT                   /orf_name="An14g02520"
FT                   /product="Similarity to hypothetical protein T04D1.4 -
FT                   Caenorhabditis elegans"
FT                   /protein_id="CAK41989.1"
FT                   /db_xref="UniParc:UPI0000EFC61B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z8"
FT                   /transl_table=1
FT                   /translation="MERKSSPSHSPPYIRLPGYACFHLKGTALWTIIIRYHDSLGAAGN
FT                   SGSERQNRYLVIPRASGCSLAVAAGPGAACSWANNRHIQIYMMVRFFCGSQGHVRSLLP
FT                   SPYHGYLEVKDDRRGGWGNHEEIGPVEAWRVVWCRDVIDSGLSVSYQISEQPARVTVTL
FT                   "
FT   CDS_pept        join(complement(632295..632320),complement(631917..632205))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656695"
FT                   /orf_name="An14g02530"
FT                   /product="Similarity to protein serine/threonine kinase-1
FT                   psk1 - Plasmodium falciparum"
FT                   /function="kinase activity"
FT                   /protein_id="CAK41990.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="UniParc:UPI0000EFC61C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R2Z9"
FT                   /transl_table=1
FT                   /translation="MPKTTSSTSTTRSITSLSTISEADYYSDAGRRQSGTRSTSSNTNQ
FT                   ESTQKLKHRNLENLHRYRDGPRWEDPYCLVERETNGKRVARMRDEFRKVEEVLGLGDEK
FT                   "
FT   CDS_pept        join(complement(634421..634750),complement(633740..634360))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171267" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887495"
FT                   /orf_name="An14g02540"
FT                   /product="Similarity to sterol regulatory element-binding
FT                   protein-1 SREBP-1 - Mus musculus"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK41991.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG327458"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI0000EFC61D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R300"
FT                   /transl_table=1
FT                   /translation="MAYPRPDSFSLDDERMYSMSHPSPLTRPNDTFAKGPDPLSANWSY
FT                   DNAIDLFSLNTMMPETFPLEMSNEMMNLDPKDFPADFFAPPPDISAFTISNHSGEDAAS
FT                   CGSLSSDLDSDDQSWSPTCRVSPLEPIHMELPKPAARTSRTSTRRKTASQPKPREVTAT
FT                   RWSSSPEITPQDYPATSVSPPPAPSSPAANNTARKTTRSLSSDSNASTGQAQTTTGRNA
FT                   AKRAAHNIIEKRYRTNMNAKFVALEKAMCGGVQKPTKGGSASLKKSEILTNAITFMQEL
FT                   QEENKVLQKELAMLKQSMVPNGMWRHSKGSEAFHA"
FT   gap             635261..635360
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(637215..637391),complement(636968..637182),
FT                   complement(636642..636729),complement(636404..636464),
FT                   complement(636238..636254),complement(635958..636173))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887496"
FT                   /orf_name="An14g02550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46503.1"
FT                   /db_xref="UniParc:UPI0000EFC61E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R301"
FT                   /transl_table=1
FT                   /translation="MLQGQLPDEPESCHENKSNPSISGEMIGQRWSSITRGGQQAYGRR
FT                   RREEFCDPWRSQATEGVLKKPDHTTGGIAADPGHPVSGPPGETIGGEIGGKEARTLLNE
FT                   VIFSTSEAEKFTSVRAGPVGSLVGDFMSKELVEKEVARTPNVPGDWLGPSVGYEMCTGI
FT                   VHPSYGLHGLRRGQSRRIHKYTIYNSVYSGGTRDGKGTVQVVWLVICNPRLCLRQTVGS
FT                   ELTLSICIITREHKGHTGEAMEARTDPLAAATEGT"
FT   CDS_pept        join(complement(639155..639412),complement(638418..639095))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171278" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887497"
FT                   /orf_name="An14g02560"
FT                   /product="Similarity to protein from patent EP0845532 -
FT                   Pseudomonas sp"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK46504.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG327460"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC61F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R302"
FT                   /transl_table=1
FT                   /translation="MAKIGVFPAAGGLGTSIINHLVKLVPASELILIARKPDNLAELTR
FT                   AGATVRRADYEDPATLERAFDGIGILMLISYASFEIQFRFEAHKNAIDAARRSGVKHIF
FT                   YSSLAFAGDLEETSVAHVMGAHLRTEKYLAELPGHFTYTAIREGLYSESYPIYTSWFDI
FT                   HHPADEIAIPHSGDGPGVAWVKRDELGEATAKLIADCAKNPAGFPYLNRVLLLSGPREV
FT                   SLKETVEILGQAVGKSLPLREISVDEYVALPQHGSKHTYHGIDLTREWASAWDAIRRGE
FT                   TAVVSPLLEEILGREPESFETTVKALAGSK"
FT   CDS_pept        join(complement(642473..642786),complement(641199..642426))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887498"
FT                   /orf_name="An14g02570"
FT                   /product="Similarity to EST Nig077 - Aspergillus niger "
FT                   /protein_id="CAK46505.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0000EFC620"
FT                   /db_xref="UniProtKB/TrEMBL:A2R303"
FT                   /transl_table=1
FT                   /translation="MSPSSKQNIFIYADFDHEAVCRRASTLRQGIPCTCDLSQRPASGS
FT                   FNWAIFILFEDGVQWVFRSPHQRTSMPLDLGVKLLASEAATLRYLKAHSDIPVPEVYDY
FT                   CASSDNETKVPFMLMSQAPGWPLSKVWVTAGSPLPDLDPSRKARVLTQLGGTTWKLSQL
FT                   RLDRIGSLFEEDGAFKIKGCLWRCYMLHERFLIEGQRGPFATDAEFYDSLVSTFLEQAE
FT                   CLRLSHHCFVAPVPSREDYDSDKQHRQAVDLWNDFVTVGGKIDSADNRLDYIVAGNALR
FT                   DIVHKLEHPTVHQGTFPLCHADLSVNNIYVDDDYNITCIIDWAFTSSVPDSMLLVPPGL
FT                   PQYGDKISPELHAAFVDGFLAAIPGSAETSMVRRYRETLEQGHFYWNLSRLLGLDSIGD
FT                   YNLFATVWQSTSGPAKGIGEYFLQQRRLPRYLQLYDEVQQEDRPLWKVEGDEKDYFRNN
FT                   VFKHTIAKKMTLMSEWKAEYAAEPPRRIRQDMFVASPNLWKWVLQFMEDWEEKLR"
FT   CDS_pept        join(complement(644470..644581),complement(643976..644385))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809349"
FT                   /orf_name="An14g02580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46506.1"
FT                   /db_xref="UniParc:UPI0000EFC621"
FT                   /db_xref="UniProtKB/TrEMBL:A2R304"
FT                   /transl_table=1
FT                   /translation="MTINSQVALRFQVVTSSPGIRSQIIIVSLPVIYPNRADAICGEFV
FT                   ISWPVTGLYEELSSSPSPILILNSPHQRRSVTEVFTVFSPAGVVVALAQTLSQPTSDPR
FT                   EGGRIMRGAMTAAACWRPGLSIEVSYMGKEPANCGELSDNGKRFSMVASAEHNRWLFCL
FT                   IGREHRGHAR"
FT   CDS_pept        join(645242..645401,645496..646952)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656696"
FT                   /orf_name="An14g02590"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK46507.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EFC622"
FT                   /db_xref="UniProtKB/TrEMBL:A2R305"
FT                   /transl_table=1
FT                   /translation="MPMDLENNGPIKPIQSVDQSVQDAHDLAAMGHDQAMTRKFDIWSM
FT                   LSLAFCVLGTYSTFAQDLDSGLTNGGSVTILWGLVLVTVCNLCVAVSLGELTSSMPTAL
FT                   GQAYWVFRLWDTPLGRFTSYMCAWINMFGWWTLTASQVAFMAEFLLGMKVMFDNSWGGA
FT                   STGWLNFIVYIGTVLVLTVINLVGCRKEKVLPWLNNFVGIWFTGLFVVLSLALLISVGV
FT                   KKDLSFQPASFVFGAWLNETGWGNGVVWFTGLVQAAYGLTAFDAVIHMVEEIPAPRRNA
FT                   PKVMWLSVLMGAITGFIFMMVCLFCIQDINEVINSPTGLPFMELMVETVGLEGGATLIA
FT                   LFIFNGLGQGISILTTASRLTWGFARDGGLPWSGYFMLVDPVWKVPARALWFQGFWIAL
FT                   VGILYLFANTVLDAILSVSTIALTISYGLPIAALLVVGRDKLPPGQFHLGRWGKLINWV
FT                   SIIYCIITTVFFLFPGSPNPSPSDMNYAIAVFGVMLVVAVGFWFVQGNRTYLKTEDAID
FT                   QMIQAQRLEINTATQAQDKKK"
FT   CDS_pept        join(complement(648272..648313),complement(648145..648188),
FT                   complement(647997..648067),complement(647803..647899),
FT                   complement(647131..647308))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809350"
FT                   /orf_name="An14g02600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46508.1"
FT                   /db_xref="UniParc:UPI0000EFC623"
FT                   /db_xref="UniProtKB/TrEMBL:A2R306"
FT                   /transl_table=1
FT                   /translation="MAPGIEMQQEVQHHAPRALTEPSADLAHEPLLAKVSKDRLQVMHT
FT                   YVASLSIGCGTLIKSGLGPLGHPVPVPVFHSRVSIQGASSILRVKEHRHERSGAIRGVM
FT                   AHNTWRARPLGSWAILTDLHTLFALSPQNVQLSILHVAY"
FT   CDS_pept        join(648681..648878,648929..648973,649026..649436,
FT                   649490..650034,650085..650590,650640..651249,
FT                   651298..651572,651620..651795,651842..651935,
FT                   651983..652290,652341..652547,652597..652756,
FT                   652803..653242,653292..653390)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887499"
FT                   /orf_name="An14g02610"
FT                   /product="Localization: integral membrane protein "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46509.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0000EFC624"
FT                   /db_xref="UniProtKB/TrEMBL:A2R307"
FT                   /transl_table=1
FT                   /translation="MDTSSSSGTVDVEPGNSSIPKQLTLTWRNVSVNVTAPDAALGDTL
FT                   LSVADPRQISGWFSKSQRPKRTILKDISGQLRPGEMLLVLGRPGSGCTSFLRVISNDRE
FT                   AFDEVVGETRYGSMDHKQAKKYRQQIMFNNEDDVHFPTLTVNRTMKFALRNKVPRERPE
FT                   HLHNRKDYVQEKRDGILESLGIPHTKKTLVGNEFIRGVSGGERKRVSLAEVMAGQSPVQ
FT                   FWDNPTRGLDSKTAVEFARMLRREANENQKTIMATMYQAGNGIFDEFDKILVLAEGVVT
FT                   YYGPRALARGYFEDMGFICPKGANIADFLTSVTVVTERIVAPGMEDKVPNSPAEFEARY
FT                   RQSAIYSQMMNDIQPPEKLVNEDENLALAVAMEKRKQHVPRPQSVYTAGLWDQILSCTL
FT                   RQFQILAGDKLSIAIKVVSAILQALVCGSLFYNLKLDSSSIFLRPGALFFPVLYFLLET
FT                   MSETTGSFMGRPILSRQKRFGFYRPTAFAIANAITDIPIVLVQVSCFSLILYFMSAMQM
FT                   DAGRFFTYWIIIIVQTLCFMQMFRAIGALCKQFGNASKMTGFLSTVFFVYGGYLIPFEK
FT                   MHVWFRWIFYLNPGAYAFEALMANEFTGLELKCVEPDYIPYGSGYPTGSSPYRGCTVKG
FT                   SNSEGIIDGAAYIKEQYNYTYHHVWRSFGIIIGFWAFFIFLTAIGFELRNSSAGSSVLL
FT                   YKRGAKSKKPDEESNVSSKSEGAVLAQSGKQSTFTWNNLDYHVPFHGQKKQLLDQVFGY
FT                   VKPGNLVALMGCSGAGKTTLLDVLAQRKDSGEIYGSILIDGRPQGISFQRTTGYCEQMD
FT                   VHEGTATVREALVFSALLRQPDSVPREEKIAYVDHIIDLLELSDIQDALIGVPGAGLSI
FT                   EQRKRVTLGVELVAKPTLLFLDEPTSGLDGQSAYNIIRFLRKLVDSGQAVLCTIHQPSA
FT                   VLFDAFDSLVLLAKGGKMTYFGETGEESHKVLEYFAKNGAPCPPDMNPAEHIVEVIQGN
FT                   TEKPIDWVDVWSRSEERERALAELEALNKEGQSHTDYVEDQSNFATPVWFQFKMVLQRL
FT                   MVQLWRSPDYMWNKIILHVFAALFSGFTFWKMGDGTFALQLRLFAIFNFIFVAPGCINQ
FT                   MQPFFLHNRDIFETREKKSKTYHWIAFIGAQAVSEIPYLIICATLYFACWYFVAGLPVD
FT                   AYISGHMYLQMIFYEFLYTSIGQAIAAYAPNEYFAAIMNPILIGAGMIAFCGVVVPYDS
FT                   ITPFWRYWMYYLDPFTYLVGGLLGEVLWDVKVQCEPSEYIQFNAPSGQTCGQYMAEFIS
FT                   EQTGYLLDANATGTCSFCQYSMGSDYAKTFNLKEKYYSWRDTGITALFCITSYGLVFLM
FT                   MKLRSKKTKSARSE"
FT   CDS_pept        join(complement(654043..654566),complement(653942..654011),
FT                   complement(653596..653784))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887500"
FT                   /orf_name="An14g02620"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An13g01640 - Aspergillus niger"
FT                   /protein_id="CAK46510.1"
FT                   /db_xref="UniParc:UPI0000EFC625"
FT                   /db_xref="UniProtKB/TrEMBL:A2R308"
FT                   /transl_table=1
FT                   /translation="MFGLTFTNYFLEISIVGVGWAGMVTGQSLVLWSRLHLVLHHKKIL
FT                   RGLLYLIIFDGVLLHCASEGLELAVNAMPDSEPVNVAFGIMERVQLVWFCAQELLLSGL
FT                   YIRETARMLRMDSGELSRSVLVQLLLVNVVIIVLDLSVVGIQYAGFFTFQVTFKALVYS
FT                   IKLKLEYVILGRWIRRDLGSDFGFLVKRDGTQLALILQHDLHHVWVCLNSYSPRNLVHM
FT                   FTLATILLTSIVAFTLPSLDLTTILVPAITFKVYVEGM"
FT   mat_peptide     join(complement(654043..654488),complement(653942..654011),
FT                   complement(653599..653784))
FT                   /db_xref="UniProtKB/TrEMBL:A2R308 "
FT   sig_peptide     complement(654489..654566)
FT                   /db_xref="UniProtKB/TrEMBL:A2R308 "
FT   CDS_pept        655590..656462
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887501"
FT                   /orf_name="An14g02630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46511.1"
FT                   /db_xref="UniParc:UPI0000EFC626"
FT                   /db_xref="UniProtKB/TrEMBL:A2R309"
FT                   /transl_table=1
FT                   /translation="MIPTKRMDLTGRKPLYRLSATPAPPTTPQTSNVKPAAQTPTHPPA
FT                   PQYQPWQQTPPHPYPALSPHGQPSQVLSPYNETNHGTDMQAARRRGRMLFENELIILFK
FT                   GCIERKDMYLTNPNRNAFWDNVAGYMNSFTGRNFSPPSYQQIVTDRSIERRTHRRDIAN
FT                   GKAHVEPPNALTTVIDQWIAMEDDILKQTSESEFLSQKRPAPDDPSTQDANQAKRLRPH
FT                   TADAPQATPSSPSQVRREVDGNSLARALVHEVRDLRREVEEVHRKLDLVLETLKAVKES
FT                   PDNVNSEER"
FT   CDS_pept        join(656680..657702,657739..657879)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267327" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656697"
FT                   /orf_name="An14g02640"
FT                   /function="5-methyltetrahydropteroyltriglutamate-
FT                   homocysteine S-methyltransferase activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /protein_id="CAK46512.1"
FT                   /db_xref="GO:0003871"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="HOGENOM:HBG327468"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="UniParc:UPI0000EFC627"
FT                   /db_xref="UniProtKB/TrEMBL:A2R310"
FT                   /transl_table=1
FT                   /translation="MAPTFRAEQIGSLMRPEELLAARNAAGLAHIYTRTNVPEGVQQVT
FT                   KQAIAKVVEQQQAHKVRPIMTGEFERPIFYAGFFENLEGLEMTKVPIPDGYRTGLPTVQ
FT                   TLEKLGVKERDACIAVGKIQHVRSPYLADWEYLRSLVPQEQWKECKMSMPSITWQHQHL
FT                   RAGTAFTASSPYTTDKEYFADLAKAFAREYQILYDAGLRSIQVDDPAMTFFVTDEMRSG
FT                   CVADGIDPDELLDLYIWAHNESLRDRPADLHVGVHLCRGNMPGSTHVLSGSYERIAQRM
FT                   FTGLNYDTFYLEYDTERAGDFQPLRHLPVGKNVVLGVVSTKAPELETVEELQARVYEAA
FT                   DVLDSSLGVSPQCGFSSVSYGRGIGMTETRMWEKLQLVQKVAERVWQ"
FT   CDS_pept        join(658367..658471,658537..659257)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887502"
FT                   /orf_name="An14g02650"
FT                   /product="Putative frameshift"
FT                   /EC_number="3.1.3.2"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="CAK46513.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="UniParc:UPI0000EFC628"
FT                   /db_xref="UniProtKB/TrEMBL:A2R311"
FT                   /transl_table=1
FT                   /translation="MRLGRAQHSHFVQRAHCGRPLGRDICARRESKRNRFRRRNTHSPD
FT                   LPCEFDSCPSGSPAVGHNSSQPRFNYVNSYPATSMKYGLNNLSSTYFSGSPDLAVAGPN
FT                   VGANLGLAVFFSGTVGATTYAANQGIPAIAFSGYTGSQIAWNVSSVPTYSTVYAELATK
FT                   LVDELVESGTPYLPEGVWLNVNFGAVSDDSCTSADDFEFVLSRLFTAIPLITADDVETC
FT                   NSTRLPTELSVMLQDGCWASVSVGMSGDKLDANATVQGVVLEKLGGLLTCLD"
FT   CDS_pept        join(659814..660043,660132..660642)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887503"
FT                   /orf_name="An14g02660"
FT                   /protein_id="CAK46514.1"
FT                   /db_xref="HOGENOM:HBG327470"
FT                   /db_xref="InterPro:IPR008701"
FT                   /db_xref="UniParc:UPI0000EFC629"
FT                   /db_xref="UniProtKB/TrEMBL:A2R312"
FT                   /transl_table=1
FT                   /translation="MSLRTLLLAASTLSATAAAGKHRLHARDWIASDEIVGFNQTVPDN
FT                   STGDLYLAYQPYLKVVNGCVPFPGVDAEGDTDAGLAPTGASDGDCSSNTGQIYVRSNIT
FT                   STSSTSTYPTALLYSWYMPKDEPSDGLGHRHDWEGVIIYLSDATTISADNILAVCPSAH
FT                   GGWDCSTDGYTLEGTKALIKYESIWPLDHSCGLTDVVGGTQPLVAWESLTTAARDALQT
FT                   ADFDKAIVPFKDSTFDENLAKATY"
FT   sig_peptide     659814..659867
FT                   /db_xref="UniProtKB/TrEMBL:A2R312 "
FT   mat_peptide     join(659868..660043,660132..660639)
FT                   /db_xref="UniProtKB/TrEMBL:A2R312 "
FT   CDS_pept        join(complement(661351..662226),complement(660991..661164))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887504"
FT                   /orf_name="An14g02670"
FT                   /EC_number="3.2.1.-"
FT                   /function="cellulose binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK46515.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="HOGENOM:HBG324252"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR005103"
FT                   /db_xref="UniParc:UPI0000EFC62A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R313"
FT                   /transl_table=1
FT                   /translation="MRQAQSASLLAALLSATQVAAHGHVTNLVVDGVYYEGFDISVFPY
FT                   ESDPPKVAAWTTPNTGNGFISPDEYRNPNIICHENATNAQAHVVVGAGEKINIQWTAWP
FT                   DSHHGPVLDYLARCDGSCETVDKTDLEFFKIDGVGLVSDTEVPGTWGTDQLINNNNSWM
FT                   VEIPPSIAAGNYVLRHELIALHGAEEQDGAQNYPQCFNLQVTGTGTATPSGVKGTELYT
FT                   ATEGGILVNIYSSLSTYTMPGPTAYSGDVSITQTTSAVTSTGTAVVGSASAVASASSTA
FT                   AAATSAAAVTSSTITPAPAVSSAASGSSGSQSLYGQCGGINWTGATQCASGSSCHSYNP
FT                   YYYQCIASA"
FT   mat_peptide     join(complement(661351..662163),complement(660994..661164))
FT                   /db_xref="UniProtKB/TrEMBL:A2R313 "
FT   sig_peptide     complement(662164..662226)
FT                   /db_xref="UniProtKB/TrEMBL:A2R313 "
FT   CDS_pept        join(complement(664017..664167),complement(663858..663917),
FT                   complement(663542..663648),complement(663414..663491),
FT                   complement(663069..663260),complement(662976..663023),
FT                   complement(662484..662714))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887505"
FT                   /orf_name="An14g02680"
FT                   /product="Similarity to hypothetical
FT                   xylosidase/arabinosidase - Streptomyces coelicolor "
FT                   /protein_id="CAK46516.1"
FT                   /db_xref="UniParc:UPI0000EFC62B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R314"
FT                   /transl_table=1
FT                   /translation="MGIYSYPDSTRRKPGDAWIQKDIAEDVIISPGATIPWSRIGMGRR
FT                   VIDSGGCIDAVFSCLIVLIPLPIFSALQVAHIGSIPRSPAYSEPVVTAMPTRVISGKQA
FT                   VQGPHLTRFAKGSLPWRVIQRCRYVSLKGTPYTAVLARSRLRRGPWPAKALPNKARQPN
FT                   LLTNTLQLYYHPKQDDGPLMDVIGEYRGFPIDVERRLFSIKGRDWWGRPKVVGRPEWKL
FT                   SDSQDPSRVIALISDGSGTLAPALPPFALTLIAPALPKGPIRTRNQGRWSDQTPGWVSW
FT                   LQPRFEM"
FT   CDS_pept        join(664805..665010,665063..665189)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113564"
FT                   /orf_name="An14g02690"
FT                   /product="Similarity to hypothetical protein MT4026.1 -
FT                   Mycobacterium tuberculosis"
FT                   /protein_id="CAK46517.1"
FT                   /db_xref="UniParc:UPI0000EFC62C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R315"
FT                   /transl_table=1
FT                   /translation="MEIPCTPQMTQTDTSPAWRYAQPSFAANPDPTDHWFVLGRGAQTA
FT                   LSGRQAAESRSSQRRLPISPPNSGYTRLPGKVERRVTLCYTYSQRDSRLSGDVVQQRYR
FT                   PWPPQP"
FT   CDS_pept        join(665654..666038,666092..666155,666205..666648,
FT                   666706..667312,667366..667701)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887506"
FT                   /orf_name="An14g02700"
FT                   /product="Function: itr2 of S. pombe is a transporter for
FT                   myo-inositol"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46518.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG324208"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC657"
FT                   /db_xref="UniProtKB/TrEMBL:A2R316"
FT                   /transl_table=1
FT                   /translation="MGDKKRDPENPISMVHHLESPTSNEKQDPEVARNWTRELTESKDA
FT                   TTSTKLKNPLAGLTRDELFRDVESFARDKGLEHIMDELKRGSLVAQDPKAFESLEELSE
FT                   SDKELLRREKTHRWSQPFMMYFMTILCAGSAIVQGMDQTAVNGAQEFYFAEFNLTNTWQ
FT                   QGLLNGAPYLCSALIGCWTTAPLNRWFGRRGCIFISCLISFASSFWMAAAHTWWNLLLG
FT                   RFLLGFAVGAKSTTTPVYGAECSPAIIRGALVMMWQMWTAFGIMLGYIASVAFMDVTHP
FT                   SIPGFNWRLMLGSTAIPPFFVCMQVYFCPESPRWYMMRNRYQDAYKALCKLRPSSFQAS
FT                   RDLYYIHAALQVEEKLREGKHLWREMFTVPRNRRAAQSSFFVMFMQQFCGVNAIMYYSS
FT                   SMFADAGFDRRMALVTSLGCGITNWIFALPAVYTIDTFGRRNLLLTTFPLMSLFLLFTG
FT                   FSFYIPDQTSRTACVATGIYLFMVVYSPGEGPVPFTYSAEAFPLYIRDVGMSFATATTW
FT                   GFNFIVSLTWLPLRDAFSPQGAFGWYAAWNVFGWIFCYFCLPETKALSLEELDQVFSIP
FT                   TRKHVNHYVGMLPWYVKKYILRGDVPPQKQLYDYE"
FT   CDS_pept        join(complement(668774..668871),complement(668431..668704))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887507"
FT                   /orf_name="An14g02710"
FT                   /product="Similarity: the predicted ORF shows a weak "
FT                   /protein_id="CAK46519.1"
FT                   /db_xref="UniParc:UPI0000EFC658"
FT                   /db_xref="UniProtKB/TrEMBL:A2R317"
FT                   /transl_table=1
FT                   /translation="MAPTQQRSLLATLTAVFVFLMQADPTSGAGFTCAGTGCIAAVLLV
FT                   GINAVMHVHGESGKTGAMTPAKRDEGSIAFNHITHEGVVHSFINTTALTHDWHFVHAVN
FT                   QPVNLTVRRLSDGRIHART"
FT   mat_peptide     join(complement(668774..668787),complement(668434..668704))
FT                   /db_xref="UniProtKB/TrEMBL:A2R317 "
FT   sig_peptide     complement(668788..668871)
FT                   /db_xref="UniProtKB/TrEMBL:A2R317 "
FT   CDS_pept        join(671492..671688,671746..671759,671815..671887,
FT                   671943..672274,672323..672466,672517..672731,
FT                   672778..672975,673025..673052,673101..673216,6
FT                   73266..673349)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962555"
FT                   /orf_name="An14g02720"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46520.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG332600"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0000EFC659"
FT                   /db_xref="UniProtKB/TrEMBL:A2R318"
FT                   /transl_table=1
FT                   /translation="MAHPTGDKVDSHLNVQTGQFFQDGREEPYLHDAEEKQDEKKGSPI
FT                   YNDTFGDEEYAEVKYKVLSWWQCGFLMVAETVSLGILSLPAVVATLGLAPAIVLIVGLG
FT                   LLATYTGYVIGQFRWRYPHVQNLADAGEILFGSIGREIFGIGQLLLVIFIMASHLLTFS
FT                   VAMNTITEHGTCSIVFGVVGLVICFLLGLPRTSANVSYLSVASFISVFSAVMIVMIAVG
FT                   VERPYKGTLSATVDTSLYEAFLAVCNIVFSFSGHVAFFGFMSELKDHREYPKALCLLQG
FT                   LDTILYLVTSVVIYIYAGPNVTSPALGSASELVGKVAYGIALPTIIIGGVVNGHVACKY
FT                   VYVRIFRHGDRMHSRDLLATGSWVGIALGLWIIAWIIAEAIPVFNDLLSLIASLFASWS
FT                   TFGFSGMFWLYLNKDRLFSSPRKIALTIFNVIIIGIAACICGLGLYVSGRSLHDDANGS
FT                   SFSCASNA"
FT   CDS_pept        join(complement(674213..674269),complement(673946..674046),
FT                   complement(673841..673921),complement(673671..673753),
FT                   complement(673502..673650))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887508"
FT                   /orf_name="An14g02730"
FT                   /product="Similarity to thioredoxin reductase tr/trx -
FT                   Mycobacterium leprae"
FT                   /protein_id="CAK46521.1"
FT                   /db_xref="UniParc:UPI0000EFC65A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R319"
FT                   /transl_table=1
FT                   /translation="MADNLKLSRLCASECLRFMIGHAVNGGVFEQGLDQTNTTTTIIII
FT                   VGKGVRVGPGHVPRSLALNAGTPHIHSQIDNSLVGDSLFILSFSFCALTSAVKISADRH
FT                   KRSMSDRQDGAAAVILADPWRGLGAGAWGNFRVRLAASWGSGICGDSLLIRW"
FT   CDS_pept        join(675426..675525,675579..675686,675737..676277,
FT                   676330..677188)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887509"
FT                   /orf_name="An14g02740"
FT                   /product="Function: high affinity glucose transporter. "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46522.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC65B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R320"
FT                   /transl_table=1
FT                   /translation="MSSVPTFAGLSGRKLIWSVTSCATLGFLLFGYDQGVMSSIIDADP
FT                   FNDIFTATRDNSTIQGVVTAIYELGCLGGALFILACGDWLGRRYSIMLGATIMIIGVII
FT                   QVTSISGHVPLAQFCVGRVITGVGNGMNTSTIPTYQAECSRTSNRGLLICIEGSTIAIG
FT                   TLISYWVDFGASYGPPDLTWRFPIAFQIFFGLLIILGLLVLPESPRWLFTQERYEEGER
FT                   VIAALQGKEISHHEVQLQKTIILDSLRASGMATKSTPLSAVFTGGKTQHCRRMLLGCSS
FT                   QFFQQIGGCNAVIYYLPVLMQQSLHQTEFMAMILGGVNMIVYSIFACSSWFLIQKVGRR
FT                   NLFLVGSFGQSASMVITFACLIPGGPEAAKGAAVGLFTFIATFGATWLPLPWLYPAEIS
FT                   PIKTRTKANAISTCTNWLFNFLIVMVTPIMIRNIGWGTYLFFAVINALFIPVIYFFYPE
FT                   TKDRSLEEIDLIFAKGYIEKMTYVRAAKELPHLSDEEVEQVAIQYGFGPADQPASGDSE
FT                   STETGAGRTEVEVEKRSE"
FT   sig_peptide     join(675426..675525,675579..675592)
FT                   /db_xref="UniProtKB/TrEMBL:A2R320 "
FT   mat_peptide     join(675593..675686,675737..676277,676330..677185)
FT                   /db_xref="UniProtKB/TrEMBL:A2R320 "
FT   CDS_pept        join(678710..678784,678820..679033,679103..679201,
FT                   679232..679276,679393..679499,679583..680267,6
FT                   80319..681154)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203751" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887510"
FT                   /orf_name="An14g02750"
FT                   /product="Similarity to ABC transporters "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="CAK46523.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="UniParc:UPI0000EFC65C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R321"
FT                   /transl_table=1
FT                   /translation="MESAATIQCTSQQTRFHIESPNYREDQEVLCVDCPCLQLDIKGLQ
FT                   ILVTSGDKKSTAKGKSKAKSKDGIEILSNAELSLKEGRRYALVGRNGTGKSTLLTSIAE
FT                   KLIPGIPENTKIAILQQTRLTDGADGLSVLQTVIERATSRTLRSLKHERLQKRLFILDK
FT                   DARLRSGMRGMQARKALSFRTDNFLRLEQSSEDISAETLQQETREAVDMLAHLQAQIEP
FT                   ALVAQTETRARSILTGLGFSSAMMAKPISDLSGGWHMRAALASTLLQDADILILDEPTN
FT                   FLDMLGIIWLQRYLTSLEENRKPPTMIIVSHDRDFISLCTDLIILKDKQLTYFHGDLPT
FT                   YETSQSERRKYLTTMKEAQDKQKAHIEKTIAANLKAGKANDDQNKIRQAKSRQKKLDNR
FT                   WGMEVGARGDEIEIPPEERPVIINLPEPPDLRFPGSLITLEKVSFRYSATSPIVIRDVD
FT                   LSVGMGDRIGILGLNGAGKSTLIQTLVGETTATQGTRNTHPRLRLGYYSQHGVEALQAL
FT                   GAQEETLTALTLLTREVNGELTEGEVRGLLSQLGLPGRLASDVPIRKLSGGQLVRCALA
FT                   RLFWRRPHCLVLDEVTTHLDYETVTALRRALNEWDGAVVAVSHDRWFMRGTVEGVVDGG
FT                   QSEGEEDDSEDELEERRRVICMVRSGELSVLGRGVDEFEERMERRVRKLID"
FT   CDS_pept        join(complement(682702..683108),complement(682419..682651),
FT                   complement(682273..682352))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181257" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887511"
FT                   /gene_name="eglA"
FT                   /orf_name="An14g02760"
FT                   /product="Endoglucanase A eglA-Aspergillus niger "
FT                   /EC_number="3.2.1.4"
FT                   /function="cellulase activity"
FT                   /biological_process="polysaccharide catabolic process "
FT                   /protein_id="CAK46524.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0008810"
FT                   /db_xref="HOGENOM:HBG344761"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="UniParc:UPI00003502B3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R322"
FT                   /transl_table=1
FT                   /translation="MKLPVTLAMLAATAMGQTMCSQYDSASSPPYSVNQNLWGEYQGTG
FT                   SQCVYVDKLSSSGASWHTEWTWSGGEGTVKSYSNSGVTFNKKLVSDVSSIPTSVEWKQD
FT                   NTNVNADVAYDLFTAANVDHATSSGDYELMIWLARYGNIQPIGKQIATATVGGKSWEVW
FT                   YGSTTQAGAEQRTYSFVSESPINSYSGDINAFFSYLTQNQGFPASSQYLINLQFGTEAF
FT                   TGGPATFTVDNWTASVN"
FT   mat_peptide     join(complement(682702..683060),complement(682419..682651),
FT                   complement(682276..682352))
FT                   /product="endoglucanase A eglA-Aspergillus niger "
FT                   /db_xref="UniProtKB/TrEMBL:A2R322 "
FT   sig_peptide     complement(683061..683108)
FT                   /db_xref="UniProtKB/TrEMBL:A2R322 "
FT   CDS_pept        join(complement(685036..685479),complement(684774..684974))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962556"
FT                   /orf_name="An14g02770"
FT                   /product="Similarity to hypothetical Stig1 -Petunia hybrida"
FT                   /protein_id="CAK46525.1"
FT                   /db_xref="InterPro:IPR021054"
FT                   /db_xref="UniParc:UPI0000EFC65D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R323"
FT                   /transl_table=1
FT                   /translation="MNLSIFMLLVVAPTLQGIPTLRGNTDYSINGTSNSSTNISAAVPA
FT                   QASTPPPSIPNPDSGLNNLILLLLRLNEQAVVLQKTLSTFDLDNNSIPSIRAQTQAITA
FT                   TGDASIAQALALDYLDTHDSTRVTLKTVALKPIFGHLLTIIKDKKILLCEMEYCKEMHD
FT                   WVGVMRVRALSLCVAVTGIVKIPDGLLIELAWASVDRRFPAILVEFHRPFS"
FT   mat_peptide     join(complement(685036..685428),complement(684777..684974))
FT                   /db_xref="UniProtKB/TrEMBL:A2R323 "
FT   sig_peptide     complement(685429..685479)
FT                   /db_xref="UniProtKB/TrEMBL:A2R323 "
FT   CDS_pept        join(686470..686636,686689..687490,687541..687601,
FT                   687649..687834,687962..688371)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887512"
FT                   /orf_name="An14g02780"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46526.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFC65E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R324"
FT                   /transl_table=1
FT                   /translation="MPSSSSTARASTSCRRCHRRKKRCDRTLPQCETCIHAQVECSFLD
FT                   DDRQVGTYPIAYVQGLECRVKELEKQLSAALASTPYPTLQLDQDFDQPVINFATPPDTD
FT                   ASDTFPIATPPSQSRSDFLVDELKRLSLEAAAERHLGSSSGLSFAKLTQAVLRRLSPDK
FT                   AEFVFDDTPDESPEQYGEPFSDPLLDASTSLWELNNSFSSPCLFNQLPLSHVMEDETTL
FT                   ADLQLPDRAHIEYLMEFYFAHSHTLYPIIRQTEFTSVIWRVYNNPQDPLAGSPLWMFRI
FT                   WMVLAIGSTTHCSVTLGDESESVLYYNKAMGYFEDALGLGDMAALEVMMLQVSYSFFNQ
FT                   VGPNTFFLVGVAARMAIGIGLHSSSSYASLPSDVIEYRKRIFFSLYMMDRYLSPKPTPY
FT                   PLSTLITLHRHHHNRRPKPHNQPLHPTTHPLPPPHRQRNHHSPPLPNEHAQLRPPDNPP
FT                   NSTQEAPPLATHHALPTPTNPIPNPTSNQRLVRSELLHAHDDAVPAISSLPVSRRTESE
FT                   DVSDSCGNGYSAGDESASAGAVRV"
FT   CDS_pept        join(complement(690604..690770),complement(688830..690570))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656698"
FT                   /orf_name="An14g02790"
FT                   /product="Similarity to hypothetical 2 "
FT                   /protein_id="CAK46527.1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000EFC65F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R325"
FT                   /transl_table=1
FT                   /translation="MSVNPSDPRRQNLIGIFGLPGSGKTYLLNQLRRELEGGPFSFYEF
FT                   EEVGQTRPSNWHECDQSGIAGIATANYMLPDEDGHPPYEIILDDGCTNGPFTHIIYLNT
FT                   PVEVVHRRCMDDAEKELDWCSLDYFREWADEEIIGLKDACLDRKIMFTIVDPLDISRII
FT                   TLIHTIQLDRNEEHNQGIVDQRIDEIVAPWQGHVEKVIVMDCDGILTPKYEEQIFWGKY
FT                   YFGDCADVYEGRRQLPDKHPWCGFIADDFDCRQSSLAYEQVAAEGRFDETCEKAASAIS
FT                   LYPEIRSFLNRVSQCPRLRIIIVTSRLRLLWERVLAQEGLSHSIKVIGSGPLSNGHIVT
FT                   PSVKERLVERLRTVHNLQVWAFGGSGSPEKMLQRAHYPIILHRPTNPHCDAEWLSGMAS
FT                   TLKDSKDCIDSTTLHLRELEEPAFFDQLVQHQFTLTHATHKGTAKLLHTEMLKTIYFPN
FT                   HDLEEKVFHEAGWYLANEYISELRGLEEVAIENPQEPKATGYQLVRESGMLIVPLMGNS
FT                   HHMAAGICDVFKEACPLQAYDPEEIDLDHLQEKDTVVLVEAVADSAETITRFVNHIHRV
FT                   KPCLPILIMTGVLQAELVAPGGPLPSLIQGGPITVVALSLAKDKDMTIENYIYDTARIS
FT                   "
FT   gap             691370..691469
FT                   /estimated_length="unknown"
FT   rRNA            complement(692857..692975)
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="An14e02800"
FT   CDS_pept        join(complement(695289..695295),complement(694506..695191))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962557"
FT                   /orf_name="An14g02810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41992.1"
FT                   /db_xref="UniParc:UPI0000EFC660"
FT                   /db_xref="UniProtKB/TrEMBL:A2R326"
FT                   /transl_table=1
FT                   /translation="MTNLKSSIHNSPLPSLEDERYNEIEGVNYTAGYVKQLSSDDELLA
FT                   GAWGMKDTTEIWDLCYRSGPRMTKILEDFVGCMKPSKRAQDDARDILTIDMQLFGWSQD
FT                   MSYISIFDDTEPPKVDWDKVTMSNVIGITAIWTLHEMARIKPAMFRHTYQYIPGERNPF
FT                   KLDPYDLLHGIMLLRWVLRTWNFDRDQQPDRPRPLRAKERRFWRPKARDISFAPLPEPE
FT                   DSEMMDVD"
FT   CDS_pept        join(complement(696539..696916),complement(696276..696395))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887513"
FT                   /orf_name="An14g02820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK41993.1"
FT                   /db_xref="UniParc:UPI0000EFC661"
FT                   /db_xref="UniProtKB/TrEMBL:A2R327"
FT                   /transl_table=1
FT                   /translation="MSGWASGSSRHEGSKPRKRNKDVPPLGLSRITPDMRKRMEEEWIL
FT                   LKGKLFGSFEDTWEHPDGPKEEDSYNDDPYPDESSEEGAHDEEWSDNERSEEGLLDNDS
FT                   FDDEPSNDSSPQDQGFWQYICNDHTDIHGFRSANHEGIHPFGHKGFLRFILIAVEYNEL
FT                   VN"
FT   CDS_pept        join(698112..698289,698402..698595,698705..698761,
FT                   698854..699654)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217470" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887514"
FT                   /orf_name="An14g02830"
FT                   /protein_id="CAK41994.1"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI0000EFC662"
FT                   /db_xref="UniProtKB/TrEMBL:A2R328"
FT                   /transl_table=1
FT                   /translation="MSVTLPSTANWVSPLCLGAMTFDTGHSKRYRHCTKANTCGIPGLF
FT                   CSKSGSFIDTANNIDKMIRFLPVGTAVLQVPNDSRLNYIIMSLEQPNKQIPGVKRPSTH
FT                   SISIGPTSGLTDKRANDNRSLQRRSQPAAAAAPEDNWSGMLAPFLLTNNPLLYSGARQR
FT                   KDVQSSGAANNIHNLSSLSSPHPQSPLPPSGAITCRLSRDEHFRCTFAPPNVHELMADF
FT                   ETGALHSYLGGSPQTDMLLNLSRMNVLRAAYQNAIALGMTAEWLCQDDTISIFSNHGPY
FT                   VVPRNQVSIPYSLRPTALQRATPHHPWLDVFPFPCMRDNLIQAGDDLDDDELCHDMTAF
FT                   WDTRSSNATLLVWGTPWDPKNWEVTEEFAKKWGVFLRGCPEILRSTNSWRARRGERPLV
FT                   WERIFASIDI"
FT   sig_peptide     698112..698192
FT                   /db_xref="UniProtKB/TrEMBL:A2R328 "
FT   mat_peptide     join(698193..698289,698402..698595,698705..698761,
FT                   698854..699651)
FT                   /db_xref="UniProtKB/TrEMBL:A2R328 "
FT   CDS_pept        join(complement(700613..700754),complement(700172..700542))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962558"
FT                   /orf_name="An14g02840"
FT                   /product="Similarity to hypothetical protein EAA58614.1 -
FT                   Aspergillus nidulans"
FT                   /protein_id="CAK41995.1"
FT                   /db_xref="HOGENOM:HBG646910"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0000EFC663"
FT                   /db_xref="UniProtKB/TrEMBL:A2R329"
FT                   /transl_table=1
FT                   /translation="MVSSAVGDEALLSPQSIEATKEDPGCVVFLKENSSVWKNTAKLDT
FT                   LLGAGFLEAGKVVSAVCHGPAALANVKLSNGTYLIAEQNFIGISDVEEDIIQFSRDMSF
FT                   LLETELRKYGGIYEKAVGRFGVKVLTSGENGKLYTGQNTSSSALVGDNIIRAAGMYFAD
FT                   ATKQYLF"
FT   CDS_pept        join(701296..701604,701693..701732,701781..701833)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656699"
FT                   /orf_name="An14g02850"
FT                   /product="Similarity"
FT                   /protein_id="CAK41996.1"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI0000EFC664"
FT                   /db_xref="UniProtKB/TrEMBL:A2R330"
FT                   /transl_table=1
FT                   /translation="MTYTITVVFPNETDAQYDIDYYTNVHMRLIEKHWSKYGLKSWSVT
FT                   KFGPSLDGTAPVYAVGSRVHWESEEGMKRAFESPEVAEVMGDVVHFSNKQPIFLFGETE
FT                   CFFSDSARYPSYERASAPSFTFPISLRLA"
FT   CDS_pept        join(702261..702632,702729..702973,703062..703833)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15887515"
FT                   /orf_name="An14g02860"
FT                   /EC_number="3.8.1.-"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="CAK41997.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG668170"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI0000EFC665"
FT                   /db_xref="UniProtKB/TrEMBL:A2R331"
FT                   /transl_table=1
FT                   /translation="MLLTNATILTLSPTRTILTNGALRTQSSYITDIDKTPILLAKYPD
FT                   EELIDLTGHILIPGLISTHMHTAQTLLRGCADDLELVSWLCERIWVLQGNFTPQDGYAA
FT                   ARLSIAEMLKSGTTCFLESMFADRYGFDGLCRAVEESGIRGCLGKIVMDTGRYAKDDAW
FT                   AMHPGLIEDRETSLLGTMKMWEKWNGKADDRIRVWFGARTPGGVSASLYKEMTALSAKH
FT                   NIPITMHCAEVSADRDFFSSVDHTPMTYCDSVGLLSPSTVLVHMVHLDDGDISLLAKSG
FT                   THVAHCPTSNAKLASGTCRVPDLQRAGVNIGLGTDGAPCNNTCDMLQEMKLAGIIHKGV
FT                   SGNPTVVSAEEVLEMATINGAKALGLQDSIGSLEVGKKADIVAIDARGVEMQPWFNPVS
FT                   AVVYTATGRDVRFVMVDGRVVVREGELVTMDEGEVVREAERRSREVVERAGLGGKVGAR
FT                   WPVV"
FT   CDS_pept        join(complement(705372..705389),complement(704541..705320),
FT                   complement(703872..704495))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888465"
FT                   /orf_name="An14g02870"
FT                   /EC_number="1.2.1.16"
FT                   /function="succinate-semialdehyde dehydrogenase [NAD(P)+]
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK41998.1"
FT                   /db_xref="GO:0009013"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000EFC666"
FT                   /db_xref="UniProtKB/TrEMBL:A2R332"
FT                   /transl_table=1
FT                   /translation="MALDFTTFHNVIDNELTSTTQTRHGINPANCQPNPEVPVSTAEDL
FT                   DRAVDAASRAFRQWSRTSFDERRTVIHSYADLIAANKEGLAALLSREQGKSLSQASTEL
FT                   DMAIQWTRSLSTIAIPKTVVSETEDREVIQRYTPIGVSAAIVPWNFPVLLAIGKIVPAV
FT                   YTGNTIIVKPSPYTPYCDLKLAELAAQCFPPGVVQALSGGDDLGPMITEHPGIQKISFT
FT                   GSIATGQRVMASCAKTLKKVTLELGGNDPCIVCEDVDIDAIVPQIAFLSFLCSSQICMM
FT                   IKRLYVHEKIYDEFRDKLVQHVQSLKMGEGTQPDVFIGPLQNKMQYDKATDLLNNIHSS
FT                   GFSTLCSNSIPDRTGYFITPTIVDNPPATSRVVQEEPFAPILPLLKWSDETDVLARANN
FT                   TDYGLGASVWSRDLQRARRMADQLEAGTVWVNSHFECAPSVPFGGHKKSGLGVEWGLNG
FT                   LTGWCNSQTLWLPKL"
FT   CDS_pept        join(707201..707374,707422..707442,707490..708860)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888466"
FT                   /orf_name="An14g02880"
FT                   /product="Function: S. cerevisiae Mal31 is a high-affinity
FT                   maltose transporter"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK41999.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG327484"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC68E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R333"
FT                   /transl_table=1
FT                   /translation="MGNIPDDKRHTVVQAIPLGVGDEAEFAQEFTRKEHALGFWEAMRL
FT                   HWPAVAWASFMNLATILKGIDGGIVKGLVGLDIFKKTYGYNYHGEYVLAARWISAFQYA
FT                   NLVGAIVGALCSGFAYDRFGPRVMIAVCSSLSIAFIFLQFFSHTPAQLFVGELINGCII
FT                   AFYPICASAYVGEVTPLALRGFAATMTNLAFSIGSLIASGILKGTESLNTTMSYKIPIA
FT                   TQWALPCIMLALIFFCPDPPYWLCRHGRNEAARASLRRLATPAVDVSRQLSHIEETLRL
FT                   EASFQADRPTYRECLRGPNLRRLLICVMAYNMQAFTGNVFFINYAVHFMELAGLDSSHA
FT                   FSMNIGLTALGLVGTCLSWLLLPYVGRRTMYIFGCSALAVVQCLIGVLDVVPRDTATVW
FT                   GQCGLMLACTFVYDLSLGPFCYVLLAEVSSARLRGLTIALATVSCFVWSVVFAVVIPYA
FT                   MNEDEGNWRGKLGFLFAGLGALCAGYCFWCMPETQGKTFEELDVLFEKGVPSRKFKNCV
FT                   VEMQ"
FT   CDS_pept        709697..710728
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113818"
FT                   /orf_name="An14g02890"
FT                   /product="Catalytic activity: S. scrofa LTB4/PGR converts "
FT                   /EC_number="1.3.1.48"
FT                   /function="15-oxoprostaglandin 13-oxidase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42000.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0047522"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC68F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R334"
FT                   /transl_table=1
FT                   /translation="MSNQSLVFKQIPTGYFVPGQDVVVKQASYDASAPAPEGGIFVQSL
FT                   YASFDPYMRGRMRPAHIKSYSPAFTLDAPIDSSIIAKVLRSNTPAYKEGDLIIGFLPIQ
FT                   QYISVSAEQLPRVRALENPLGIEDLRVFIGALGMPGLTAYSSLYEIGKPKKGETIFVSA
FT                   ASGAVGQLVGQLAKHEGLKVIGSVGSDEKLDFIIKELGFDGGFNYKTEKPADALARLAP
FT                   EGLDIYYENVGGEHLEAALNAMNDFGRVVVCGMISQYNGGGYPIKNITNVLTKRLDMRG
FT                   FIVGDKGMGDKYAKEHQENVQKWIKEGTFKTLIHETQGIENAPEGLLGIFHGKNLGKAV
FT                   LKF"
FT   CDS_pept        join(complement(712368..712407),complement(710949..712300))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962810"
FT                   /orf_name="An14g02900"
FT                   /EC_number="1.1.99.18"
FT                   /function="carbohydrate binding"
FT                   /function="cellobiose dehydrogenase (acceptor) activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42001.1"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0047735"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG330950"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="InterPro:IPR008960"
FT                   /db_xref="InterPro:IPR015920"
FT                   /db_xref="UniParc:UPI0000EFC690"
FT                   /db_xref="UniProtKB/TrEMBL:A2R335"
FT                   /transl_table=1
FT                   /translation="MKWLNLLPIALGLANASIISFSPPTNPDIIYSLTIPNTTTLSTPG
FT                   PIYIQITAPTSIQWVGLGQGAQMTGANMFLLYTSSSTKITLSPRSGLGHFEPQYTSNTQ
FT                   ITMLPGTGISTINSTTAALTNSSSSSSDNTRTTMTANFRCDNCLTWQDGTGTMNPKDPN
FT                   FPFIWAYREGVPINSAAMDADISIHDDMGGIQVDLTRAGMPPQPNTSTTEDDQINPFTN
FT                   YNPATDSVPVQAPSTPTSPLPNLTKMTHILITHATLMSLSFVLFYPLAALLMPLPISLP
FT                   VEKFRLHMPLQIFTMLMTLAGFGCGIYLAYETGQLKTAHPILGIIVVGVLVLFQPAMGW
FT                   LQHWGFLRTGGRTVWGVCHRWLGRGVIVVGVVNGGIGLHAARGMGMAPLGAVIGYAVVA
FT                   GVVGVVYVVGVLVGWVVERRRKRVEGERVDGEGVGEVQRGESVEGRDVRENDGEKGGSV
FT                   EERDG"
FT   mat_peptide     complement(710952..712292)
FT                   /db_xref="UniProtKB/TrEMBL:A2R335 "
FT   sig_peptide     join(complement(712368..712407),complement(712293..712300))
FT                   /db_xref="UniProtKB/TrEMBL:A2R335 "
FT   gap             713316..713415
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(714820..715182),complement(714495..714772),
FT                   complement(713926..714444),complement(713657..713874),
FT                   complement(<713416..713603))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809598"
FT                   /orf_name="An14g02910"
FT                   /product="Function: Dal5p of S. cerevisiae is a component
FT                   of the allantoate transport system. "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46528.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC691"
FT                   /db_xref="UniProtKB/TrEMBL:A2R336"
FT                   /transl_table=1
FT                   /translation="MSMENISSTPAGGPDSKGASTAVEDHKPPQDVSHVERVLSPSDKL
FT                   KAPIDANRVDNEVLEYAARGQIEVDEAESRRLRRMIDRRVLVIMIVTYFLQALDKGTMS
FT                   FASIMGIRDDAHLVGQQYSWLTTCIYIAVLIVEYPTNWIIQRVRIAKYLGFNIICWGTI
FT                   LALHSACHNFAGLVTVRTLLGIFEAACQPSFVVLSGMWYKREEQAATVTFWYMMNGGQQ
FT                   IVGGLLAYCFSLIGSDRALKSWQALFLTYGCISVLWGLFVVWWMPDSPMRAKCFTEEDK
FT                   HKMVERVRANQTGLQNKKFRAYQMWEAFRDPQMYCYCAIQIFTTLPTSGLGAFANIIIS
FT                   GFNFTELQTQLLAMVLGFYIIIVLLTSAWLVKKFEQNLLVMLGFIIPCRSFVGTIVLMT
FT                   VQNHSLSTKVGLLISYYITLSFWSAQNLGLSMVTRNIAGATKKSTVVAATFVSWAVGNA
FT                   IGPQVFLDRDAPRYFIAFGVHLGCYSAMTLAVIFLRFYLIRENKKKDKAMAEMGIALDG
FT                   EDHLA"
FT   CDS_pept        715704..716801
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171769" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888467"
FT                   /orf_name="An14g02920"
FT                   /product="Similarity to hypothetical conserved protein yesR
FT                   - Bacillus subtilis"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK46529.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG301397"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI0000EFC692"
FT                   /db_xref="UniProtKB/TrEMBL:A2R337"
FT                   /transl_table=1
FT                   /translation="MASTSPPAVRSKIDLLITNLVNIQDKTGQFLLPLADGRIIDTKSW
FT                   HGWEWTHGIGLYGIWKYYEMTGSPHLLQIIEDWFAARFAEGGTTKNINTMAVFLTLAYV
FT                   YEKTQNPVYLPWLDAWAEWAMHELPRTKQGGMQHATYLTENYQQLWDDTLMMTVMPLAK
FT                   IGKLLNRPDYVEEAKRQTLVHVKYLVDTSTGLWFHGWTFEDGGHNFARARWARGNSWVT
FT                   MVIPEFIELLDLKEGDPIRLFLLDTLEAQCEALMGLQEESGFWHTLLDHPDSYVEASAT
FT                   AGFAYGILKAVRKRYLPKKYRVVAEKAIQAVLSAVDETGELQQTSFGTGMGDSLDFYKK
FT                   IPLTAMPYGQAMAIMALGEYLRGHL"
FT   CDS_pept        join(complement(720031..720091),complement(718868..719718))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809599"
FT                   /orf_name="An14g02930"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An12g07270 - Aspergillus niger"
FT                   /protein_id="CAK46530.1"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0000EFC693"
FT                   /db_xref="UniProtKB/TrEMBL:A2R338"
FT                   /transl_table=1
FT                   /translation="MSTITSCSYLWSWDSVYMNEILHHQAETMDSPHQIFLIPEVLEPV
FT                   LLNLDTTTLLFSQRVCHVWNSLIKTSPSLQTALFFRPQKDSSTSTPALKPKRTVNPLMN
FT                   KLLKHFVSNHGSSFHRDISSYLSRFGPQKSSDPSTTELERQHPYLRPEASWREMLLHQP
FT                   PAPTLAVSDDLIPLSIGGVPSNESNAVLRLKHLEKLVQVCFSFPVEKVLIFYPMHNPPW
FT                   GRAPVSILRRFLDTCDTYIVPRYFVLTGLSTAVDAPVECGWPAGLPWLTEVGRWLKEWE
FT                   AIRESWRLECLTHFMYLYFYGS"
FT   CDS_pept        join(complement(721971..722013),complement(721204..721917),
FT                   complement(720181..721142))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888468"
FT                   /orf_name="An14g02940"
FT                   /product="Function: L-sorbose dehydrogenase "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAK46531.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI0000EFC694"
FT                   /db_xref="UniProtKB/TrEMBL:A2R339"
FT                   /transl_table=1
FT                   /translation="MASTDQTWEFVVVGGGPAGCALASRLARSARRPQVLLLEAGPRND
FT                   DPSLRVDGQRWQTFMNGNLNWGYKTTPQEHCNGRQIDYSRGKVLGGSSAINFGVYTVGA
FT                   RDDYNQWAGLVGDDLFRWERMQARFRQLETFNGAIVDPKNSKYAAPRTSDHGSQGSLKV
FT                   GYAAEWEQDLPLMMDVFEQAGLARNPDHNSGDPIGMALVINSSHQGRRVTATDLLDEAP
FT                   SNLTIITETPALRLVLQGTKTVGVETKGAKYFASKEVILTTGSLDTPKILMHSGLGPAG
FT                   QLQQFGIPVVKDMPAVGQGLRDHFFAPLCFQRNPTTNDRDAFFGNPAAMESALEQWSKD
FT                   GTGPWARHSCQIGAGWLKSDRLVASEEFKALPPTVQEFLQRDTVPHYEFMTHFPLHLIS
FT                   PEPFKDYSYVCMLVFLMNEQSSGEVRLQSANPEDPLLFDPKFLSHPFDRRACIEIYRHA
FT                   LEVTKHESFQKDTVSALIAPPSESDEDILEFWKNTLGSSWHMTGTTKMGKSGDADAVVD
FT                   SRFRVFGVENLRIADMGVVPVLTNNHTQATAYVTGLTCGDALAEEYGLDTSEARL"
FT   CDS_pept        join(723890..723995,724089..724310,724379..724920,
FT                   724967..725929)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888469"
FT                   /orf_name="An14g02950"
FT                   /product="Similarity: show strong similarity to several
FT                   oxidoreductases of different organims. "
FT                   /EC_number="1.1.3.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46532.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324318"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0000EFC695"
FT                   /db_xref="UniProtKB/TrEMBL:A2R340"
FT                   /transl_table=1
FT                   /translation="MRRALPWQSTTSSSSNTGRTFRPRRAVPRYAQCFGVSPVVRASSQ
FT                   CRCQPGDACWPSRDGWKHLNESISGHLVRVYPIGHVCHEPFFDQASCNQLVHLQYDSNW
FT                   RAEQPGALQSFNWENWPRENENCTIEANPSSVCGQGRIPLYSAVIQSVDEICAVVKFAK
FT                   QRNIRLVIKNTGHDSTGRSGAPHSLQILTNRLKDITFHDDFVPSQGDLGMDNPNASGVP
FT                   AVTIGAGVMVGELYAAAAARGLIVVAGECSTVGVAGGYLQGGGVSTVLSPMYGLAVDHV
FT                   LELEVVTAQGEIVTANGYQHDDLFWALRGGGGGTYGVVTKATMRAFPDIPAVIPTVHFI
FT                   YPRANDVFWQAVAQVVRLTQSMSVNGNSGQYIVGHLPNYHWYVNWTMFVWDDTESELVE
FT                   EQIPPFLRFLDWFGIEYQYELAEYSKISAFLTIPKQVDIGGIGYLQSSVVISESFMNST
FT                   AGASRLTASFSKLMLDPGALITVNVLGGQINLNAKDEDASVNPLWRSSSLLVVLMQSFP
FT                   PTPEAQSAAHQTLSQTNTPILASIDPEGGGVYFNEADPDQSDFQNAFWGHHYGRLRRIK
FT                   SRWDPAGLFVVRNGVGSEDWDVESMCRKETMVPA"
FT   CDS_pept        join(727949..728600,728697..728912,728992..729005,
FT                   729101..729252,729690..729984,730245..730727)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962811"
FT                   /orf_name="An14g02960"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g14870 - Aspergillus niger"
FT                   /protein_id="CAK46533.1"
FT                   /db_xref="UniParc:UPI0000EFC696"
FT                   /db_xref="UniProtKB/TrEMBL:A2R341"
FT                   /transl_table=1
FT                   /translation="MVPGQSIVLYSRLHLVVQSQTLLRRVLYLIIFDTIVLLIPTTVLT
FT                   YCTIYVRTTPVIRGFNVMERMQLAWFCAQEILISLIYIAETLKLLRLRPEKDAERHKTM
FT                   YELIAINLVIILLDIALLVLEYVGLYTLQTTLKAAVYSVKLKLEFGVLRKLVSLVHARP
FT                   AESSSSDQDTYPTFVDPNQITGDVTRAAPAYSRRQSQYPWTAISMDSLVLSDRRSCDIS
FT                   HTRATPILISGTSPQRTASALVKGPPPKQVSRALYSKWPGMREMWLQRWLGSPIHGCPD
FT                   QSLVTPIPYDHSCIPVDSHRACPQGPERARPKEKIASGGSELVRRPGKLELSSPAALAK
FT                   QPGDSIVPDSWESDAMVRGAVTASATELSDQDEFIVVIVVERLLKATQLFGMNMTNWPV
FT                   TLEDCDDVINRSTSISGTRRSRRGCLKVSSHSKLLSGSISLGGVSGGTSSGGITRAADW
FT                   SLPTFGHQRLAANPKEGIRPSLTRSIWQSNPWGTTESPSLMKLILFPPPLTAPSACFFA
FT                   RNPRLRGVWIPEYLTSRSVTGLHLTVRALRQTKSPFAAATIYIVVVYYSLLSARLPPHP
FT                   SAPRVSASPSSPTVSMCFGLSSPSGRV"
FT   CDS_pept        join(731209..733902,733960..734715,734767..735093)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888470"
FT                   /orf_name="An14g02970"
FT                   /function="ATP binding"
FT                   /function="G-protein coupled photoreceptor activity "
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="protein-chromophore linkage "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="sensory perception"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK46534.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0007600"
FT                   /db_xref="GO:0008020"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="GO:0018298"
FT                   /db_xref="HOGENOM:HBG327489"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="UniParc:UPI0000EFC697"
FT                   /db_xref="UniProtKB/TrEMBL:A2R342"
FT                   /transl_table=1
FT                   /translation="MDGATVGGTDRVYPIRSIISFNPAATDPNQQGIPNEIRSPRSGAR
FT                   SYSIIDADTWDQLSSQPTSSPHTNPSPNAPVHTPESTDRLSQQQSPNVFSPASSAAERD
FT                   APPDESSTYRKVAPEEGHASLVTSRFQHVVTAAGHAVITGNTPDSFRACEDEPIHIPGA
FT                   VQTFGVMLVLRETPEGSLAVHVASENSEAILGHSPSNLFALESFTDLLQDDQTDILLDH
FT                   IDFIRDDGYDPVSDGPEVFILAVKDRFGRPRRFWCAIHVNTAHRDVIICEFELEDDRIN
FT                   PLNVAGRTTPTSPTVTLGFEPTPDQLASSTVNISQPLRVLRNARRRRGEAAAMEVFSIV
FT                   SQIQDQLGDAQNMDALLNITIGIVKELTGFHRVMIYQFDSEANGDVVAELVDTRMTKDL
FT                   YKGLHFPSTDIPKQARDLYRLNKVRILYDRDQMSSRLVCRGIEDLKTPLDMTHAYLRAM
FT                   SPIHIKYLANMGVRASMSISINNTHDLWGLISCHSYGDTGMRVPFPIRKMCRLIGDTLS
FT                   RNIERLSYASRLQARKLLNTIPTDANPSGYIIASSDDLLKLFDADYGALSIRGETKILG
FT                   KSTESQEMLALLEFLKIRQLNSVVASHHVKKDFPDLRYPPGFKEISGMLYVPLSADGKD
FT                   FIVFFRKGELTQIKWGGNPYTKLLQNGHLEPRASFQVWTETVMDRAREWSESEVETAAV
FT                   LCLVYGKFIKVWRQQEAALEGSQLTKLLLANSAHEVRTPLNAIVNYLEIALEGALDTET
FT                   RDNLTKSYSASKSLIYVINDLLDLTNTEKGHNLIKDEPFDLPLCFKEATAMFSGEAHRK
FT                   GIEYTVHAHPGLPKTVLGDERRVRQAISNLISNAIQHTSTGGVTVEMWRAPGNPEPGFA
FT                   TIHMTVLDTGTGMSDAMLETMFQELEQHTEVERGKGVLGLGLALVSRIVRNTHGQLTVR
FT                   SEEGKGSRFQISLQFSTPDDTGSDQPETPQPSTQEGDATPFEAKEEFILVDSSSSAPSD
FT                   GWRRSGSHRGTISPSADELDAKLVAEDSIDRTKDEAAGLLPSSDRRKLVTLPSTPERLD
FT                   DVTRALQQNVQNLAISDKPAITSAGPAGPAPTSAPPAESDAKAPPGKYRVLVAEDDPIN
FT                   GKIVQKRLGKLGHTVQLTVNGEECAAAYRADSAQFDVVLMDIQMPIVDGINSTKMIREF
FT                   ETSSDSTALSSVAKLNNRIPIFAVSASLLEKDMSLYVDAGFDGWVMKPINFNRLNVLLE
FT                   GLQTGDTRNSATYHPGCDWEQGGWFTPIPEEKQ"
FT   CDS_pept        join(complement(738200..738561),complement(737754..737976),
FT                   complement(737337..737663),complement(735920..737209))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962812"
FT                   /orf_name="An14g02980"
FT                   /product="Similarity: similarity results from repetitive
FT                   sequences."
FT                   /protein_id="CAK46535.1"
FT                   /db_xref="UniParc:UPI0000EFC698"
FT                   /db_xref="UniProtKB/TrEMBL:A2R343"
FT                   /transl_table=1
FT                   /translation="MKSISAVLIALLAASVSAGPVVTTVTIALANDQTGAQGSAAIPAD
FT                   GSEQSISALYGGTGVGSGGVIKASSAQLTNFQANTNCVITKYGSVLATLNSRNTYVDLD
FT                   GNPSAAQPVDLSAASVKCHHNAVEVTLIALPRRQSIAEYIEVVLQEMTAGPQETLSGGP
FT                   SHPRAMTFLSVSGSESPDISSVAQPRVTLFKFHQGTSMPPTVSTKQASVHSVMHKQLLV
FT                   RLTSPDQNIPPCDQLINKWMNCSQLSPTFVAANQHDDLPWASRILALFVALQLRSGGSR
FT                   PLQVPLSTKDPTMNISELYLRLRHRPHIKPIPYILPITSLHGTLPLILEPRNDQTTAMN
FT                   TTTTTTAIASYYTLPRADSYTAISLISISTFTCLLLYYLIFDLSFFTTTSTSTSTKPRP
FT                   LTVPTTTLLTTTTTTLLSSTFCILLLFHHTHTPTRIASAILFVLTTTAASITNTLLLYF
FT                   SLPLITIHQRPQAHFQLRIQRILLSTIIATILLFQLPHVIVAPAAATLYKDGHWTHAVT
FT                   ILSRISVTAYCTREILLLAVYTWGVIKYLRPVIHHFHYESTHQDRQRICSTLLVAGCIS
FT                   LILNIANIVAVYTVHNAAAMAFFPFVVSTKVLVEGVAVGRLVGFVGASRQPRCVYSIHG
FT                   GGGGGDSRRGSAQPLITSTYSSASTMSGGLGAVETKDCGSDRDESPVGVQGRDKEWYTR
FT                   NRIGSVDTIVSVAEPPLAHSVGHLVQEMPDLEGGSGVWC"
FT   mat_peptide     join(complement(738200..738507),complement(737754..737976),
FT                   complement(737337..737663),complement(735923..737209))
FT                   /db_xref="UniProtKB/TrEMBL:A2R343 "
FT   sig_peptide     complement(738508..738561)
FT                   /db_xref="UniProtKB/TrEMBL:A2R343 "
FT   CDS_pept        join(741146..741169,741230..741465,741582..742614)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888471"
FT                   /orf_name="An14g02990"
FT                   /product="Similarity to hypothetical protein KIAA1715 -Homo
FT                   sapiens"
FT                   /protein_id="CAK46536.1"
FT                   /db_xref="HOGENOM:HBG327491"
FT                   /db_xref="InterPro:IPR019273"
FT                   /db_xref="UniParc:UPI0000EFC699"
FT                   /db_xref="UniProtKB/TrEMBL:A2R344"
FT                   /transl_table=1
FT                   /translation="MVSLWPFRAEDTSPASFEKALAALSTKITRATTRLDLHRQHARRF
FT                   KALWTLYTTFAYLLYSIIIALVLGWQNWGITEYGAIIGGPILIYLIRTISTRYYDYRIT
FT                   KTQAYLDDLHKQREKTIEDLKTATRWNSTQQLLEKYGGESPKPARSNSVKSGDAKRNKS
FT                   EGAKRKQPSQQQQQHVQRTGIPPPPTANIRRPAPQQFPSSPQPPSTPPVAFQHHQQSPH
FT                   VFPGQQQLQQQQQSAPSMNVGLEEPGFAPNAFSSTSTQYVEQSHWYDRLLDVLLGEDET
FT                   QPKNRLALICSTCRLVNGQAPPGIKTLEELGRWRCGNCGAWNGEESEAKKVLAGIRKEQ
FT                   QQQSSNISSGSVDGTETRSSVGGDVTDDGVMVAATGSEDDQLESQSEGAETSEEQVEQV
FT                   AESENEEEEEPEPQPSKRVTRSRAKGGKRKG"
FT   CDS_pept        join(complement(747378..747465),complement(747276..747304),
FT                   complement(747162..747185),complement(746850..747102),
FT                   complement(746596..746743),complement(746418..746547),
FT                   complement(745468..746360),complement(742918..745411))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809600"
FT                   /gene_name="dcl2-1"
FT                   /orf_name="An14g03000"
FT                   /product="Dicer-like protein 2-1 "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /function="metal ion binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="regulation of defense response to
FT                   virus"
FT                   /biological_process="response to virus"
FT                   /protein_id="CAK46537.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0009615"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0050688"
FT                   /db_xref="HOGENOM:HBG327492"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005034"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000EFC6CE"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R345"
FT                   /transl_table=1
FT                   /translation="MTVAATVLPAGEDAPAYRPRSYQVEMFEANGNWQWENSHELESNP
FT                   HKLIWFLTPTVALCLQQFKFLSDNIPAVRARTLTSLDKVELWTEQPVWDAILKEMQVVV
FT                   STHAVLADAMSHGFVKITQLGLMIFDEAHHCMRRHPANKIMQDFYHPALERHGAEAVPK
FT                   ILGLTASPVVRSNRQELLKIESNLDAVCKTPRTHRSELMTHTHRPHLQQILFTPVLLDD
FT                   LQDDPYIKKLRKSPLDGRALQKVLESGKTYCNDQLKRFATRSLHIFEELGEWAADYFIH
FT                   ASIEQLKARAGNSADTMGWTDEEKAYLLDIVSKLPIPNIDLTHSDPDRIPISSKFRSLL
FT                   EFLDTKGEPNFSGLIFAKQRATVSVMEKLLSIHPVTKHRFRCASFVGWSGGGSKDVLGE
FT                   LLDARMQRDTLSEFRTGQKNLIIATDVLEEGIDISACSVVVCFDKPPNLKSFVQRRGRA
FT                   RHRQSTYAIMFATDDESSALSKWEDLEQAMIEAYEDDERRLREAWALEAINEEVVERLE
FT                   VQSTGAVLTADTAVAHLNHFCAVLPRQPYASNEPEFSYEKDDADLLRGTVTLPSCVHPG
FT                   VRRIQGQRWWQTERAARKEAAFQAYKRLYEFGLLSDHLLPFKRNLELKETDLTNLPALV
FT                   EVSEQYDPWVDWACSWSSPDVHQTRIAIKHNGDSRMCIRLTSPTSLPPVEPMTLFWDSE
FT                   TIYTLDFDKPKRMKEIAAESIENMRLATALYLQAASSRQMRPEQDFVTLFGPDLTDLEL
FT                   AEWLNKHAGDEPALEVYSRKDFPTVMGIVRDRSRYNEPMLFKRWVVSGQDDTPIVELEC
FT                   DAVPKRRNLLHRQTLAAKQPDSETPAISSKIRLILAENCTIDKLPYAETIFGRFISVIL
FT                   DRLEATLVATRLCETILRDLEFSSIRHIITAITAPSAQSLTNYQRYEFFGDSVLKFTVS
FT                   CQLFFQHPNWHEGYLSEGRDEIVQNSRLARAALDAGLDAFIMNKMFTPRKWSAPLISEK
FT                   ISLTPKQRTMSTKVLADVVEALIGASYIDGGFAAAHACIHRFLPEVNLENIDRTTAPMP
FT                   KDGVTNHTLNDDHLMAHIGYTFTNKSLLVESLTHPSCQFDTTTQSYQRLEFLGDAVLDM
FT                   AIMSTLLSHPREIPQGLMTKIKHAVVNANLLAFFCMEFALTEKRTNVQVTPTGTVTLNP
FT                   STEHIELWRFMRYQGAHLQTARDLALSRHSSLRGSIIHGLKHSPSYPWKSLSQLNADKF
FT                   FSDIIESILGAIFIDSHGNLAECEKFLERLGLLRYLRRILKDEVDVMHPRNIAQQMAKG
FT                   EIRFEVLRVPNEGGGGGEDDGATYRCTVKMAGVDGVAVVVEGCLTSEEAEITAAERAVE
FT                   ILVGRGCSL"
FT   CDS_pept        join(complement(749822..749875),complement(749528..749543),
FT                   complement(749074..749330),complement(748517..749020))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656937"
FT                   /gene_name="kapC"
FT                   /orf_name="An14g03010"
FT                   /product="Putative transcription factor kapC "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46538.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG327493"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI0000EFC6CF"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R346"
FT                   /transl_table=1
FT                   /translation="MQPTLAPAPHPSMQTSAQDHADQAAHQHLSHPQQARPQGPTAQPP
FT                   HMQPNTTSPRDQNNIDPAISGAAMLSGPPQTPPQPEPTGQESPKTYGKRPLSTSKRAAQ
FT                   NRAAQRAFRQRKESYIRKLEEQVKEFDNTNETMKQLQAENYQLREYIINLQSRLLDSQG
FT                   EVPELPGNIDLNQPRNDISVPPPGAPAATGPAPGPGGAPQQMQVPNPGAATNEDMNSLN
FT                   RIAVAGLGMRKHPNEEANFLGNNFQARRPRNDDGQPDGSEATKTEPGHGLPVVS"
FT   CDS_pept        join(complement(754092..754176),complement(753866..754022),
FT                   complement(753507..753795),complement(753010..753441),
FT                   complement(751710..752960))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962813"
FT                   /orf_name="An14g03020"
FT                   /product="Function: suggested activities include
FT                   nutritional activity"
FT                   /protein_id="CAK46539.1"
FT                   /db_xref="HOGENOM:HBG327420"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniParc:UPI0000EFC6D0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R347"
FT                   /transl_table=1
FT                   /translation="MASTIPRDPVHSNHYVDYVIRYNFGGETDAAYATEQLDRLLRKLF
FT                   EVGLQTEVRQGDESSLLIFVRASRKKSLKRAIYQSRIRDWLYGVRNNEPESESSAEAQS
FT                   ESERLRVIYHMITVPKEAGGAGITPKHGEWKCVDAIFPLHDEAMNKQCIKDWSQKTFLS
FT                   ADDLDQIRNTFGENVGFYFAFLQSYFRFLIFPAVFGFSCWLLLGSFSIIYAVVNSLWCI
FT                   IFIEYWKRQEEDLSCRWQTKGVSAVRPKRREFQPEREVQDESTGEVRGVFPATRRMYRQ
FT                   LLIVPFALLSAVALGVIIATCFAIEIFISEIYNGPLKTYLVFIPTILLSALIPTMSSVL
FT                   VSIATKLNDYENYETQPAYDVALTQKIFIINFITSYLPIFLTAFVYVPFASRIVPYLDV
FT                   FHLTVRPFVSKEDANSRRTEFSIDPDRLRKQVIYFTVTAQAVNFAMETIVPMLKQRLSR
FT                   EYKEYNRRKQGKIETEDGSEAKKEALFDDHPDETKFLTRVRNEADMEDYDVTEDLREMC
FT                   IQFGYLALFSPVWPLVPVSFLVNNWVELRSDFFKICMECKRPWPQRADTIGPWLESLGF
FT                   LSWVGSITSSALLYMFSNGHEGPNGEPTAIRGWALLLTIFFSEHIYLMVRYAIRAAMAK
FT                   LEPPNAKKERTERYLMRKRYLESTIAARSSDDEGDGNEQDHSMKVPDITRKSLEEDARE
FT                   WSTHDTDPAERFWMRQKGWKESAHVGATIIKTLATEPQAKKEQ"
FT   CDS_pept        complement(754801..755374)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962814"
FT                   /orf_name="An14g03030"
FT                   /product="Putative frameshift"
FT                   /EC_number="2.3.1.-"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAK46540.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000EFC6D1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R348"
FT                   /transl_table=1
FT                   /translation="MPLCITCVGPIRPLAIPPLLTNHVLATIADVPIIHQFICELADYE
FT                   KALHEVEATHESLLETLSFPDSPPKRGSVYTALITPPATAENPTPKPVGMALFFYNYST
FT                   WRAAPGIYLEDLYVQPSARGNGYGFKLLKYLAAKVLEIKGRRLEWSVLKWNEPSIKFYE
FT                   QVGAKAMDEWTKMMMEGPALNKLAEGL"
FT   CDS_pept        join(complement(759615..759746),complement(759043..759481),
FT                   complement(757463..758804),complement(755904..757380))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171660" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113819"
FT                   /orf_name="An14g03040"
FT                   /product="Similarity: shows similarity to myosin heavy
FT                   chain of different species."
FT                   /EC_number="3.6.4.1"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK46541.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG327496"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="UniParc:UPI0000EFC6D2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R349"
FT                   /transl_table=1
FT                   /translation="MLPFFPAYRLLLLVLTFCRLLYFCLSFISLAVALAHRPATVMFQR
FT                   LRDAIDSRIAEEQARQRSAQTSLSRSNSARHPTGRNLSPTRRTSRPRRNTGTPVRGPDP
FT                   NEFEPEFAIGDDEGSSRSATPRLESAGGSEAAPEENTGEGKTSSEESATKKPEAQPVTE
FT                   TNQSPSELPPEIRVKLRRLGKLESRYQAERDDYKKKLEESQKSTKAAWDEVTKLKEDSK
FT                   SQAKKDEGPTSESSATDKSTPDSAAKSGKASTSGAKVTAEASQKESDAQGDSEEFFSYD
FT                   SEIPRLESELKEKQEEIETLKSQTESLKRDLSVARESTEGMVHNLESATRELVELRDTK
FT                   DKQDAELEKLKTSKQEEVSELKAKLEKSEAAVSKTSSEIESLKSELKQKADEIEQLQAQ
FT                   TAHAKSADQQAEIESKLEQLNREKEANDKRLGVLQGLVDSLRSQLKETEETFTSLKKEM
FT                   GQKNEDMGKLQNVVNFLDANLKDNEKWQQTKDQIANGKEAAFDELRESLAPPPQTTAVK
FT                   EDPAGPTAPAANPAGGAGGGKKKNKKKKKGGKANEEASKVIEAAAPEEKQEPAEQDDQA
FT                   ALKLTELEQNIESLKTQLAEKDATIDRLCSKLKGEEDLKEEIETLRDDLLNIGQDHVKP
FT                   RISSESSKVDTEKAHNDLKDEYESLKIKSTTLETELSAAQQLAATRFKDMTELRETLQK
FT                   LQPEVKKLRAESAELKSTKESLNSKTADLRNLEGQHDELRAELKSLKSTISERDAEVKS
FT                   LNQKIRQETDSRLKSEEKLTVAQSDLRYSESKKQEAVEAKEKLASDLSKAQDELKAARA
FT                   RLREAESQAAQLNKDLGGLREEIQLKTAQHASAQSLMNSMRDQAGELGMQMKEARERCE
FT                   SLEEELADAHRLLSERTREGETMRRLLNDIDGRAEAKVRDFKERMEAAIEERDRAEDEA
FT                   SAQSRRRARELEDLKGKLREAERALRTVEEDKEELEHTQKDWKRRRDQLEAESEKTTQE
FT                   LSDLRQAMARLRDALDESEKQVRDLEKEKAELRRSVEETNARLEKVRKSNKMLPDESRF
FT                   GTNPQSSRSSIDSGSRKALASPVSKDRSPSTRRSETPTGPSTSSIDYIYLKNVLLQFLE
FT                   QKDKNYQKQLVPVLGMLLHFDR"
FT   mat_peptide     join(complement(759615..759641),complement(759043..759481),
FT                   complement(757463..758804),complement(755907..757380))
FT                   /db_xref="UniProtKB/TrEMBL:A2R349 "
FT   sig_peptide     complement(759642..759746)
FT                   /db_xref="UniProtKB/TrEMBL:A2R349 "
FT   CDS_pept        join(761089..761450,761558..762207,762355..765791)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888472"
FT                   /gene_name="nte1"
FT                   /orf_name="An14g03050"
FT                   /product="Lysophospholipase nte1 "
FT                   /EC_number="3.1.1.5"
FT                   /function="lysophospholipase activity"
FT                   /biological_process="lipid catabolic process"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46542.1"
FT                   /db_xref="GO:0004622"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="HOGENOM:HBG398180"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI0000EFC6D3"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R350"
FT                   /transl_table=1
FT                   /translation="MATGDGIIAAPPSLESSSLDPLHVLPASSSTAARSLATSIPALTA
FT                   SFSVVSGFSSHLPPPPVTPPAPSTMVGWIGWIFSFIFQVIPSVLYWIVTFTTITLPTWL
FT                   FTLFSMSLTFTMNFTTLLLIALAVVSTISWFIRYRFLNMYSRLPPEPQRKEPQLDLFPD
FT                   VPDSDTKPGLANYLDEFLSAIKVFGYLERPVFHELTRTMQTRKLIAGETLLLEEEKGFC
FT                   LVVDGLVQIFVKSMRDRKSGSDEELNRMAGESSDEDDHRPDGRQGYQLLTEVKNGASMS
FT                   SLFSILSLFTEDVQLRYADSSASSASSIGPGLAIGPDSFPASPREMDDSPHVYQGDLHP
FT                   DIVARAMVDTTIAIIPASAFRRLTRVYPKATAHIVQVILTRLQRVTFATAHSYLGLNNE
FT                   VLGIEKQMTKFTTYDLPNELRGSALDRLKDKFIKERDRLGQEEVTKGIALHNPYGGRRP
FT                   RSSSFRRKEAALQAKMVASKRPVSMVAQDSALSDRENSGVSPGDLLSTIQLSRFGPRYE
FT                   HLAPRLLSPLTEKEHSPLRSPSPMIPGRASPFHRKESLDEDALFRESILECIMKGIGLT
FT                   GSTNDFLRKSSHPSGDVSPKLLSYDSRRQKAVFSNNAFGFIDPYEGSADGESESMMSMS
FT                   VTSAGGTSPIVNLREELRNDIEIVYFPQGSVLVEQGERHPGLYYVVDGFLDVGIPVDDK
FT                   EEDLVGSSRPAHEELFPMLRRTNTSSSRVSGSAAAANDPRRKKQSRRSLYLIKPGGIQG
FT                   YVGAVASYRSYTDVVAKTDVYVGFLPRASLERIAERYPLALLTLAKRLTSLLPRLLLHI
FT                   DFALEWVQVSAGQVIYHQGDESDAIYLALNGRLRSVHEGPNGKMTVVGEYGQGESVGEL
FT                   EVMTESTRPATLHAIRDTELAKFPRTLFNSLAQEHPGITIQVSKLIAQRMRDLVETPLA
FT                   EKGGEPGVSGTVKTAKSTLNLRTVGILPVTAGVPVVEFGNRLLQALHQIGVTNGATSLN
FT                   QAAILNHLGRHAFSKMGKLKLSQYLADLEEKYGMVLYIADTSVNSPWTQTCITQADCIL
FT                   LVGLAESTPSIGEYERFLLGMKTTARKELVLLHGERYCPPGLTRQWLKNRVWINGGHHH
FT                   VQMAFRLTAEPSHPQTKRFGTVLKQRVQVIQAEIQKYTSRRIRQSPLYSAQTPFKGDFH
FT                   RLARRLCGRSVGLVLGGGGARGIAQVGVIKALEEAGIPIDVIGGTSIGSFIGALYARDA
FT                   DVVPMYGRAKKFAGRMGSIWRFALDLTYPTVSYTTGHEFNRGIFKTFGDSQIEDFWLEF
FT                   YCNTTNISRSRAEYHSSGYTWRYVRASMSLAGLIPPICDEGSMLLDGGYIDNLTVDHMK
FT                   GLGADVIFAVDVGSIDDNTPQVYGDSLSGFWAVVNRWNPFSSCPNPPTLSEIQARLAYV
FT                   SSIENLERAKNTPGCLYMRPPIDPYGTLDFAKFDEIYQLGYAYGKNYLEKLKREGSLPL
FT                   PEETEEKKKLQRTLAPRRASI"
FT   CDS_pept        join(766892..766961,767021..767120,767188..767754,
FT                   767818..767887)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216347" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888473"
FT                   /orf_name="An14g03060"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An16g01890 - Aspergillus niger"
FT                   /protein_id="CAK46543.1"
FT                   /db_xref="HOGENOM:HBG327497"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniParc:UPI0000EFC6D4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R351"
FT                   /transl_table=1
FT                   /translation="MFCLGLLALLYVRLLRDDLILVLGRVEKPPARRKHNALVLAKTSS
FT                   EDVTWAYALKPHWKPYIYTSDKEPGYRPIPANKAREGMAYLTHIIEHYDYLADVTAFMH
FT                   ASATQWHNDVGDTASSSLLQNLSLDAVNKAGYANLRCEHRPGCPVAVRPFDPAMESNHN
FT                   VVYRNFTSIYMDMFSVPREQVPTEIGGVCCGQFVLTRDRIRERPRDDYVRMRDWALATD
FT                   MDTFAAGSVFEMLWHIIFLEQPVSCPDVQQCYCELYNICPEIDSGS"
FT   sig_peptide     766892..766939
FT                   /db_xref="UniProtKB/TrEMBL:A2R351 "
FT   mat_peptide     join(766940..766961,767021..767120,767188..767754,
FT                   767818..767884)
FT                   /db_xref="UniProtKB/TrEMBL:A2R351 "
FT   CDS_pept        join(768815..769406,769465..770474)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962815"
FT                   /orf_name="An14g03070"
FT                   /product="Catalytic activity: CHO has oligosaccharide
FT                   oxidation activity."
FT                   /EC_number="1.5.3.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46544.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327498"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0000EFC6D5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R352"
FT                   /transl_table=1
FT                   /translation="MAPPVIFTAAVLFMLPNQLAALPQNPGNISTPATANHGVLPRSLE
FT                   SCLGATGVSVVYATDAGYSNLTVADNSNYHPHPQAVVIPNSTEQVAATVRCVAAEQGRV
FT                   TLTTRGGGHGYAAYSLSGQVVIDSSQMTDIVLDESTQEVTVQMGQKLGPLALAMGRAGY
FT                   ALPHGTCPGVGVAGHSLGGGWGFTSREWGWLVDRLVSLELVDVTGRIRTISPKATNPNT
FT                   TSTDDTNDGDLWWALRGAGSNNFGIVTSFTYRMQPAPTAIVNYNIGFASQSDCVQVLLT
FT                   LQEIGSHPATSSAGFPTSLGGELIIDGGYQPPKAYCSFTGQYLGDSAAYNETIQRLLSP
FT                   LARQSIQPLTTTSSFYTNWVSALTNLMGDLDSPSVPQPYYAKSLFDDGHPNYTSASISR
FT                   IFSAIQPAGPDAFISFDLNGPDAATTLPPDDSVGPMAFNHRNNLFMSQIYAWDFPGFTN
FT                   ASARETAVDRLSDVADAVRQAAPKGGWQAYQNYIDPYLQNWAERYYGDALDRLKEIKKK
FT                   WDPLNILDFPQGLGRA"
FT   sig_peptide     768815..768877
FT                   /db_xref="UniProtKB/TrEMBL:A2R352 "
FT   mat_peptide     join(768878..769406,769465..770471)
FT                   /db_xref="UniProtKB/TrEMBL:A2R352 "
FT   CDS_pept        join(complement(772438..772581),complement(772273..772376),
FT                   complement(771951..772209))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888474"
FT                   /orf_name="An14g03080"
FT                   /product="Localization: might be a transmembrane protein. "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46545.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG325540"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniParc:UPI0000EFC6D6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R353"
FT                   /transl_table=1
FT                   /translation="MFSSTVARPLQLVTRFMQWASAVIVMGITSYFIHKGPRGQHTIYW
FT                   EVISTMSVVFFLPAFISPFMPNALSKFVLIIDVIFSYLWLTAFIFAAQDYNWHNCGANS
FT                   PPGLSCSKKKANEAFIFLTFIFTFFAIFLEVGALWAYRRESTPVREKNTGGAHGGPADA
FT                   PVATA"
FT   mat_peptide     join(complement(772438..772515),complement(772273..772376),
FT                   complement(771954..772209))
FT                   /db_xref="UniProtKB/TrEMBL:A2R353 "
FT   sig_peptide     complement(772516..772581)
FT                   /db_xref="UniProtKB/TrEMBL:A2R353 "
FT   CDS_pept        join(complement(778194..778391),complement(778112..778126),
FT                   complement(777727..778049),complement(777405..777667),
FT                   complement(777205..777345),complement(776918..777146),
FT                   complement(776697..776835))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113820"
FT                   /orf_name="An14g03090"
FT                   /product="Similarity to glucose/galactose transporter gluP
FT                   - Brucella abortus"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46546.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG327335"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC6D7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R354"
FT                   /transl_table=1
FT                   /translation="MSTTTIELAPQGLQESQSPVQPFGPSTEEAIVQQKQKWNDPPINR
FT                   WRLLATFISFTVVGANDGVYGALVPYLREDYKLSTTVVSLIFVTPFAGYTIATLIVNKI
FT                   HMTLGQRGIAIIGPLCHIIPYVIMAIHPPWPAMLAVYVIVGLGNGLIDAAWNSWIADMA
FT                   NANAMMGVLQAFYGLGATISPLVGTQVIKSGLRWNYFYYTLLGGSVLELMVSSTLFWKA
FT                   NAVSYRATNHRNSDSGDGSRTTEAMKSPITWLIAVWLFVYMGVEVSVGGWVVDFMVQVR
FT                   HGAPYQSGLIPTGFWAGVTVGRLVLGFVNDWLGERIAISIYLVISIALELIFWLVPQFV
FT                   VSAVAVSLLGFFTGPLFPAAIVVAAKLLPKHLHTPGIGLASALAGGGGAILPFVAGAIS
FT                   GARGVQSLQPFVLALLVALIAIWVLLPRNKHHAHGV"
FT   CDS_pept        join(complement(779990..780558),complement(779172..779916))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168398" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888475"
FT                   /orf_name="An14g03100"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK46547.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="HOGENOM:HBG326862"
FT                   /db_xref="InterPro:IPR006759"
FT                   /db_xref="UniParc:UPI0000EFC701"
FT                   /db_xref="UniProtKB/TrEMBL:A2R355"
FT                   /transl_table=1
FT                   /translation="MLPIPPTRVAKQFFTHFPYYLQLRASKILISSLFVWLLIFFYCRV
FT                   TLWRDPHSAYFEDRHVYELDYSLHREREAWHFISQHNSGIDPPDYVKSGSTPSVCIAMV
FT                   TVRRDSDHYFEASVGSLLEGLDERERQALYLSILFADTDPRVHPSWDQKWVGRLVDSAD
FT                   SYNVTEGQLQHLQDLEKEKNFYEKGVFDYIYALRACQEVNAPYTIIFEDDIILATGWFS
FT                   KTLKALSDISQRSQQPRDPWIYLRLFYTETSLGWSDSDMAYRNMPLIFGLLMLSTFSSL
FT                   SMLRHTRFQRLHLDTLSIVVISMVCVPAFTALVYMAGKYNVMPLHGVVEMNQYGCCTQG
FT                   LVFPRENVDGLIEFLSARGHGQTDSMIEEYADQSQLTRYALAPPQLQHVGLKSSRNNLD
FT                   INTQSTWAFWFETNDPAKLRREHATLLEDYDVERMLNV"
FT   CDS_pept        join(complement(782830..783037),complement(782453..782783),
FT                   complement(782194..782407),complement(781332..782144))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888476"
FT                   /orf_name="An14g03110"
FT                   /product="Function: initial oxygenation step in
FT                   trichothecene toxin biosynthesis. "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46548.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327222"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000EFC702"
FT                   /db_xref="UniProtKB/TrEMBL:A2R356"
FT                   /transl_table=1
FT                   /translation="MSLLWNVGVAALLAVLWTASEAVRRLYFHPLAHIPGPRLAALTWW
FT                   YEFYFDVIRPGQYVFKIQELHTRYGPIIRITPDEVHVNDVGFLDTIYAPSMIRRDKYGY
FT                   QLRSLRVPGGLGTTTDHDLHKVRRESLTPFFSKKNIQYMEGLITDKVDQLKQLISTHAA
FT                   RDTPVNLSDVFLAFSNDVVNNFLFAHRTDVLASEPKAATLRQNSKELLMGININKHFPQ
FT                   IPDLLESLPMSISRPVMPPGLIDLLALFDRVREEIFMIKKDKESSVTHKKNIGPTGKAS
FT                   VFDSLVDNPNLPASEKTLLRLQQEGALLVLAGTESPAQTLNIIFYHLLANPALLEKLRR
FT                   ELRAVPVPSSWTQLEQLPYLSAVIEEGNRLSFGVTARSARIAYEPLTYKPSAHVSSTCP
FT                   PSTRSKSYIIPAGTPVCTTTLSAHTADTVFPDPFVFDPERWIGDAGKERRRFQMAFNKG
FT                   GRRCLGIELARAELYHVVAALVREFDMALFETDADDVAFMYDYQVAMPKMGSKGVRIMA
FT                   KLAH"
FT   mat_peptide     join(complement(782830..782971),complement(782453..782783),
FT                   complement(782194..782407),complement(781335..782144))
FT                   /db_xref="UniProtKB/TrEMBL:A2R356 "
FT   sig_peptide     complement(782972..783037)
FT                   /db_xref="UniProtKB/TrEMBL:A2R356 "
FT   CDS_pept        join(783399..783551,783604..783744,783793..784122,
FT                   784174..784241,784291..784370,784451..784779)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888477"
FT                   /orf_name="An14g03120"
FT                   /product="Similarity: shows only similarity to the central
FT                   part of pth11"
FT                   /protein_id="CAK46549.1"
FT                   /db_xref="UniParc:UPI0000EFC703"
FT                   /db_xref="UniProtKB/TrEMBL:A2R357"
FT                   /transl_table=1
FT                   /translation="MSRTYATPAAIITISILFPVLGTLTVILRFYTRRKTKSVLWIDDW
FT                   LTLPALGLEYVLAALLLWGTTTGSLGGLLPQPDDPRPDAYIFSNSDQQIRLLQIQYVAD
FT                   IVTVWAFGFTKLSILYFYRSIFCSRRTIRTAFHSVTMCMTVLVSVWTVAFGVGTIFICG
FT                   AHPVNAWGTIAVVTTECTVQVPIVEGYAISDFIMDVIIWLLPLPRIWLLNISVRQKMAL
FT                   GLVFLVGLLAIAASATRMAIYIAHHINPFAQSDGEKCGLGVIVICLPSLRPMYKKRELN
FT                   SLINSFKRYLYRIPTSTTSSALRNNSLNGLTNSNSSNVNLVRPWHPGPTTSPAVGHNAS
FT                   MAQHPSNTEQRIQVTREIELIRLDSS"
FT   CDS_pept        join(complement(786534..786597),complement(786324..786478))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888478"
FT                   /orf_name="An14g03130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46550.1"
FT                   /db_xref="UniParc:UPI0000EFC704"
FT                   /db_xref="UniProtKB/TrEMBL:A2R358"
FT                   /transl_table=1
FT                   /translation="MKISLIWAVSLLLNVHAAVIPRAAESATSIEAGVRAAEFGAGGIH
FT                   ERAALSYGEGDSKVDNKEDNTVIGEGW"
FT   mat_peptide     join(complement(786534..786546),complement(786327..786478))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R358 "
FT   sig_peptide     complement(786547..786597)
FT                   /db_xref="UniProtKB/TrEMBL:A2R358 "
FT   CDS_pept        join(complement(790368..790551),complement(789980..790300),
FT                   complement(788987..789927),complement(788157..788933),
FT                   complement(788061..788093))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171615" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962816"
FT                   /orf_name="An14g03140"
FT                   /protein_id="CAK46551.1"
FT                   /db_xref="HOGENOM:HBG327501"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI0000EFC705"
FT                   /db_xref="UniProtKB/TrEMBL:A2R359"
FT                   /transl_table=1
FT                   /translation="MAITSIQPVLPTRFTINSEKGATKPPPEPYNVQDHPFKGYHPPQP
FT                   EGYEKSKSTSAIVIDNGSNLVKAGWSFDKSPRFVLPPVMSRYRDRKLNKACQFIGYDSY
FT                   VDATTRGQLRYAFDPGTSVVGNWDVMEGVLDYLFIKLGVDGANGGVDRPIVMTEPIANL
FT                   AYPRRMMNEILFECYSAPSVAYGIDSLFSYRYNRGKDGLIISSSHTSTHVIPVLNNKAL
FT                   LSNCSRLNWGGLHASEYLLKLMRLKYPTFPARMTESQMEDIVHKHCYVSKDYDQELSHY
FT                   LDWTGLEERDCIVQYPYTEHVVPEKTEEELARIAERKKESGRRLQEQAAKMRLEKLMKK
FT                   EQELEYYKDLQHGLASETKKEARRILEAEDLKDEAHLDRLIRDLERSIKRSRNRDLGIE
FT                   ETEEPQEEMSFPLLDVPDEELDEAGLKEKRHQRLMKSNVEARQRAKAEKEREKARREEE
FT                   ERLDREKRENDFENWLAERRANRQNIMQKIKERDRMKADLGNRKSLASQMRMKTLANLA
FT                   ADGPKKRRRGGDDDTFGANDEDWGVYRTVATGEQSDEEEEEDLGGMLDAVEKELLEYDP
FT                   EFTENHTLAAQSDWTKSLVHVFLRGPWPFDPESQREAHQLHLNVERIRVPEVVFKPSIA
FT                   GIDQAGLLEIAADIVNQRFPNPEEQSKLLRDVFLTGGNTMFQNFDERLRNDFRAYLPVD
FT                   AQLNVRRANDPVLDAWKGAAQWASGSELAKSSITRQEYLEKGSEYLKEHDMGNATTW"
FT   CDS_pept        join(complement(791248..791271),complement(791109..791193),
FT                   complement(791015..791061))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171594" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962817"
FT                   /orf_name="An14g03150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46552.1"
FT                   /db_xref="InterPro:IPR013959"
FT                   /db_xref="UniParc:UPI0000EFC706"
FT                   /db_xref="UniProtKB/TrEMBL:A2R360"
FT                   /transl_table=1
FT                   /translation="MVMNRSLQEVNIQNMNVELVAQMFKNYQSNVLFHLEATENLKDPS
FT                   SSSSSS"
FT   CDS_pept        join(791899..792385,792536..792576)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962818"
FT                   /orf_name="An14g03160"
FT                   /product="Similarity to hypothetical protein CAE02259.1 -
FT                   Oryza sativa"
FT                   /protein_id="CAK46553.1"
FT                   /db_xref="HOGENOM:HBG327503"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="UniParc:UPI0000EFC707"
FT                   /db_xref="UniProtKB/TrEMBL:A2R361"
FT                   /transl_table=1
FT                   /translation="MAPLTPVEQENHQALLDRLDIAAVPRPFRNPNWKPSQRRNKNVKQ
FT                   LISESSRKEASVMATQSNSGATTPLAATSASTDGSQTPADGTPRTNIAQAAQNLSTLVL
FT                   EKNARAAFTSGPAVTYTNIESAPSLHPSQQTRYCDITGLPAPYTDPKTRLRYHDKEIFE
FT                   IMHSDSNEGPAR"
FT   CDS_pept        join(793554..793689,793884..793996)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888479"
FT                   /orf_name="An14g03170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46554.1"
FT                   /db_xref="UniParc:UPI0000EFC708"
FT                   /db_xref="UniProtKB/TrEMBL:A2R362"
FT                   /transl_table=1
FT                   /translation="MPTMWLSDNQSKKRLLCTLRTKAFPGHWLTHVLSTTEIGVIFCSA
FT                   AWRWEMYAILNYPTPMRYVETPTNPLHRRSSSSSASP"
FT   CDS_pept        join(complement(795808..795835),complement(795692..795707),
FT                   complement(795519..795603),complement(795286..795420),
FT                   complement(795081..795212))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171591" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113821"
FT                   /orf_name="An14g03180"
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /cellular_component="actin cytoskeleton"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK46555.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015629"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="HOGENOM:HBG388165"
FT                   /db_xref="InterPro:IPR002097"
FT                   /db_xref="InterPro:IPR005455"
FT                   /db_xref="UniParc:UPI0000EFC709"
FT                   /db_xref="UniProtKB/TrEMBL:A2R363"
FT                   /transl_table=1
FT                   /translation="MGQHSAIWQGYVDSSLMGSGQFDKAGILSHDISGVEASSPGFTIS
FT                   PQELQGLAAAFKDPNAAWGNGITVGGEKFVTIKADDRSLYGKKGKEGIVVVKAVSCVMV
FT                   AHHAENVQTPNAATVVENLVDYINNPR"
FT   CDS_pept        join(798126..798998,799059..799886)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656938"
FT                   /orf_name="An14g03190"
FT                   /product="Remark: only repetitive elements are matching "
FT                   /protein_id="CAK46556.1"
FT                   /db_xref="HOGENOM:HBG327505"
FT                   /db_xref="UniParc:UPI0000EFC70A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R364"
FT                   /transl_table=1
FT                   /translation="MARGTFLGRSRTIRQAEAGSSPTSKHPDMLPRKDQKCIEDGANKG
FT                   RPAPHVNRSFHRPGVSEGHQQKKMQAMSPINTEAPPLLSSPVSSPVSTDNDMNGSLIGV
FT                   ALGSPRMIDPQVPTSQMQETVPVKPAEPQTRPSLQRKPSKWKKIGGLFKAKAAMTTPPN
FT                   QPFYQVRLENEWPMQGSTYSFDQQPKTQSSGHENPASPTSGTDAWPSLVPEIQTSTQEP
FT                   QQSHADATSGSPPEKEQSLGSGPLLQVDIPDIQLERYSVMFGGVLKKNRLSAMSRRSKN
FT                   LEDSNSPTEQDTHHSPTPTRSKSPSPSFSLFPATRTSKASKVLGSQNVPRGPSPIHKSQ
FT                   TSLGESNQENLSEKNSVVLMVHSTQPSHKQQNSVSSFLSSTTIGSEDERLLLQKLGPVR
FT                   SYFDAREPEWEIINKKPTAKEPVRESPPPLRIDTQMDSPRTASYASSTLSESSDTPVDA
FT                   PRQRNEVPSPASRRTSPTSPRPKPSGVAQKDSNPSDPENPVPTVEISIARSVSVSKGRR
FT                   QVLVPIRPRPDRLDPNERVGDKKGKAPQVMEADRSHLPGRSQEVLVDTI"
FT   CDS_pept        complement(800349..806324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809601"
FT                   /orf_name="An14g03200"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAK46557.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG736699"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000EFC70B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R365"
FT                   /transl_table=1
FT                   /translation="MAVNGSVETQWLAQLAAMRQAIADLKLPQDPAKDTSYGSDLDLDF
FT                   DEDYSSPGTADDDIWDIISSDEEASDDFDDYDELPSPPTSSAYDQLWLEQKCMSLAANK
FT                   PGMDAGELAQQITAALATDSGDDELQMSLAEIVGFDDLDFVIDLIAHRADIVASSHTGP
FT                   EAQTDGLMAGKLMTRAEREQALRQADYEHKHASLMPAQTRSEPHYPHVFKLHESRNVLA
FT                   LGGKRYGLPMGSKQIDEKKYTEVEVPASKVGTLRPGHKLVEIASLDGLCQGTFKGYKTL
FT                   NRMQSLLYEVAYKTNENMLICAPTGAGKTDAAMLTILNAIGKNTVPNPIEEPQATEFAV
FT                   QVEDFKIIYVAPMKALAAEVTEKLGKRLAWLGIKVRELTGDMQLTKREIVETQIIVTTP
FT                   EKWDVVTRKSTGDTELVQKVRLLIIDEVHMLHDERGAVIESLVARTQRQVESTQSLIRI
FT                   VGLSATLPNYVDVADFLKVNKMAGLFFFDQSFRPVPLEQHFIGVKGKPGTKQSRENLDV
FT                   VAFEKVRDMLERGHQVMVFVHSRKDTVMTARMLKQMASEDGCENLFSCQEHEGYSNGLG
FT                   DVKRSRARELRELFASGLGTHHAGMSRSDRNLMERLFSEGLIKVLCCTATLAWGVNLPA
FT                   AAVVIKGTQLYNPQEGKFVDLGILDVLQIFGRAGRPQFQDTGIGFICTTHDKLHHYISA
FT                   VTSQQPIESRFSSRLVDNLNAEISLGTVTSVPEAVQWLGYSYLFVRMKREPRNYGIDFA
FT                   ELRDDPMLVQRRRQLVIQAAIVLQKSQMIIYNEKTEELRAKDVGRIASQYYVLQTSVEI
FT                   FNNLMRPRASEADVLRMISMSGEFDNIQARESESKELNRLRDEAIQTEVEGGNDSPHAK
FT                   TNILLQSYISRARVEDFALVSDTGYVAQNAARICRSLFMIALNRRWGYQCQVLLSLCKA
FT                   IEKQMWPFDHPFHQFDLPQPILRNLDDKLPTSSIESMRDMETAEIGQLVHNQKMGKTLA
FT                   KLLDNFPTLGVEAEIAPLNRDVLRIRLSLYPEFIWNDRHHGASESYWIWVENSETSEIY
FT                   HHEYFILSRKKLNDEHELNFTIPLSDPLPSQIYVRAISDRWLGAETVHPVSFQHLIRPD
FT                   TESVYTDLLNLQPLPISALKNPILEELYGQRFQFFNPMQTQIFHMLYHTPANVLLGSPT
FT                   GSGKTVAAELAMWWAFREKPGSKVVYIAPMKALVRERVQDWKKRLTAPMGLKLVELTGD
FT                   NTPDTRTIRDADIIITTPEKWDGISRSWQTRDYVRKVSLVIIDEIHLLGGDRGPILEII
FT                   VSRMNYIASQSKGSVRLMGMSTACANATDLANWLGVKEGLYNFRHSVRPVPLEIYIDGF
FT                   PEQRGFCPLMQSMNRPTFLAIKNHSPEKPVIVFVASRRQTRLTAKDLINYCGMEDNPRR
FT                   FVRMSEEDLQLNLARVKDEALREALSFGIGLHHAGLVESDRQLAEELFGNNKIQILVAT
FT                   STLAWGVNLPAHLVVVKGTQFFDAKIEGYRDMDLTDVLQMLGRAGRPQFDTSGIARIFT
FT                   QDAKKAFYKHFLHTGFPVESTLHKVLDNHLGAEVSAGTITTKQDALDYLTWTFFFRRLH
FT                   KNPSYYGLEISAEEHNTMAAQAIAQDFMIELVDKSLGELAESSCVVLDSATGDVDPTPF
FT                   GKIMSYYYLSHKTIRYLMSHAKPNPTFHDVLSWMCSATEFDELPVRHNEDLINAELARN
FT                   LPLSVESMCDLPLWDPHVKAFLLLQAYMSRIDLPISDYVGDQTSVLDQGIRIIQASIDV
FT                   MAELGYLHACHMFMSLLQCIKSARWPEDAPLSILPGIDPVEKKSALPTSLTALVSLPFK
FT                   ATEALTKKLSLPAQFAKAASNLPNISLSIPTISPNGLTVTLTRKNAPRDRDYRIYAPRF
FT                   PKPQTEGFFMLVYSGASSDGKNGELLALKRVSWPSSSNQRNGSGPSRKPNDNRNGPLVV
FT                   RSSVKFPENVRGLSMRVTIKVISDSYPGMEWTLSDVEVDAGVPEKQTLPESSTFPEKS"
FT   CDS_pept        complement(807564..808568)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962819"
FT                   /orf_name="An14g03210"
FT                   /product="Similarity to human transcriptional regulator
FT                   protein #28 patent WO200078954-A2 "
FT                   /protein_id="CAK46558.1"
FT                   /db_xref="HOGENOM:HBG717219"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI0000EFC70C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R366"
FT                   /transl_table=1
FT                   /translation="MPDSRDDYSRRRHRSPSGSPAPDRDQRQRRRDEDRGSDSGHRESH
FT                   QSSRRDSSRRRSSRSPADRRSHRRDYDSRRSERRDKEDVSEDDRRRRRHTSDRESSYRR
FT                   HRDRDSYDRKEKSSRRRRDYSRSRSPTRRSPGPDSRAPVRSKAPLPPQQDAYTSSEVAR
FT                   TGESEGPPPEKEKPNFAQTGRLAAESKTVNVNGSSVVLKYHEPPEARKPPAKEPWRFYV
FT                   FKGQDLLEMVELGIRSCWLIGKEQLVVDFPLEHPSCSKQHAALQFRFVEKRNEFGDRIG
FT                   RVKPYLIDLESANGTTVNGDAIPAGRYVELRDKDVVQFGLSSREYVLMLPPPE"
FT   CDS_pept        808814..809740
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197782" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888480"
FT                   /orf_name="An14g03220"
FT                   /function="heat shock protein binding"
FT                   /protein_id="CAK46559.1"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="HOGENOM:HBG327506"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0000EFC70D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R367"
FT                   /transl_table=1
FT                   /translation="MFKKPNILCCGGGLQLLNSPCLSSPPRYRSFPSQSRYSARRYATA
FT                   SHNPETDLSWPSSPTFTPYELFKQDRTAPYSKARYYEMVKIYHPDRPCSGHPLCRDLTP
FT                   EVRLQRYHILVAAHEILSDPSRRAAYDFSGAGWNLHPYETPIPSWARTGSSNYGPIYAN
FT                   ATWEDWERWNNRHQGKQQTLVDHRTFATFVILLTLMGGALQASWISKLSSGYEDRLWEL
FT                   NEESSRLLKGRRENTQHQMQSVDARVQHFLIRRDPSGCGLKEEEQPVYKQVLHSQKSSN
FT                   DPPAEILGSERQDGRVSGDSVQTGTSS"
FT   sig_peptide     808814..808882
FT                   /db_xref="UniProtKB/TrEMBL:A2R367 "
FT   mat_peptide     808883..809737
FT                   /db_xref="UniProtKB/TrEMBL:A2R367 "
FT   CDS_pept        join(810296..810865,811014..811067,811102..811409,
FT                   811476..812450,812489..812600,812654..812722,8
FT                   12756..812857)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809602"
FT                   /orf_name="An14g03230"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An13g03440 - Aspergillus niger"
FT                   /protein_id="CAK46560.1"
FT                   /db_xref="UniParc:UPI0000EFC70E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R368"
FT                   /transl_table=1
FT                   /translation="MRGPMVMLFPLVRHQWYETGNWKSGAHDFFRLSKCDIRQRPGSNP
FT                   GELIGHGHINSGSVLISRPVLVSSGHQRQWKELNNALVSAITDIVERWWTNSVSRFPER
FT                   MPLKPAEEDLLRVCYVPPPTVHPAAGSGTFSQQHDISDPIEEFPRHRDCSYEEAPPRYF
FT                   ALQVLREDRCRGGVLSGMDVGKLSSPAILQSIWWTNVQRPIDKLLDVGSEHAEHFPILT
FT                   QDLEITSSSPINTNCLIDARAIDVTMSAEELLANVEGGVVPVTCHEDVLRIAFIYLDEG
FT                   LWTGNGVFDVVDKLHSHGLSFGEGVLRFNRSLDIFYLAQLAAAIYRYISQLKDDFPSFS
FT                   DFPAFYIAYHAFLHSSAWRSYYSYPFLTQRTTACFYRLPNLQDLPDSSSPLCQPRHSPA
FT                   SLHILKIPRWAYTVGCTRRRQPFLPSETLTALALSTLEATMTRLHTAYPSAPPYSEAHP
FT                   RFWLDYFTPDPSPSRVAEVTPWQAWRPHSFGILVAQGKYDIHRLEAEYLTRIAGGEIIE
FT                   GDSQPEQVIWYGWPDGGIEGQAWWRGWEEEVGSEEEVDFLAAVAVEETVGLGLQGIDMD
FT                   ELDLSIRSHILLAVMQAAVKDKQEKERFLDEMKRRMVQKGRIVNERAGKWTREALETME
FT                   PGEREDAAADSGGKCAALCTLEVVAYFEAVHFRAEAEGYPNQLKKIRIPASQRNATPYL
FT                   NLCMQEALGSTCLPILSFKGNQAELRKSLDAKRHY"
FT   CDS_pept        join(complement(814926..815247),complement(813848..814863))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656939"
FT                   /orf_name="An14g03240"
FT                   /product="Catalytic activity: acyl-CoA + NADP+  "
FT                   /EC_number="1.3.1.8"
FT                   /function="acyl-CoA dehydrogenase (NADP+) activity "
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46561.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0047616"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG699365"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI0000EFC73C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R369"
FT                   /transl_table=1
FT                   /translation="MSRIYQLSRAFQRSQVGALRPRSLLPARSSRCGFSTSATRPLMEL
FT                   TGFTEEQLTVRDAVSAICAKFPNTYWQDCDQNERDPNEFHAALARDGWLGIALPEELGG
FT                   AGLGISEATMMMQTITQSGAGMAGAQAIHANVYATQPLARFGTREQLEETIPKIINGTW
FT                   RTCFGVTEPNTGLETLKLKTLATKKSRGDSDIYSISGQKIWITCAQVASKMILLARTTP
FT                   LEEVTKSTQGLSMFCIDLDRTQPGLDMRKIKKMGGRAVDANEVFFDGYEVPANTLIGQE
FT                   NEGFRIILHGMNAERCLLAGEALGLGYAALERAADYAKERVVFGRPIGQNQGIAHPLAD
FT                   AYMRLEAAKLATYHAARLYDASKKDEGIPLHSVGVACNSAKYLAAEAAFTACERAVLSH
FT                   GGMGYAMEYDVERYLRECLVPRIAPVSREMILNYVSEKVLQLPRSY"
FT   CDS_pept        complement(815546..816385)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178374" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962820"
FT                   /orf_name="An14g03250"
FT                   /product="Catalytic activity: preverential cleavage in B
FT                   chain of insulin: Asn3-|-Gln"
FT                   /EC_number="3.4.23.19"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK46562.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG325156"
FT                   /db_xref="InterPro:IPR000250"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI000004F5F5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R370"
FT                   /transl_table=1
FT                   /translation="MKFTNYLLTTATLASSVLAAPAPRTGLEDRLRARSLQRQSHPLAP
FT                   IPLDTSTKENSRLLEADENTTHVTYSSNWAGAVREQPPPQGTYSAVSATFRVPEPTAQG
FT                   GSGTQAGSAWVGIDGDTYSNAILQTGVDFYVENGQTYNDAWYEWYPDYAYDFDLDVSTG
FT                   DTIVAKVEAISPSQGVATIENISTGKKATQTIRAPAATATLAGQNADWIVEDFQSGDSM
FT                   VDLAGFGEISFWGVQAQGGGSTWGVDDATIVELKQGNEVLTDVEVQSDSAFTVKYTS"
FT   mat_peptide     complement(815549..816328)
FT                   /db_xref="UniProtKB/TrEMBL:A2R370 "
FT   sig_peptide     complement(816329..816385)
FT                   /db_xref="UniProtKB/TrEMBL:A2R370 "
FT   CDS_pept        join(complement(817089..817326),complement(816785..816981))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888481"
FT                   /orf_name="An14g03260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46563.1"
FT                   /db_xref="UniParc:UPI0000EFC73D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R371"
FT                   /transl_table=1
FT                   /translation="MSRNRRLKLPCFRPRDIWPYPGTQDKQGSNKLRADVFSDHADMPQ
FT                   NRKGSCVDWYVRFLIPALVTLPFATRPQTATAEPSPLWQVIRSAEVPSLAQTPASASAV
FT                   VDPALFRRSFALPIASEGPVGVLHLSGKTCALHPLVPAGV"
FT   CDS_pept        join(complement(818347..819214),complement(818081..818277))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182278" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656940"
FT                   /orf_name="An14g03270"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAK46564.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG735894"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR017280"
FT                   /db_xref="UniParc:UPI0000EFC73E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R372"
FT                   /transl_table=1
FT                   /translation="MAPAPIASSSDDIATVLQLVTPPQIAPHRSHDPSNNQKRSDPFQF
FT                   GSRYLEEGDDVFEFNAWDHVEPDDEFKAFAEVQYSKQRETPVSDFDRNRFNADPAKWWN
FT                   LFYKNNTSNFFKNRKWLRQEFPVLADVTQPTAGKKVVLEVGAGAGNTAFPLLENNENEE
FT                   LMVHACDFSKTAVKVMRESPHYNPKHITADVWDVTAEPDENSNGLPPGLTEESVDVVVL
FT                   IFIFSALAPEQWNQALRNVYRVLKPGGHVLFRDYGRGDLAQVRFKKNRYMGENFYVRGD
FT                   GTRVYFFDREETEVEEEQNPTDTKGVFDIEKLGVDYRLIVNRQRKLKMYRCWIQGHFLK
FT                   RDTTAAVDISKIES"
FT   CDS_pept        join(complement(821744..821817),complement(820257..821662),
FT                   complement(819862..820180),complement(819721..819769))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000173155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888482"
FT                   /orf_name="An14g03280"
FT                   /product="Catalytic activity: 2"
FT                   /function="dihydroxy-acid dehydratase activity "
FT                   /biological_process="isoleucine biosynthetic process "
FT                   /biological_process="valine biosynthetic process "
FT                   /protein_id="CAK46565.1"
FT                   /db_xref="GO:0004160"
FT                   /db_xref="GO:0009097"
FT                   /db_xref="GO:0009099"
FT                   /db_xref="HOGENOM:HBG671001"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniParc:UPI0000EFC73F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R373"
FT                   /transl_table=1
FT                   /translation="MLLSQTRGRMPSALRSIAKRSLLNSRPLSTTLPKQQNGNDDEYTG
FT                   LNKVSRHITQPISQGASQAMLYAAGLTEADMNKAQVGISSVWYNGNPCNMHLLDLNNRV
FT                   REGVQKAGLVGFQFNTVGVSDAISMGTKGMRFSLQSRDLIADSIETVMGGQWYDANISI
FT                   PGCDKNMPGVLMAMGRVNRPSLMVYGGTIKPGCASMQGNADIDIVSAFQAYGQFISKEI
FT                   TEPQRFDIIRNACPGGGACGGMYTANTMATAIEVMGMTLPGSSSNPAESDAKYLECLAA
FT                   GEAIKTLLKEDIRPSDILTRQAFENAMVLVNITGGSTNAVLHLIAIADSVGIKLDIEDF
FT                   QSVSDRIPFLADLKPSGKYVMADLHKIGGTPSLLKFLLKEGLIDGSGMTVTGQTLAKNL
FT                   ENVPDFPEDQKIIRPLSNPIKETGHIQILRGSLAPGGSVGKITGKEGTVFTGKARVFDD
FT                   EDDFIAALERNEIKKEEKTVVVIRYTGPKGGPGMPEMLKPSSALMGAGLGQSCALITDG
FT                   RFSGGSHGFLIGHIVPEAAVGGPIGLVKDGDVITIDAEKRVLDLDVEETELAQRRKQWE
FT                   ADRAAGKLPPTGLTLRGTLGKYARTVKDASHGCITDSLE"
FT   CDS_pept        join(822879..823214,823275..825788,825837..827663)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187442" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888483"
FT                   /orf_name="An14g03290"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46566.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG327510"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0000EFC740"
FT                   /db_xref="UniProtKB/TrEMBL:A2R374"
FT                   /transl_table=1
FT                   /translation="MASIATGALGILLISGCTVPALLGIIRRFLHVKETPPIHLPGAHA
FT                   FDRPGYEDKDGEASDEALKGFSDLWQRLGIIILSITGLGISLTQVVISITKGQHLMIVP
FT                   FGLQMGSWGILCVQATGFFIEPAPTKRYMLGVYGFGASLLAAIIPCLEIGLVWNTGYRL
FT                   DTVSVGLTISQFGISCFRATLCLLLPRRPDVYHDGQIVDRERTVSAMERFTFSWVDNLL
FT                   NHAVANEGLEIDDLPKMPFNTRSETLHTHLDRMRGSRALWRSLVVAHQNSLILQSSLSM
FT                   IICVLSFGPQAAMYGILTSLENRYSNPDLNPKDANEAWAWVFGLGTVLILSSSIESWLW
FT                   WIIYAKLWIPIYEGLSALVFAKSMRCKDIKQLVSLEEKEGDDHDADKMQQDVVSQSPIN
FT                   LASVDSKRIADFVMFSYLIPSSVIRLLIGGVFLVHLIGWPSLLAGVATALLVAPMNAYL
FT                   TKNYSTAQEEYMKASDKRMGAVGEVLHGIRQIKFAALEQQWQDRIKEKRRAELGLLWQT
FT                   SLYTIGMVSVWIMGPLMLSAVSLTVYTLTRGELSASVAFTTLSIFGSLESAMASLPDLL
FT                   SKGMEAKISADRIERYLDSSEKSLHTSAVDKISFHNATIAWPGEEGVEFDQRFLLRDLT
FT                   LQFPPKGLSVISGKTGSGKSLLLASILGECDVLSGTVAVPHAPSINKTYDQRATRHNWI
FT                   IDSAIAYVAQNPWLENATIKDNILFGLPYDRYRYRKVIYAAGLKKDIAMFPDSDRTDIG
FT                   ANGINLSGGQRWRISFARALYSRAGILVMDDIFSALDAETGRHVYEHALIGKLGQGRTR
FT                   ILVTHHLGLCLSRTDYCVILSDGLTIHAGTVDELAATQNLIDLLGESAKSSNGRKFDVV
FT                   DEEPVSPMTPMKRVSTESGFSVATSVAEPPRKFTEDEKREKGAVSMQVYTTYITKGKCL
FT                   RWWMMTFLAYVAFMVLLVGRSWWISVWTDSSTSSSQPTHSYDASQSRTIVAKRHYVDKD
FT                   SMFYLSIYVCFSVAACIIGTLRTLALALASLESSQRLFDDLLAAVLRSPLRWLDTVPLG
FT                   RILNRFTSDMYILDWRLGYDIGHFVFKALELTSILAAGVLVSPILLVLACILLVLCFRL
FT                   SKIYLTGMREIKRLESTAKSPVLERFGSSLSGLTTIRAFNKAEIYMKDMYDRIDRHAQA
FT                   AWYLWLLDRWLSFRMSIAGAVLAGMTAALVVYVPSISPALAGFAMTFALQYNYAVSMGL
FT                   RFYANVETDMNATERVLEYCNIELEEQGGHNPPAAWPTRGKVEVEDLAVGYAPDLPPVI
FT                   DGLSFTMENNQRVGVVGRTGAGKSSLTLALFRFLEARQGRVLIDGLDISQIKLEALRSR
FT                   LAIIPQDPVLFSGTLRSNLDPFNEYSDLELYNALERVHLVSFEDTLTLASHSSSEPLSD
FT                   SGTLPSSANSSTEPVKTSNFFASLSSVVSQGGLNLSQGQRQLLCLARAIVSQPKIMILD
FT                   EATSAVDMETEALIQRSIREEFGRNATSLLVIAHRLSTVADFDRILVMDAGKAVEFGTP
FT                   QELLEIEGGVFRNLVENSGERAHLERVIRGEETGSRSS"
FT   sig_peptide     822879..822950
FT                   /db_xref="UniProtKB/TrEMBL:A2R374 "
FT   mat_peptide     join(822951..823214,823275..825788,825837..827660)
FT                   /db_xref="UniProtKB/TrEMBL:A2R374 "
FT   CDS_pept        join(827810..827919,827972..828342,828406..829190)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217470" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888484"
FT                   /orf_name="An14g03300"
FT                   /product="Similarity to hypothetical protein BAB32722.1 -
FT                   Oryza sativa"
FT                   /protein_id="CAK46567.1"
FT                   /db_xref="HOGENOM:HBG325321"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI0000EFC741"
FT                   /db_xref="UniProtKB/TrEMBL:A2R375"
FT                   /transl_table=1
FT                   /translation="MYYFCELIGEDFQECIVFRVFTKPYPTYDEQPLLPFRSGGPALLT
FT                   GFRLAFSYSVIAAFPLRPSLPVVTIIISCFSIQESIQFRHTHMGSDLLRSPTNQDISTE
FT                   KATRSSSPPPLPVVTPAVTAAAAASTAQVDPEDDWAGLCDRQERRRRQNRLNQRAYRKR
FT                   KQAERSGNNALAIRSSSSHPPPPSLGTNIKIEQGSSSSPPSSSSSPSSDSNPSQTLTRR
FT                   TLTREASKPENIRRIFEHFARVAYESYFRGSPSADHLLTLSKLNVFRAFMTNMTVLGFG
FT                   NQTTWCDDDDALSLFNTLPPEAIEEKKLPVSLRPTKIQMQVPHHPWLDFFPLPRLRDNL
FT                   CLMIDRFDDDELCHDVMGFWDNASDTCSLLVWGEPSDPANWEVTEQFLRKWPWVLRGCP
FT                   ELLKSTNRWRQKRGEKMIIRYL"
FT   CDS_pept        join(complement(830807..831190),complement(830351..830748),
FT                   complement(829996..830278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000046303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888485"
FT                   /orf_name="An14g03310"
FT                   /product="Catalytic activity: D-amino acid + H2O + O2  "
FT                   /EC_number="1.4.3.3"
FT                   /function="D-amino-acid oxidase activity"
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46568.1"
FT                   /db_xref="GO:0003884"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327511"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniParc:UPI0000EFC742"
FT                   /db_xref="UniProtKB/TrEMBL:A2R376"
FT                   /transl_table=1
FT                   /translation="MGELQHYPADTPNVPFAQRPIIILGAGIIGCAAARQLLQNGFPVI
FT                   LVAEYLPGDQDFRYASAWAGAAWHPAGGISPEWRYLQAISHRQLLKMAQEEPESGVSIV
FT                   DALEYVERPPAENSSAWGRTLAAKWRDLQPGEYPSEFSCGWSYETLVTDPTLHMPYLAK
FT                   KITALGGQFIRKRVESLEDLYGMFPESSIFINASGIGSQTLKDVQDDLCFPERGQNVFY
FT                   KTENCRTMYFRNGQEYTYVIPRPMSHGVILGGVKQADNLSSEPDMEIARDEIARAHRLA
FT                   PEIVPEHPPEDTLSYIVGIRPSRKGGFRLDSEQQGSRYILSAYGFGGGGYAFSYGVADA
FT                   LCKMVEKAERENVI"
FT   CDS_pept        join(831276..831355,831467..831580,831675..831867,
FT                   831918..831998,832131..832346,832436..832593,
FT                   832653..832880,833120..833162)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113822"
FT                   /orf_name="An14g03320"
FT                   /product="Similarity to hypothetical protein 68B2.60 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK46569.1"
FT                   /db_xref="UniParc:UPI0000EFC743"
FT                   /db_xref="UniProtKB/TrEMBL:A2R377"
FT                   /transl_table=1
FT                   /translation="MVQEGKKDGTVVWEANDARAHRERDDNHESDHEPLARKKCSGMGE
FT                   LFGSKRPEARSARRLEPTSGEVNPSRTRQLPVSPAALIGPGWMAPCPTRLDGAALSDRQ
FT                   ILLYSQTDPRKSIWCFMSTCHVIESDDNVRKPSSSQMKSRKKSAYRLPRPIMSGTSAGH
FT                   SNPVCSAIAFVLPSRMLRGLDSHRNNESSLVNEVDLSGDAAYTRPLNSQPPHPCRSPAG
FT                   VCRVFEDNCVQGTSSGECCKRSSLSMTTVSGRPELTGIVSGALSQENRCVSEPPGLPDW
FT                   VSHYMVQLGTERSDACLPACLHFSKKIRFKEDLRFSGHDKARCRFRELALVTLRDILAT
FT                   SALMPDIIDVVSRCRKRQQKNKQLAIPELL"
FT   CDS_pept        join(complement(835130..835346),complement(833967..835057))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076750" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888486"
FT                   /orf_name="An14g03330"
FT                   /product="Similarity to hypothetical protein SCF12.05 -
FT                   Streptomyces coelicolor"
FT                   /protein_id="CAK46570.1"
FT                   /db_xref="HOGENOM:HBG322899"
FT                   /db_xref="InterPro:IPR021889"
FT                   /db_xref="UniParc:UPI0000EFC744"
FT                   /db_xref="UniProtKB/TrEMBL:A2R378"
FT                   /transl_table=1
FT                   /translation="MSHSAAELQKPTGEYRQYLPDLSLKRFQVMRNQDAHEYAHDFKTL
FT                   KNPPWLHALYMHWVDLLQEPFKGVTTDGNVRPGLFTLQDEGVPVGDIVDSVQNVLSLAD
FT                   DKQRQALSYHIDSPEWRTWSNPEFLLAHKGLRLDEIDNKLRDAIMNVLKTSLSPEGYDK
FT                   AVKAMRINHFLGELVESPKVMNEFSYNFVLFGRPSTTRPWGWSFYGHHLCLNIFLYKNQ
FT                   IVASPWFTGAEPNEIDDGPYSGTRIMQVEEELGLRLMQSLTPDLQQKARVFAEMHDPAM
FT                   PPGRWNRDDQRHLCGAYRDNRVVPNEGITVDGFTEEQKKYMYGIFEQYLLYLPARARQM
FT                   KLDQIRQYESETYFCWIGGYGDSDPFYYRLQSPVVLIEFDHHSGVFLNNEEPKKFHIHT
FT                   LLRTPNAGDYGQALRAQIPAVEGLNGKEIVWEKSAL"
FT   CDS_pept        join(complement(837957..838065),complement(837624..837865),
FT                   complement(837456..837566),complement(837255..837399),
FT                   complement(837049..837203),complement(836809..836966),
FT                   complement(835864..836752))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888487"
FT                   /orf_name="An14g03340"
FT                   /product="Remark: expression analysis of tfdB "
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46571.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG569405"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000EFC745"
FT                   /db_xref="UniProtKB/TrEMBL:A2R379"
FT                   /transl_table=1
FT                   /translation="MSPTKDEIPFDDDVPILIVGAGPCGLLLAYLLAQLGVRSLLCERY
FT                   PTRLQAPKAHALSPRTLELCRQYGLDVNEIRSIGTKRGEAFWVNFITSLSGRHVGRLPY
FT                   ERMDPAVLESTPTMIHNIPQPEFEELVAKRLSKNNLVEIRKNHSFVRLVDRGDHVLATI
FT                   EDRATKQEYTVKCCHLVACDGAKSAVRRCLGIESEGEDSYETMMTIHINANLHPVVKER
FT                   VGMLHWVMDPEVSGFIIGYDLGGNQVLICNFDAEKHPVETWDEALCRKVVDAAIGTKIP
FT                   YDVLSYRPWILSRKVALSYRANRVLLAGDAAHSFPPTGGLGLNSGLGDVHNLAYKLAAV
FT                   HHGWGGDRLLDSYEADRRPVACDNAEQSVKNGKQIFGLLKALGTTDPDVRVARQNLYRN
FT                   IEDSHMMKEINKGIEGQREHFDNLGLHVGYVYGNHRRPDCASTYEPVCTPGARLPHAWI
FT                   NLLTPEQIRLPPIDCSYVSEFLPEELKLKQFSTLDLCAFDAFTLIVDIRSADHWGKILE
FT                   EVKRQLSGKCDGLKIEMMTRGANFDLQPGGGDKWMALTRVAEGQAILVRPDQHVLARFE
FT                   YPGESSGVLGELRAHLAWDEGAGGSG"
FT   CDS_pept        join(838519..838576,838821..839096,839276..839334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888488"
FT                   /orf_name="An14g03350"
FT                   /protein_id="CAK46572.1"
FT                   /db_xref="UniParc:UPI0000EFC746"
FT                   /db_xref="UniProtKB/TrEMBL:A2R380"
FT                   /transl_table=1
FT                   /translation="MATDPPGVPRVPIGSEARCVELPYRKNMGQRHARPSPVTRNGDIP
FT                   RDRHAHPRTPRASHDSSTSKPDALIGTPLWQSSRILHILVNQCLSRQLYSLTISFPTVL
FT                   GAVEIPTASLPVKLDNCCDILSGKLR"
FT   CDS_pept        839669..841804
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000191288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888489"
FT                   /orf_name="An14g03360"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAK46573.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG324690"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI0000EFC747"
FT                   /db_xref="UniProtKB/TrEMBL:A2R381"
FT                   /transl_table=1
FT                   /translation="MARRFMIPWLYDLGVWIFTLCLDIFFREVYSRGAWRIPKRGPVII
FT                   VAAPHANQFVDSILLMRILKHYAGRRTSFLIAEKSMREPYIGTMAGCMGALPVVRSMDH
FT                   VKPAKGEIYLPDPDNDPTLVRGRGTDFTSDQFMVGGAIILPRVGKTSPEQQAIEEILSP
FT                   EEIRLRKPFKKFEKDHPLYEPLRKGTPFKAAPHIDQSKMFASVYSELVAGGCIGIFPEG
FT                   GSHDRPSLLPLKAGVAIIALGTLAQDPNCGLSIIPCGMNYFHPNKFRSRAVVEFGNPVQ
FT                   VHPDQIEAFKAGGNSKRNAVGSLLETITEALTAVTQQAPDHETLMVIQATRRLYKPLRM
FT                   KLPLPVVIELNRRLLKGYTQFKDEPKVLQLKKAISDYNRRLRALGIRDHQVEWGDVTHR
FT                   PWWLVFGTLLYRVGELLTLAIGTLPSVALFWPVFVTAKVVSVKKQRKALAGSVVKLEGR
FT                   DVVGTWKILVAMGLAPALYTWYTVIVTIWLHYCRHDGHYASVVPWWLNARTYISDSIPL
FT                   ALFSIFFFGLMISVSFAGLRIGEIGIDVLKSLPPLLRALDPRSANSLAKLRAERQALSA
FT                   RVVDVIDTFAPEIFPDFESEKLIPHEHPEDDTYQSRLKSMPPSEPESRNRSKDRTSRSR
FT                   SRSAGFHLYDTLLKPLSIKSKDDLGEVNRRIHVSMQERGRQRARNEIDPDEDVVSLDGS
FT                   VSAQSGDIAVEEVKKTK"
FT   sig_peptide     839669..839761
FT                   /db_xref="UniProtKB/TrEMBL:A2R381 "
FT   mat_peptide     839762..841801
FT                   /db_xref="UniProtKB/TrEMBL:A2R381 "
FT   CDS_pept        join(complement(844164..844661),complement(843570..844106),
FT                   complement(843443..843518),complement(843093..843418))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000219146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888490"
FT                   /orf_name="An14g03370"
FT                   /product="Catalytic activity: allantoin + H2O  "
FT                   /EC_number="3.5.2.5"
FT                   /function="allantoinase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="allantoin catabolic process "
FT                   /protein_id="CAK46574.1"
FT                   /db_xref="GO:0000256"
FT                   /db_xref="GO:0004038"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG724623"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="UniParc:UPI0000EFC77A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R382"
FT                   /transl_table=1
FT                   /translation="MEASQIPSIAVIASSRAVISGRLTSATIVISRTTGKITAVFDSVI
FT                   PASDFPAGTPYTDYSPHVLLPGLVDAHVHLNEPGRTEWEGFYTGTQAAAFGGVTTVIDM
FT                   PLNAIPPTTTVANFKEKLRAAQGKCWVDVGFYGGIIPGNAGDLKALVQEGVRGFKGFLI
FT                   DSGVDEFPAVSSEDIRKAMAELADEPTTLMFHAEMLPPSTAAEEKDQALEGPAEAYSTF
FT                   LASRPSAFETCAVEEIITLSQVAPKLPLHIVHLSAMEAIPLLRKARADGVPITAETCFH
FT                   YLSLAAEEIRDGDTRHKCCPPIRSQSNQDALWDELERHAEDGVIQTVVSDHSPCTPDLK
FT                   LLPSHGSFLSAWGGISSVGLGLPILWTELSHETTTQQALQDVVRLCCTNTAVQVGLQHQ
FT                   KGDLVPGHDADICVFDDTAEWIVEPSTMLFRNKCSPYQGRKLRGMVRETWLRGEKIFSR
FT                   DDGFSTKTPSGGLLLEKRAC"
FT   CDS_pept        join(845301..845383,845477..845528,845616..845752,
FT                   845869..845949,846042..846147)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113823"
FT                   /orf_name="An14g03380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46575.1"
FT                   /db_xref="UniParc:UPI0000EFC77B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R383"
FT                   /transl_table=1
FT                   /translation="MGRGIGRLRHPPSDLSCWLLQVIASSPLPRPPALANLMHPRFGRT
FT                   RVQRTKVNCMLRFAYTPVIDRDHRAKNRGFSGTPGSGRTLQWSVAKLQKKWEADHRRLE
FT                   CGGKKGERQQASEMPQVLLQTSSPPLLNTESLLSRMRRWGRQYYSSVT"
FT   sig_peptide     join(845301..845383,845477..845498)
FT                   /db_xref="UniProtKB/TrEMBL:A2R383 "
FT   mat_peptide     join(845499..845528,845616..845752,845869..845949,
FT                   846042..846144)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R383 "
FT   CDS_pept        join(848134..849264,849321..850569,850632..850861)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217205" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888491"
FT                   /orf_name="An14g03390"
FT                   /product="Remark: FluG from E. nidulans has no apparent
FT                   role in glutamine biosynthesis"
FT                   /function="glutamate-ammonia ligase activity"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="CAK46576.1"
FT                   /db_xref="GO:0004356"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="HOGENOM:HBG327515"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniParc:UPI0000EFC77C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R384"
FT                   /transl_table=1
FT                   /translation="MDPLASLRRLIQTHPLIDNHAHNLLAQAAARNYAKYPFEQITSEA
FT                   QGSALHNAPSTLPLQRAAAQLATLYDCPTSEWDRVKAARDQYVERDYDGLIRRCLEGTH
FT                   SLLLDDLLTDQDIEPFTWHDRFTTAPTKRIVRIEVVAAQVLTSILPNGYDQSSSDITVL
FT                   RQYLDQFSQGFNQKISEAIADPVVVGFKSVICYRTGLNVQVADDKDDSNLLESFSRTLS
FT                   QGSGSTYRVEDKPLNDWLVRQALNQLQSAKEKDASEPNKPLQLHTGLGDNDINLILSNP
FT                   AYLQDLVARYPKVDFVLLHSAYPYTREAGYLACVYPNVYLDLGEVFPMVSRDAQESIIR
FT                   ESLEIVPTTRLLWSTDGHFFPETYWLANKQFRDALEKVLVDYVIQGDHSVDQAKLAAAD
FT                   ILFHNSNRLYSLNETVSYDDRLVPAVSNLSGLSSTDALESFMHSNPDVKYIWMQFFDYT
FT                   STVRVRMFPIREFAKIVRKQRRIGICTATFLMLQSDTVCPEGSTTGQFYLEPDLSTLSR
FT                   NVGIDSKSATVMTWGRSEEGLEVEGCPRTLLRRVTTDLRANHGIEILCGFEIEVILLKC
FT                   VTKPDTDEEEFVPCVRNHSWSQMTRDTRRMVPLLEEIVDTLASIGIDLEQFHAESAPGQ
FT                   FEFILPPGSPVAAVDTLLKARQVVTYIAEQHGYRATLHPRPFSHAAGSAAHAHVSITPA
FT                   TQEESFLAGVLKHFTSLTAFTLSNDVSYERMHSGLWAGSEWVAWGTQNRETPIRKISAG
FT                   HWEIKALDGLSNMYLAMAAILAAGYLGVQDKLPLTLQDCLYDAATLSEADRSAIGITTQ
FT                   IPTTLAQSLDNMAADKALRDVLGNTLVENYITVKRAESKKLNAMEAEARRKWLVERY"
FT   CDS_pept        851178..852293
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000022686" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888492"
FT                   /gene_name="argB"
FT                   /orf_name="An14g03400"
FT                   /product="Ornithine carbamoyltransferase argB-Aspergillus
FT                   niger"
FT                   /EC_number="2.1.3.3"
FT                   /function="amino acid binding"
FT                   /function="ornithine carbamoyltransferase activity "
FT                   /cellular_component="ornithine carbamoyltransferase complex"
FT                   /protein_id="CAK46577.1"
FT                   /db_xref="GO:0004585"
FT                   /db_xref="GO:0009348"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG579429"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="UniParc:UPI0000EFC77D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R385"
FT                   /transl_table=1
FT                   /translation="MPSPLRTAAAAARYGPSTTRHALRRLYSSTSHSAATPATSPFAPR
FT                   HLLSIADLTPTEFATLVRNASSHKRAIKSGSIPQSLHGALSGKTVAMMFSKRSTRTRIS
FT                   TEGAVVQMGGHPMFLGKDDIQLGVNESLYDTAVVVSSMVECIVARVGKHADVADLAKHS
FT                   TKPVINALCDSYHPLQAIADFQTISEHFAASGKGKLEGLGLNGLKIAWVGDANNVLFDM
FT                   AISARKMGVDVAVATPKGYEIPKEMLEIIEKAGEGVKSPGKLVQTNVPEEAVKGADVLV
FT                   TDTWVSMGQEEEAAKRLRDFAGFQITSELAKRGGAKEGWRFMHCLPRHPEEVADEVFYG
FT                   HRSLVFPEAENRLWAAISALEGFVVNKGKIE"
FT   CDS_pept        join(complement(853522..853902),complement(852776..853465))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962821"
FT                   /orf_name="An14g03410"
FT                   /product="Similarity with EST an_3520 Aspergillus niger "
FT                   /protein_id="CAK46578.1"
FT                   /db_xref="HOGENOM:HBG325034"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000EFC77E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R386"
FT                   /transl_table=1
FT                   /translation="MRAASLYSLPSISRPNRSAATSARLFSCTSLRSNRSRIPLDIPPP
FT                   FPITKTCPEPSCSCPSTPSMPAPIDYDQPLNGTMAAYAQQLLICTGQRDWTSRIEEDGQ
FT                   GQNWGELVRGLKSLLGRGGKYADPFNNILVTNASFLPSSSSSSSSTSTSTSQTASAFLF
FT                   PSFKYFPSVPVNLPDSAPATTDLSTFVRAFLLPIESRHGGQIRDQALAAEFPDAVDLQH
FT                   SPVVLICGHGGRDMRCGVMAPVLETEFQRVLQSKGYTSAGSDNSVVDSPEHAHIGLISH
FT                   VGGHKYAGNVIVYIPPGMKEAGSSSPHPLAGKGIWYGRIEPKHVQGVVEETILGGKVIT
FT                   DHFRGAVDRESGVLRL"
FT   CDS_pept        join(complement(855892..855946),complement(855799..855839),
FT                   complement(855325..855705),complement(854748..855269))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888493"
FT                   /orf_name="An14g03420"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK46579.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG327516"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI0000EFC77F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R387"
FT                   /transl_table=1
FT                   /translation="MAPVGLLTKLRTLITKDYDEPAISTQTAAFLSVCLTLVYVVPFYV
FT                   NPTTRPSPTLSRDAPSVIRARIRAVTFSCTISSLVVLWLVAAKENASFSRALHFLGWWP
FT                   VGLVDIFRSLLLTAILFAGPLFERGVAEGEWREWIRGGRVTASLRSWIGWRNYVAGPIT
FT                   EEVMFRSAIVPLHLLAKVDPGRIVFVAPLYFGIAHVHHFYEFRLTHPDTSIVAAILRSV
FT                   FQFGYTTIFGWYATFVYLRTGSLLAVILAHTFCNWCGLPRLWGRVEAGVPIGPPMVKGK
FT                   GSSDVTYGQLSLGWTVAYYVILVAGAIGFFQTLWPLTESLNALASFSGATK"
FT   CDS_pept        join(857124..857417,857469..857479,857527..857779,
FT                   857833..859137)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113824"
FT                   /orf_name="An14g03430"
FT                   /product="Remark: aflatoxins are polyketide-derived
FT                   secondary metabolites."
FT                   /EC_number="1.14.13.-"
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46580.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG655952"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI0000EFC780"
FT                   /db_xref="UniProtKB/TrEMBL:A2R388"
FT                   /transl_table=1
FT                   /translation="MAAVKGPELIRHEPVIEADPKHLPAVSLGSLINELSVSEKADGQA
FT                   RPAFEIEEHPIDEVRPIKVGVIGAGLAGITAGVLLPAKLPGLDLRIYEKNSGVGGTWFE
FT                   NTYPGVRCDIPAHVYQSGFEPNTQWSEEFAQGAEIREYWQSIARTYDVHKYLRLQQKVD
FT                   QAVWLPELGKWRVTLQDLGDSNRIYEEDLDVLINAIGHFNEWKLPEYPGREEYTGVLFH
FT                   SSHWNHNVDLNGKRIALIGNGASGLQVLPSIQPIAQHVDHYARNRTWIADSFGTSGVRR
FT                   LEANLFSPEQLESFRDPDTYLAYRKSVEAGYFSRFGAIFKDSPENRGLREKWTELMKSR
FT                   VGDQPELIDKLIPDFPPNCRRPTPGPGYLEALTKDNVSYIQTPIQRFTPTGIVTTDGIE
FT                   RPVDIVICSTGANVDHAPPFSIISNGIDLKKAWKHDGLYGYPYNYLGVATPGFPNLLWI
FT                   GGPQSTGPSGSVPNSLENQITYIAKLLRKIRSQGIKAMVPSKQAADDFVEYCDKFYPRT
FT                   VWTANDDSTPGQKNCSSWYNGGRPGGKVHGQFPGSAAALNYLRRDPRWEDWDYSYTNPS
FT                   GNRFAYFGNGWTTRETIPDADLTPHLKRPDTIDLRSYLEGWWDV"
FT   CDS_pept        join(complement(860284..861014),complement(859939..860216),
FT                   complement(859255..859886))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113825"
FT                   /orf_name="An14g03440"
FT                   /product="Remark: cercosporin"
FT                   /protein_id="CAK46581.1"
FT                   /db_xref="UniParc:UPI0000EFC781"
FT                   /db_xref="UniProtKB/TrEMBL:A2R389"
FT                   /transl_table=1
FT                   /translation="MLRSVAHAAGVSSNLQTSSNASTNEDLSNLAIPDTNHDSILVPPS
FT                   LTTAPSHSTTTPSLCNGSSQPLALQPPLYELNLDEASWYLERFTTNMLLCFPFICLPPN
FT                   TTTQQLQEDRPFLLEAIIAVATPSTQAKLARTDRLKSRLTKSAMLENQSSIDMLLSILT
FT                   YIAWSTDPFVKRASNLSRMIMLAISMVYDLQLDKQPPPEVPIIAKMAPGLENPEQNASN
FT                   NSLQWISEQHRAKLACFVLSSIISSTIGRIASLRWDIQMEHALNIIETNKESPSDEYLT
FT                   AQIRLQILAQKALSLRDPDEPSPSTTPPATTMYLKVLQRQLAELQSSVLPHLPHYELLH
FT                   LQTHYTSLLLHETPRPASSSTPLLPSTPDSLTSLWNSVQAIKSWLSTFQALPASTITGF
FT                   PFFMWFQLVRCIVLLKHLSTFEDPAWDRDAVRQEVDMLALLEWMGEKAEMASLEAGEGS
FT                   DDDLFRRVGRMLRLAREWVVKKMRGEVGGDGLVSEENSAGSNEGSSGTMGIDMDMDMTD
FT                   MAWMHALESGDGGWLEEVLGWSPLAVYNI"
FT   CDS_pept        join(complement(862251..862605),complement(861553..862190))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809603"
FT                   /orf_name="An14g03450"
FT                   /product="Similarity to human secreted protein "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAK46582.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC782"
FT                   /db_xref="UniProtKB/TrEMBL:A2R390"
FT                   /transl_table=1
FT                   /translation="MASISEIRASNSRITSETVPRTAVFTGATDGIGKATLTRLISTNL
FT                   PVRVYVIGRNGKRHQAFLDELRLSNRQAQITWLEGQLSLLADTKKLCDEIKRRETSLDC
FT                   LYLSAGFISSGERIETSEGKSLSLSLNYYSRILMMTLLLPLLNSSPNSPRIVSILNAGY
FT                   ESSSIYLDDLDLEKPGHFSLLSLTKSMSTYTTLSMSTLAQENPHVVFVHHYPGGVTTDA
FT                   FKKAWGGKWYFPLFRAALSAFGTSPEDAAEKVLYLITSAKYGGRGVPLREGQKAGMTMA
FT                   TSVKGGELFAIDNKMKELFQGKVMLELQAMNAGEIVWRKTVETLAPYSS"
FT   CDS_pept        join(complement(865097..865273),complement(864927..865037),
FT                   complement(864743..864867),complement(864161..864686),
FT                   complement(863506..864095),complement(863372..863465),
FT                   complement(863259..863321))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186439" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809604"
FT                   /orf_name="An14g03460"
FT                   /product="Similarity to Leishmania antigen M15 protein
FT                   patent WO9835045-A2"
FT                   /function="binding"
FT                   /protein_id="CAK46583.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0000EFC783"
FT                   /db_xref="UniProtKB/TrEMBL:A2R391"
FT                   /transl_table=1
FT                   /translation="MSDKGNATKKIGPQALSCKGADVMSILDNRAATYIKLTQYDRALN
FT                   DSRQMIRRDTKDGRGVLRYGQTLLLTGDRAKALKAYGYGLKTLPEDHPRRKMILQMYCK
FT                   VKERASVKRLDPFDTLPLELAMMVLQHFNFRELAVLLRVSKGWQRMLSQPDLWMHLDFT
FT                   EARRKVHWRSFRAFVQRSRALLTHAVMTNISTPFQDRVLEALSRCPKLEHLEIRDPITQ
FT                   PNGLYDVFRSSTQLKSLVIGKQTPVAQENIAKFLSSLTQLELLEIHNAQPSPESRVLWP
FT                   SHLPNLRSIALFTEASMPAPGRVPALYIPPATESMSCSMPNLEELRLDSYPKVWAPYNL
FT                   SFDPVQFPRLRKLDLKGVFVGPFGLPPSLEYLSIHAGAAPTGEEFPFSPEQLLHLPNLH
FT                   TLILRDLIWVTYRTLHGFIVDSKASLRNLVVDRCPQLDTGKLSLVLVENSVNLTELGVP
FT                   QLPGINDSTVKTLVEGLSNLTALDVSNTDVTGYLLKMLADARSSNVDFPRVEQLPTLGH
FT                   MGSVSFGDVHASAQTHPEACWHAQIYKVCIRGMAVLRPRKSNVV"
FT   CDS_pept        join(865721..865900,865955..866035,866097..867578)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809605"
FT                   /orf_name="An14g03470"
FT                   /protein_id="CAK46584.1"
FT                   /db_xref="HOGENOM:HBG325473"
FT                   /db_xref="InterPro:IPR021622"
FT                   /db_xref="UniParc:UPI0000EFC784"
FT                   /db_xref="UniProtKB/TrEMBL:A2R392"
FT                   /transl_table=1
FT                   /translation="MEPQNLQAASTYINNVLLARGLLKSGQPIDFANPEDEEGGTAATM
FT                   GRIINLINDLVLRRDREAEHRENLATTIRTLRAEESQKTAELEKVKTKASELTRSLALA
FT                   EAQERALKANASSADSTIRGLKEQVQRMKTTIQQVRAQCANDIRKRDLEMQKLKSHLAE
FT                   RQRGKREGLSMTTININPAASQSSWSRLAAGGEGINDPGYSLKQETNDFLTELCQNLSD
FT                   ENDTLISLARNTVETLKDLQGLSQAEDEDKSATGMASVGAGRSLQGSVTALPTSCDELS
FT                   AQMDHVLEHLRTLLTNPSFVPLEEVEMRDEEIKRLREGWEKMESRWSQAVTMMDGWHKR
FT                   IADGGYSIQAEELRQGLDLRLDITQALSQDGGRDTTIQSPIFEDQEAEEEEEKQTAAKI
FT                   TTEPSRPAQSPRRTRQSTRETRSRRASKALKERSDNIMTGRSPRKVSFTAGLQDSPCEP
FT                   SADDETLQVKAHRSEAVTRRPSRRKAESKGLSRQGSSAQSPQPKESRRATAIQASSSQA
FT                   RLSVPQKLAAAESEAREAEQARKESESRKRGRALKGSSKGHGDRRRSTLTSDELGELMG
FT                   MPAK"
FT   CDS_pept        join(complement(868341..868492),complement(867916..868248),
FT                   complement(867732..867837))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888494"
FT                   /orf_name="An14g03480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46585.1"
FT                   /db_xref="UniParc:UPI0000EFC785"
FT                   /db_xref="UniProtKB/TrEMBL:A2R393"
FT                   /transl_table=1
FT                   /translation="MEKEELLWLTRSKIASSQSVSVLWREKYERQRTKQPAGLYTNVRS
FT                   YAFTMRTLLATRRFLACYDFYGMKEMGRQNLVAVLPFSVICGILKPPILPGELQIGVRV
FT                   TWSVLLSGWVARNSGLFWGKSGHGSLGARTKYTTMRLRPGILADMIHSVRKIQPVDIDL
FT                   DGHRQKLEHVEIRKYRMAALRNCSWYCGDTGMY"
FT   CDS_pept        join(868676..869373,869435..869567,869617..870063)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809606"
FT                   /orf_name="An14g03490"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK46586.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EFC786"
FT                   /db_xref="UniProtKB/TrEMBL:A2R394"
FT                   /transl_table=1
FT                   /translation="MASHHQLTRAIPYPGKEPFGALWNKCIWQWVFFTGARLRLRVLEK
FT                   NRLFWIYFVIPPWCDPEESYHLPGVPEMAQWDVIHTESTMPNGYHVYVTSRITSHGFEG
FT                   QQYIPAGNFPSFQHVSHNHHFSHMTHPGYQVHHGSPLQQVLKRSGPSWVTIPPQSSLQG
FT                   SVQAQAGPSQGNVANNPCEPEQPESQSRELSPLESGHDIVCDVLIVGEIEVTDENAQDL
FT                   LPLEARLFVGNIPSALCPTQIKFELKRILARYGCCYVKVKTNPNSGLRTAFAQFETPEV
FT                   ANRVMQKSKDQPSEFDLHHRSLRFEMAKGKREISTRTRSREVFSQPDPCTTRVDNIEGR
FT                   VEPAQEMNGEGRVEPAHNMNAEGNVEPTHRINGEGRVEPPQDNREVVSESGKSAGETRE
FT                   SFYNVGARGSHSAPCLPLVWEASATA"
FT   CDS_pept        join(complement(872923..873068),complement(871757..872864),
FT                   complement(870823..871695))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888495"
FT                   /orf_name="An14g03500"
FT                   /EC_number="2.2.1.3"
FT                   /function="formaldehyde transketolase activity "
FT                   /function="transketolase activity"
FT                   /protein_id="CAK46587.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="GO:0047896"
FT                   /db_xref="HOGENOM:HBG565885"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniParc:UPI0000EFC787"
FT                   /db_xref="UniProtKB/TrEMBL:A2R395"
FT                   /transl_table=1
FT                   /translation="MAVGPVPQSNGASALPLVRQLSKDHDHVLKSFRLLISDLCQQFGG
FT                   GHPGGAIGMAAIGVALWRYVMQYAPHSPDYFNRDRFILSNGHTCLFQYAFLHLTGYKAM
FT                   TFEQLKSYHSDRVDALCPGHPEIEHEGIEVTTGPLGQGVANAVGLAMATKNLAANFNRP
FT                   GYDVISNHTWCMIGDACLQEGVGLEAISFAGHLKLNNLTVIYDNNQITCDGSVDLTNTE
FT                   DINAKMRACGWDVIDVEDGCYDVEGIVQALEKARASQEKPTFINVRTVIGLGSKVEGMA
FT                   AAHGAAFGAPDVADMKRKYGFNPDEHFVISDTVRGFFQELPTRGEALVQQWNSLVKQYS
FT                   AEYPELGAEFQRRMRGELPSNWKDLIPSSFPDKPTATRASSGLVFNPLAKDIESFMVGT
FT                   ADLSPSVNMIWPGKVDFQHPDLRTTCKINGNYSGRYIHFGVREHAMCAISNGLAAFAPN
FT                   TFIPITSSFFMFYLYAAPAVRMGALQHLQVIHAATHDSIGMGEDGPTHQPIELAALYRA
FT                   MPNLLYIRPGDSEETAGAWIAALEAKKSSSIISTSRHALPQLKQTRREGVALGAYVLEE
FT                   ADDASVTLIGVGAELSFALEVAQQLKETKGIAARVISFPCQRLFEQQPLEYKRTVLRRH
FT                   QGIPAVVIEPYAPNGWERYGDAGINIRRFGHSLPGKAAYKFFGYETGVMAAKVSDYLDR
FT                   LEKGEWQRGEFVDL"
FT   CDS_pept        join(873593..873798,873854..873981,874035..874194,
FT                   874253..874721,874776..874979)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962822"
FT                   /orf_name="An14g03510"
FT                   /product="Catalytic activity: L-iditol + NAD(+)  "
FT                   /EC_number="1.1.1.14"
FT                   /function="L-iditol 2-dehydrogenase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46588.1"
FT                   /db_xref="GO:0003939"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC7B0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R396"
FT                   /transl_table=1
FT                   /translation="MAPSVLLSSPAPTSTSKASLTEQVQLSPPLPNPSLQITADHNLKF
FT                   VPAPVYAPQRGEVLLQIKATGVCGSDIHFWKTGRIGELVFEGDCIIGHEAAGVVLKCGD
FT                   GVTHLQPGDRVAVEPGVPCEHCFLCDDGRYNLCEDVQFAGVYPYAGTIQRYKVHPAKWL
FT                   HKLPDNISYLEGALLEPLSVVMRGIQVARLHLGRAVVVCGAGPIGLIALAAARASGAHP
FT                   IVITDIEPKRLAFAKEFAPWCNTYQVNPALDAEGNAKAIRALFGPDEYNAPETVLECTG
FT                   VENSVCTAAFTARRGGAVVVIGVGKAVMNNLPFMHISLAEIDLRFINRYRDTWPPAIAC
FT                   LTGGILDLKKLVSHVFPLEKAVDALNLCADPRNGSIKVTIVDEVEATL"
FT   sig_peptide     873593..873646
FT                   /db_xref="UniProtKB/TrEMBL:A2R396 "
FT   mat_peptide     join(873647..873798,873854..873981,874035..874194,
FT                   874253..874721,874776..874976)
FT                   /db_xref="UniProtKB/TrEMBL:A2R396 "
FT   CDS_pept        join(877110..877209,877414..877658,877729..878178,
FT                   878242..878820)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888496"
FT                   /orf_name="An14g03520"
FT                   /product="Function: Dfg5 from S. cerevisiae is required for
FT                   filamentous growth"
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAK46589.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI0000EFC7B1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R397"
FT                   /transl_table=1
FT                   /translation="MRLVRDCLYGGLFLNTALFSQLSHAIDIDISSTSSIKDAASKTAY
FT                   GSMTWYHGNETGQIPGAFPSKWWEGSALFTSLLLYWYYTGDSTYNDEVRQGMQWQAGDC
FT                   DYMPANYSSYLGNDDQMFWGLAAITAAEIEFADSSSGYSWLALAQGVYNTQIDRWDDST
FT                   CGGGLRWQIYPYEAGYAMKNSISNGGLFQLAARLARYTSNDTYADWAEKIFDWCASTPL
FT                   LNNETWNVADSTDVDNSCSTQGNNQWSYNYGVFLTGAAYMYNYTGKAKWKTAAEGLLNV
FT                   TLDTFFPAKYGGNIMSEILCEPTEVCNDNEILFKGLVTGWLGLVALVMPSTYDSILPKL
FT                   QGSAEAAAASCSGMSNNTCGVRWWPKKWDGWNGMEEEIAVTNVLSSALVNTKKTAPVTS
FT                   STGGNSSSDPNAGTGDNTGSSGSTESKITTGDKAGASILTIAFVGMWGGMIAWMVIGG"
FT   sig_peptide     877110..877184
FT                   /db_xref="UniProtKB/TrEMBL:A2R397 "
FT   mat_peptide     join(877185..877209,877414..877658,877729..878178,
FT                   878242..878817)
FT                   /db_xref="UniProtKB/TrEMBL:A2R397 "
FT   CDS_pept        join(complement(881383..881673),complement(880858..881231),
FT                   complement(880729..880793),complement(880246..880655))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888497"
FT                   /orf_name="An14g03530"
FT                   /protein_id="CAK46590.1"
FT                   /db_xref="HOGENOM:HBG327523"
FT                   /db_xref="UniParc:UPI0000EFC7B2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R398"
FT                   /transl_table=1
FT                   /translation="MTSSLETASRVPVVIAGYTVPIVCMTLCTGLRLFVKVRGPTEDRF
FT                   HADDYLITLATVLLPPYRLVPVHTDDLCCLRLDAGGNIQYYHAGRRYGLHALGDYIASH
FT                   LYNVGLASVKLGILALYYRIFAIQWFRRTVIGCVTFVCLWIATIEIFMGLLCRPLEAFW
FT                   DASVKGHCFNSSALSYYVNTSNMITDLVIFALPIGVIVRLRTTRSNKIALCIIFSIGFI
FT                   TCGISAARLAFVFAESSSDITWDGVDLGVLSGFESLGGILCANLPIIYRLFRQAAQKVT
FT                   SRTGGSSSIPHLQYGRESKNFTSRSRPRRHRLSETLNEQWIQLQNGNSSNDSHVSRGQD
FT                   FAVQKVVDMETGMEVVRLSNVPNAITVKREFHQTVEGRR"
FT   CDS_pept        join(882491..882768,882863..884615)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888498"
FT                   /orf_name="An14g03540"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An08g01290 - Aspergillus niger"
FT                   /protein_id="CAK46591.1"
FT                   /db_xref="UniParc:UPI0000EFC7B3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R399"
FT                   /transl_table=1
FT                   /translation="MAFPPPVSSFSPLGVLQRSFPHLILLTREITRSGVECPSKDMIDC
FT                   RHVHFVVVEPWPSNFIRLRFVASEDVPTQNPVPQRLSYVSSETGQMRRDKEAYSPMRPE
FT                   AHPVCVRCQRSKNRCNYGVRLQWEDDMRAAGKCHGRTGIVTRRDSLRCKESEEDEDLLP
FT                   SKRIERKDQPGSDGESALILTPPSSHSPLRAATSESVSFLTRDTYHSQYQHWKESKIKS
FT                   SNTTFRTLPWTLGVPDVDDVCLSFYESIMCPAAVTIDNEETNPLRNTVMRMVFRSELAY
FT                   YSVLMTSAQYLRSIDSRFELFEMQVRQRVLKGLRQALAESCFEFEDVLLPTIFLCSSAV
FT                   CDVLALDVLMGVSIDSQQISHSCDASWVRHLTCFQMVIKQKIRRHTTTDVPQLFLSYFL
FT                   AHLVLAKSLFPIDKALPVVELRNDLSLPVEEGASWTSSDSLSKAMDPDTLHEIDVWTGM
FT                   SNRMLLLINDILSLKDDVRALYEEGTEAEEKQRVIEAKIITLQRNLQDTTHLLPKSLRR
FT                   CQDSAEVVHRRRLLEYTGESYRLAACLLLSEASTPAFLGYISEPSLGLDTTRKQRHVDY
FT                   ILSLVESIVSSLDHLPISWPLWPLFIASCCSTSESDKARALAQFQAAQAKAPYENTVRA
FT                   QTVVELLWQRRELYVAGERTRTGRFEWELVMEFLGWQTSFA"
FT   CDS_pept        join(complement(886286..886510),complement(886112..886236),
FT                   complement(885540..886062),complement(885004..885474),
FT                   complement(884769..884912))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809607"
FT                   /orf_name="An14g03550"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46592.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC7B4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A0"
FT                   /transl_table=1
FT                   /translation="MSASDSTNSPPMEDEKRFHKGPNESIQPLSEREEKAIIRRIDLCL
FT                   LPLMFFSYLLQYLDKTTLSYASILGLLSGTHMTTALYSWTSSAFYFGYLVASYPVSLGF
FT                   VKFPLGKYLSTMMILWAIILTCHAAASNFAGMTALRVLLGVFESAISPGFTLVVSMWYT
FT                   PSEHALRSCIWFAGNGVAAIFGGVLAYAIGHIEDRLGPWQWLFIIFGLITLGWSVFLFF
FT                   ALPDSPHNAKFLQPNQRESAYLRAQACQKSYQSREWKKDQFIEAWLDPKTWFLFVYNFM
FT                   VSLPNGGITNFSSLVIESFGFDTFNTLLYSIPMAAVALVFLLISAFTCNRFRGLRCYWM
FT                   IATLLVSLVGILLMRQLPTEKKWGRLVGVWLVSVFGAGWPLSLSLVSSNFAGFTKKSTV
FT                   TAILFIGYCVGNIAGPQLFKTNEAPKYLVRELSLISVGLRLSAVIEALTNKRRNRKQGR
FT                   TIEPESPEMEDAVQSHSDHSESGDITDWQNESYRYCL"
FT   CDS_pept        887097..888359
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000148525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888499"
FT                   /orf_name="An14g03560"
FT                   /product="Catalytic activity: hydrolysis of Xaa-|-Pro
FT                   dipeptides"
FT                   /EC_number="3.4.13.9"
FT                   /function="dipeptidase activity"
FT                   /protein_id="CAK46593.1"
FT                   /db_xref="GO:0016805"
FT                   /db_xref="HOGENOM:HBG705868"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="UniParc:UPI0000EFC7B5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A1"
FT                   /transl_table=1
FT                   /translation="MHRPLTDSTFYRINADILIPGRGAPIARGAVVWKSKTILYSGPQH
FT                   EVPVEYQDAVTTHVPVAMPGMWDCHIHFLGATAATMDSIVNTPQALAGARSVPYLYATI
FT                   IAGFTSVREVGGYGCELAKVIDEGRIPGPTIYGAHSAISMTAGHGDVHGVNPEGLRDLC
FT                   THGLPLTIADGVPECLQAVRKQLRHGARIIKVCASGGVVSAIDDPQHQEFSFEELKAIV
FT                   DEAARARRVVAAHCHGKAGIMNALRAGCRTIEHGSYLDEEAIDLMLEKGAMLVATRSVI
FT                   ESGLAMRDLFTPGSYQKLLEVADTHKRAYELAVRRGVPIALGTDQFISSDNPALGYGRN
FT                   GKELVYAVAAGMTPLAAIEAATANGPLTLGDQAPKSGQLREGFDADIIALTANPLENII
FT                   VVSDPKNVTHVWRYGKLVKSN"
FT   CDS_pept        join(890124..891216,891276..891958,892006..894528)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888500"
FT                   /orf_name="An14g03570"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46594.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0000EFC7B6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A2"
FT                   /transl_table=1
FT                   /translation="MNPPEFPEDEKSSDLPIPERKSLDTLNVPHINVREAPSAETLIVP
FT                   HAVNASAPGKDAEWSMTPQVIRSQEREAAAGFKKRELGVTWKNLGVDVLAAEAAVNENL
FT                   FSQFNLPQRIRDFTRKPPLKSILTESHGCVKPGEMLLVLGRPGSGCTTLLNLLSNRRHG
FT                   YHTIKGDVSFGNMSHEEAAQYRSHIVMNTEEELFYPRLTVGQTMDFATRLKVPSHLPDG
FT                   AASVKEYTAETKQFLMESMGISHTADTKVGNEFVRGVSGGERKRVSIIECLATRGSVFC
FT                   WDNSTRGLDASTALEWAKALRAMTNVLGLSTIVTLYQAGNGIYNLFDKVLVLDEGKQIF
FT                   YGPAAAAKPFMENLGFVYTDGANVGDFLTGVTVPTERRIRPGYENRFPRNADSIMVEYK
FT                   ASAIYSHMTAEYDYPTSAIAQERTEAFKESVAFEKTTHQPKKSPFTTGFGTQVLACTRR
FT                   QYQILWGEKSTFLIKQILSLVMALIAGSCFYNAPQTSAGLFTKGGAVFFSLLYNTIVAM
FT                   SEVTESFKGRPVLIKHKAFAFYHPAAFCLAQITADFPVLLFQCTIFSVVLYWMVGLKAT
FT                   AAAFFTFWIILFTTTLCVTALFRCIGAGFSTFEAASKISGTAIKGIVMYAGYMIPKPKV
FT                   KNWFLELYYTNPMAYAFQAALSNEFHGQHIPCVGKNIVPNGPGYEDVDSANKACTGVGG
FT                   ALPGADYVTGDQYLSSLHYKHSQLWRNFGVVWAWWGFFAVLTIICTTYWKAGAGGSASL
FT                   LIPRENLKQHQKSIDEESQVKEKEQAKAATSDTTAEVDGNLSRNTAVFTWKNLKYTVKT
FT                   PSGDRVLLDNIHGWVKPGMLGALMGSSGAGKTTLLDVLAQRKTEGTITGSIMVDGRPLP
FT                   VSFQRMAGYCEQLDVHEPFATVREALEFSALLRQPRTTPKEEKLKYVETIIDLLELHDL
FT                   ADTLIGTVGNGLSVEQRKRVTIGVELVSKPSILIFLDEPTSGLDGQSAYNTVRFLRKLA
FT                   DVGQAVLVTIHQPSAQLFAQFDTLLLLARGGKTVYFGDIGENGQTIKNYFGKYGAQCPI
FT                   EANPAEFMIDVVTGGIESVKDKDWHHVWLESPEHQQMITELDHLISEAASKPSGVNDDG
FT                   CEFSMPLWEQTKIVTHRMNVALFRNTNYVNNKFSLHIISALLNGFSFWRVGPSVTALQL
FT                   KMFTIFNFVFVAPGVINQLQPLFIQRRDIYDAREKKSKMYSWISFVIGLIVSEFPYLCV
FT                   CAVLYFLCWYYCVRLPHDSNKAGATFFIMLIYEFIYTGIGQFIAAYAPNPTFAALVNPM
FT                   IISVLVLFCGIFVPYTQLNVFWKYWLYYLNPFNYVVSGMLTFDMWDAKVTCNEDEFALF
FT                   NPTNGTCAEYLKDYIAGQGWRVNLTNPDATSTCRVCEYRRGSDFLTTLNINHYYYGWRN
FT                   AGITVIFAISGYALVFALMKLRTKASKKAE"
FT   CDS_pept        complement(894954..896270)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113826"
FT                   /orf_name="An14g03580"
FT                   /protein_id="CAK46595.1"
FT                   /db_xref="HOGENOM:HBG561905"
FT                   /db_xref="UniParc:UPI0000EFC7B7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A3"
FT                   /transl_table=1
FT                   /translation="MNLRQINAHNLSTFRHHYVSEISGSLGDLGTFLPIAIALAVNNTV
FT                   SLSSTLIFSGLFNILTGVFFGIPLPVQPMKAIAAVAIARTFTNGAIAAAGLFVAAFILL
FT                   FSVTGLLTRFANAIPIPIIKGIQVGAGLSLIIASCNSLLSNLSWLSPSWADNRLWALAA
FT                   FCFLLFTTVYRTVPYALLVFLLGLIFALILSTLASDLPSLSLWHPYTVLPSPSDWSTGI
FT                   LDAGIGQIPLTTLNSIVAVVHLAHDLLPTHTNSSHLNVTSIALSVSAMNLLGCWFGAMP
FT                   VCHGSGGLAAQYRFGARSGASIIFLGVFKLVIGVFFGESLVGLLKRFPTALLGVMVIAA
FT                   GMELLSVGESLNTTGARDIRKAVAGQGGLTGEDMGPMLSDFERKKRWMVMMVTVGLLVG
FT                   FKNDAVGFLGGLLCHLAFEIPAVVERGVTRWREGRVRLE"
FT   CDS_pept        complement(897084..897872)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888501"
FT                   /orf_name="An14g03590"
FT                   /product="Function: Nopp 140 functions as a transcriptional
FT                   activator "
FT                   /protein_id="CAK46596.1"
FT                   /db_xref="InterPro:IPR022226"
FT                   /db_xref="UniParc:UPI0000EFC7B8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A4"
FT                   /transl_table=1
FT                   /translation="MEPEKRKYAAGPSLPSTSEDDSSKRRKVIGPAPPPPSTTADANSS
FT                   DNSSSDDDSDDDFGPSLPPPEGTVPSVPNTGATQPIPSESTSEAPKQPQRDAWMLEPID
FT                   GSNRNSRVDPTKLRNRKFQTGRGANTTPSAGGLDVSWTETPEQKMKRLQDEVLGVQTRP
FT                   TAPNAGDSAGGARGAQPSRAMQEKIHRFNEEKRKEEAKARDAERKKKKDGEEEEDDPSA
FT                   RAFDKEKDMALSSKITHAQRREMMNKAADFGSRFTSGKFL"
FT   CDS_pept        join(complement(899269..899822),complement(898247..899210))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217191" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888502"
FT                   /orf_name="An14g03600"
FT                   /product="Similarity to hypothetical protein SPAC56F8.12 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK46597.1"
FT                   /db_xref="HOGENOM:HBG327527"
FT                   /db_xref="InterPro:IPR018830"
FT                   /db_xref="UniParc:UPI0000EFC7B9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A5"
FT                   /transl_table=1
FT                   /translation="MPLLYVRAVVPFEAGANATDVLINEVHFNRTALNYYHYTLFSNGT
FT                   LSNGTDCYLAFNQFQPHMNENGTFVNGTSCYAPIRDIGRHASAGLAFAFMFVFAIVFTL
FT                   INMRKHSRRYLPADRRWTLLGRRAKWIWMLFIAACGTISCFMSIDVDRGYIVSVPLILQ
FT                   SVFYTLLTPGMMAAVWEAVRHWGSWQERQIYDRDPYAFQVSSSRQGQEFVLPIIFYGCA
FT                   LANFVLTVPRSWTAIEMQRSLDQQLNEAKPVATDVRWRAAGFVAVAGVLVICYSLEHSI
FT                   YRYRARPTSTIGQLLFYLNAAPSQFLIAIVLLGVKIGYAIASAFDWTVSPLRYGVDSGW
FT                   LYGLGYTPVLLLLILFNICGFCELNEDKALIVQRDEFNHAVADAVGVGQRKPSWWKKSR
FT                   TFVRELSDHRQRQGSQQDDRDMSRFVEMGIIKPREQPQEDEPKPETWVTTRTASQGSES
FT                   TAVARTESSPETSPPYVEYTLQPELSRNTSNEMEVHGRPQTERDILG"
FT   mat_peptide     join(complement(899269..899768),complement(898250..899210))
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A5 "
FT   sig_peptide     complement(899769..899822)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A5 "
FT   CDS_pept        join(900927..901040,901134..901278,901340..901725,
FT                   901791..902398,902464..902540,902601..902779)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113827"
FT                   /orf_name="An14g03610"
FT                   /product="Putative sequencing error "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46598.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327167"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000EFC7BA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A6"
FT                   /transl_table=1
FT                   /translation="MLTIIYLESSDSSSISSLGIRYRFTQQAQCGPASWLAMRVEVYRE
FT                   RRNPLSSIPGPFLCKWTDIFVRYQTVTGNRPRYVQGLHKIYGPVVRVGPNAVDIAKIAE
FT                   AREIHRIGSGFLKSPVYELLKHDNAKSIFSTTDPKFHSKHRRLLSSPFADANLHSLEPL
FT                   IEARIRLTMQRMREEMTTRKVADVQKWFFFMSSDIIGELSFGDSFRMLEQGKHIKDLEI
FT                   AALVGESRVAFPFIFRLAEFLPLPILREANKSRNRFGNYADECVNRYKRLLAASPEDVK
FT                   PTLFTKLYNAGKEGLSDAEIRDDASDLIIAGSDTTANTLTYLTWAVCKAPVIRQALVAE
FT                   VATLPERFSDKDVXSLSYLNQVIDEALRLYPAVPCALPRVVPPQGATFSDHWVPGGSTV
FT                   TTQIWSLHRDPVAFPEPEKFDPSRWASPTKEMKDAFMPFGAGTRNCLGLHLARIELRLA
FT                   TAHFFRQFPRSEVSSREGMSDEDMEQVLHFLLSTKGHRCLLEVQ"
FT   CDS_pept        join(903264..903404,903459..905396)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197492" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888503"
FT                   /orf_name="An14g03620"
FT                   /product="Phenotype: deletion of YJL010C in S. cerevisiae
FT                   is lethal"
FT                   /function="RNA binding"
FT                   /protein_id="CAK46599.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG327528"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000EFC7BB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A7"
FT                   /transl_table=1
FT                   /translation="MPREKVKRGRRATEKANKEASKRKRDDAPEDVVPKRVKPSDDETN
FT                   DFGAQTGDMPFYGLLDPEEQEYFSRANEVLETNQFGDAEERRVFVESVYKEAEGKELKI
FT                   SCSQSCSRLMEKLISMSDIHQIRRLFSKFIGHFLHLVQHRFASHCCETLFIHAAPGVSQ
FT                   KPSKKASKTEAEEGDEPEPELSLAEMFMKVIEELEGNWGYLLTERFASHTIRVLLLVLA
FT                   GEPVDLSLSDSVVASRKKERHGVLNEVQDENPVAQKRSVPESFEGTLKKIMQDMVSVLD
FT                   DTYLRALATHPVGNPVLQVLVYLELSHFGKASAKDPKSIIRRLIPDDTFEEGTESTVFI
FT                   RGLLYDPVGSRLLETIVRYMPGKLFKGLYKNFLRDQLRSLSRNITAGYVVLKVLERLGK
FT                   DDLENAVELLVPQIPNLIERSRVIVPKTLVERCIVRGVDTTPIARSLETAYDSDPAKRL
FT                   SQMLTLEDTTTTSEPQQQNQAQDQDDHQQPPAIPDFGPDNANANINTNPKGAKLHNSLF
FT                   VQTILTAPGPLSALVYSSLLSQTPESLLTIAKDPTASHVIQKSLTLPTSTPQFRRQFAV
FT                   RFTGHLEELALDSSGSRVVDALWHATKDVFFVKERMAQELARSEMALRDSFVGRAVWRN
FT                   WSMDLYKRRRGEWAAKAKGLDVGGEGGQKPKSRIELARERFAAKAAESEKKKNGEDA"
FT   CDS_pept        join(complement(907648..908012),complement(905979..907566))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000204197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656941"
FT                   /orf_name="An14g03630"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAK46600.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG327529"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000EFC7E7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A8"
FT                   /transl_table=1
FT                   /translation="MLGAFRRSGAVHALRASRSLLARSIPQQPQWLSASAPAVSYVARA
FT                   LYHPSPAFLDATAAAQAQLNVAADIEPRLPNSKFHSLAQDGLVNDRLIRTVTNSMKIET
FT                   MTDVQAKTIRETLSGDDVLAQAKTGTGKTLAFLIPVVQRLVSDPSVKRSRPSYRGQQGR
FT                   RNTPDIRAIVISPTRELAEQIAHEAQRLVYGLGLTVQTAVGGTQKRLHLNKIRNEGCNI
FT                   LVGTPGRLKDLLSDPYSGVTAPQLQALVFDEADRLLDDGFSQEIGQIKDLLPNPEEVDR
FT                   QTLMFSATVPGEVMNMVRQTMKPDFKFIKTVSEDEVPTHLRVPQKVVYLDGFQNGLPAI
FT                   LELAKQGYVNSPNFKAIVYLNATTMVSLANDIFRRLQNDPEDRTKGHALGRLPILQIHS
FT                   RLTQAQRTRVTSTFRNARSGILFSSDVTARGLDFPDVTHVIQYGLPSERQTYIHRVGRT
FT                   GRANKEGEGWILLHNNEKRAFKQMLGDLPIEEDQTTIPVAKVNMREEIEDDGSETSRTL
FT                   QQIKLAAQQVPIDDRVEAWKSQTGTIIGKLQPLSATLPAMHDLSKYGYVLPKPPHLPSR
FT                   IQQALEKGDRPPPRSNRGGPRDSFRSRDSYRPRSSGGYNDRYQRSSSRDREPRNPWNER
FT                   GSSRGRRESRSYNRY"
FT   CDS_pept        join(complement(909807..910796),complement(909384..909743))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185699" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809608"
FT                   /orf_name="An14g03640"
FT                   /product="Catalytic activity: Salicylate + NADH + O2  "
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46601.1"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327530"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000EFC7E8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A9"
FT                   /transl_table=1
FT                   /translation="MQSTPVPRDILIVGAGIAGLASAISLAKELASSIPDLKISVFEGA
FT                   PGLSASGGAISLTPTAQNYLDKLGVLSELNRMGSEAGIEVDRIELFSLRSGRRLGPLKF
FT                   TDENGFGYGGYKGRRVMRNALSRAMLSVIQTHLPTVSVYFNKKVVGGTTTDSSVTLSFE
FT                   DGSFATGELVLGCDGVHSITRTRIVDPGNRSEYTGISFIQSVTDAHDLSVPMHFNQTAI
FT                   HLTRHSSLLTSYCDPDRQKIFSAAILRVNEHLIERYQATSKSDCPEQASMKMSIRYLVR
FT                   TQFAKSALPSIRALLDHTEDWALYPVYQVRQRGKWHKGRILLLGDAAHAMPPRDESAAY
FT                   SIEDALIFTQIFSRNLHAPLATTFQEYESLRRELVNKVFDASRRLWQSDLDKGLFPGHV
FT                   RELMSPVHMSPGGCTTIASARPAVPAATHQSFSDLSVYSLTREFQGEIES"
FT   mat_peptide     join(complement(909807..910715),complement(909387..909743))
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A9 "
FT   sig_peptide     complement(910716..910796)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3A9 "
FT   CDS_pept        join(911682..912264,912304..912418,912526..912532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193153" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888504"
FT                   /orf_name="An14g03650"
FT                   /product="Similarity: the similarities are mainly based on
FT                   repetetive structures"
FT                   /protein_id="CAK46602.1"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="UniParc:UPI0000EFC7E9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B0"
FT                   /transl_table=1
FT                   /translation="MNVFDEEPSTITLSTPKASTTGTTIAIILEELRLPYTFHLLPHSS
FT                   STTTLTDIHRTGHGPTLHSLPSITTYLLTRYDGDHHHHHHLSYPPHSPEHVAVEESLSK
FT                   LADRMGIIHQHHQDNEPDNKHEHKHHHNKQHLPAIKETEVVDNNNNTAKETATATVPFA
FT                   RRLLSLYLHLEEYLSRQRRGGGGWLIGERWYCRIWLMGHSTVADIAHFPYVAAASQYGF
FT                   DLERFPELTGWY"
FT   CDS_pept        join(complement(915787..915837),complement(915235..915703),
FT                   complement(914561..915175),complement(914179..914505),
FT                   complement(913719..914117),complement(912836..913662))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161488" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888505"
FT                   /orf_name="An14g03660"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK46603.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG327532"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR022257"
FT                   /db_xref="UniParc:UPI0000EFC7EA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B1"
FT                   /transl_table=1
FT                   /translation="MAIRDVGLEGLHQLFQRSSSDDPQSASNSASGLVTTLVPSLISAA
FT                   AMVIIFIILRRSETRMYMPRTYLGVLRPSERTPASPTGLWNWIMQMYRLPDEYVLQHHS
FT                   MDAYLLLRFLKIVSMICFVGACMTWPILFPVNATGGGGRSQLDMLSMSNVSSDKYARYF
FT                   AHAFVAWLFVGFVFYTITRECLFYINLRHAYALAPAYASRLSSRTVLFTAVTEDYLSRD
FT                   KIRQMFGPEKVKNVWLTTNTSELDDKVAERDDAAMKLEAAETKLIKLANAARLKALKKQ
FT                   GSVEEGQNAGDSLCDDDDESGSVAARWVRPQDRPTHRLTLLVGKKVDTINWARSEIERL
FT                   TPEIEELQAKHREGNADLVSSVFVEFHAQADAQQAFQSVAHNYPLHMAPRYIGLEPTQV
FT                   IWSNLRIKWWERLIRYSATIAFVVALIVFWAIPTAVVGCISNINFLTDKVPFLRFINDV
FT                   PSWILGVITSLLPTVLMSVLMALLPIVLRLMAKFGGAPSLAAVELTTQNFYFAFEVIQV
FT                   FLVVTISSSASSVVTKIINNPTSAASLLAENIPTASNFYISYIILQGLSFSAGALLQIS
FT                   GLILGKVLGRLLDNTPRKMYSRWSNLAGLGWGTVYPVFTLLAVIAIVYSCIAPLVLGFA
FT                   TIGLYLFYFAYRYNMLYVSNANIDTQGKAYVQGLKHLTVGCYLLMVCLIGLFAIGTAAD
FT                   NIATGPLVLMIILLVFCVLYHVALNNALEPLIQYLPKNLESEEEALLSREQTKVSQSGE
FT                   ASDDAAAEGSKARDSGVANIDSAERGLTSDEPQAKPNFLLRYLRPDKYDSYAQMRRLVP
FT                   SGQEITKYAPEVERDAYFNPSIKAQPPLLWIPRDELGVSRQEVRHTSRVIKITDEDAWL
FT                   DEKNHICWDLDKGVPPIFKEKVYY"
FT   CDS_pept        join(915853..916041,916103..916165,916237..916340,
FT                   916424..916718)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888506"
FT                   /orf_name="An14g03670"
FT                   /product="Similarity to retinitis pigmentosa GTPase
FT                   regulator RPGR - Bos taurus"
FT                   /protein_id="CAK46604.1"
FT                   /db_xref="UniParc:UPI0000EFC7EB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B2"
FT                   /transl_table=1
FT                   /translation="MAVRVCRGQVEYRCGYVKRQNVARSRAVDRREGGGDHRQGHGQDR
FT                   KSVRSKQGSWTGRKGGREGEGEPPKGKKPFSVWVAWDLKGRKELAKQIGCTAQRMPIGL
FT                   PGMAMGSAEAKEWFPGFEASATHEGTSHSTWGRAGRVRGDATGRSTLDLRWDRWVARVT
FT                   LLWVEESMTIEGRASVRGIPIRSTNARFAFDFWADQQQSDDRTPFQPLLVIMI"
FT   CDS_pept        join(complement(917454..917459),complement(916940..917332))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888507"
FT                   /orf_name="An14g03680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46605.1"
FT                   /db_xref="UniParc:UPI0000EFC7EC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B3"
FT                   /transl_table=1
FT                   /translation="MIPLEHEPTSRPSGGGRDCVPRFLSWPELGTEELKGSGRFKFATF
FT                   ATGRKSHSIDSGSTTWVATRIQRVYEAFQCECMGDATAKSASEQYHTVSELRVRLRDTS
FT                   NLLRPIYWDQLIHSCALSSSLVWSLQPQ"
FT   CDS_pept        918259..918531
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888508"
FT                   /orf_name="An14g03685"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46606.1"
FT                   /db_xref="UniParc:UPI0000EFC7ED"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B4"
FT                   /transl_table=1
FT                   /translation="MQALLALLLIASAEEYLCVRVCCCHLREAMLFSLCSAHHHYAYRN
FT                   RCCLCVCSADDDDSIYNWHHHIIHRRKLEERETNISRVAADFAAK"
FT   sig_peptide     918259..918297
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B4 "
FT   mat_peptide     918298..918528
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B4 "
FT   CDS_pept        join(918825..918959,919002..919193)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888509"
FT                   /orf_name="An14g03690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46607.1"
FT                   /db_xref="UniParc:UPI0000EFC7EE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B5"
FT                   /transl_table=1
FT                   /translation="MAFAFGGIRDGSMPGLASLPRLVSETGPYEDVYTGTNDCCTSPEE
FT                   GVYRGETIFCHTRENCPESKADVWSIIPVNSLKHKMQGLHEEVTKYITQPQTRQRSRPL
FT                   TILP"
FT   CDS_pept        join(complement(922777..922870),complement(922365..922735),
FT                   complement(921305..922270))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175396" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809609"
FT                   /orf_name="An14g03700"
FT                   /protein_id="CAK46608.1"
FT                   /db_xref="UniParc:UPI0000EFC7EF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B6"
FT                   /transl_table=1
FT                   /translation="MSADRLPLADSTPLDSTSGVRGTSSSESEQQLDELTNTISSGTSS
FT                   DPPQIPVRLRRRRHLPMSDDQSSRNQIFYFVDSNSSSREKRAHVMRHHVQEKRRQRKSS
FT                   HSRADGDRRGSRPLRYSPWPHKRTDVDNHDDYESIAPQEVPSETSVNGHSLIRFGLPPV
FT                   QSPPESVDGYQSPSPVTMLDASRKDPFNSLPGVYSRDDQELADYWTNRLTYWSGQNKYI
FT                   KDLVFKAAMSHPLCFQAVILTYCARWKAQLYNLQDSKEAHYHLDKAVQGIEEAKIGSAG
FT                   VDEDNLALALSGMSLHEDRFGDKQVARKYEDQAVEILRSRSGTQSTVEVFMHYVRYVMI
FT                   PPPMEMSEEGKRWLVSFLHAAEQLMHQHSTPSYLESVPQRRTAFQMDSPLFPLLSSGPR
FT                   PSQVPQDYRMYVVRNAPTQEITRTAALIYITAALWDLAASENKTGRFLNHLHHLVRLHN
FT                   LDRYPACETFIWLLLEEG"
FT   CDS_pept        join(924011..925659,925723..925862,925923..926893,
FT                   926958..927080)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809610"
FT                   /orf_name="An14g03710"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46609.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008049"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI0000EFC7F0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B7"
FT                   /transl_table=1
FT                   /translation="MSSLFDAVLQSELGSTAGSRDHRLHSDQIPSSRPQPPSESNGPMS
FT                   DMHGFADDQIADSSASTVTRLRNPYLPGPPPVSDVAGEKVQQAFAELLETYQEETPSSA
FT                   QAAPSSQVLSEKYYIAQIMGMAKWELSTLYVDFTHLTSMSNPILADAIANQYYRFQPFL
FT                   TKALHDLIAKYEPDYFASHRQATAAGSVSSQAGTSMIAGNSSVSDNPELERNIREKTRH
FT                   QQTDKLFSLAFYNLPLVSRLRQLRTSQIGKLVSVSGTVTRTSEIRPELSLGTFICEECK
FT                   AVVTNVEQTFRYTEPSQCPNNTCGNRSGWRLDIGKSTFVDWQKVKLQESSHEIPTGSMP
FT                   RTMDVILRGEMVDRAKAGERCIFTGTLIVVPDVSQLGLPGVRPEAVRDDGAFRGSDIGG
FT                   GGVTGLKALGIKDLTYRLAFLSCMVTPDTTTPGQQSNQQLNGQSQNILASLNQNRDPES
FT                   NEDQAQEALLQSLTPYEVQDLKNLVHSEYIYSRLIDSIAPMIYGHRQIKKGLLLQLIGG
FT                   VGKSTEQENLQLRGDINICIVGDPSTSKSQFLKYICSLHPRAVYTSGKASSAAGLTASV
FT                   VKDAETGEFTIEAGALMLAVGGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHTT
FT                   LNARASILAAANPIGGRYNPKTTLRGNLNFSAPIMSRFDLFFVIRDDPNETVDRNLADH
FT                   IVNVHMNRDEAVNPELSTEQLLRYIRFARTFKPVFTEEAKAYLVEKYKELRAGDAQGGM
FT                   GRSSYRITVRQLESLIRLSEAVAKANCVEEIIPKFVREAYDLLRQSIVTVEKDDVEVDD
FT                   DEPAAADGPAVEEDHEMGDRDGDSPMREDAEPAQPKRSRTKITYDKYMKILNLMVRRVR
FT                   DDEANSGEGVEQEDLLIWYLEQIESEIDTEDDLQNERDLAVKVLKRMIKDNILMPIRGQ
FT                   GLVDADDEGQSEQVQRTVYVMHPNCAIDEM"
FT   CDS_pept        join(927991..928210,928267..928768,928821..929532,
FT                   929662..929746,929794..929881,929931..930059,
FT                   930117..930274,930342..930441,930510..930597,
FT                   930750..930882,930915..930983,931023..931813,
FT                   931870..932049,932099..932413)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656942"
FT                   /orf_name="An14g03720"
FT                   /product="Function: RAD5 of S. cerevisiae has single-
FT                   stranded DNA-dependent ATPase activity "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK46610.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG325016"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI0000EFC7F1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B8"
FT                   /transl_table=1
FT                   /translation="MEGLSKGLEPPRNTEDLLAGSGDVQEPDEQESSLQPESLDPDQMR
FT                   LEAIDRRRQQDNSRQALFFSRLGLDTHNPVQHTESAPSTIPSVQDDQAPAAQAVLDESL
FT                   FVPQEVSFSWNHLSTETDVPPMSPDDQNIFDLFQGLNSEGDTSPPIEQLLQNSPHSIAS
FT                   ASQTGNAGTTAAPAANEEDPKPSAPTCVEIISSSSSASGDTDVPVEDFPDDAGDQSCPT
FT                   EWPDEELEASTRADLSKRKFNSIKKWFDSLEKPSVADEIRLETARQQESARKNRVARRK
FT                   ALENQSELFDPEIDEPDEFTSRQVPIEQKTGSSHDVPVKPQPKKRRQNRISADEKQKSK
FT                   ELGLAAVLVQQKKRGPPKGAPRKRKERGSDNAIPGPSKKRKRGPLGSKKYLEALLSSTI
FT                   VADAHANASLDAIPELKNKDKMKALTHLVASLPSADQQEAKSDKRSIIAATRNFTNVPR
FT                   SDGKSGWRLKGLNTSLYHYQRKRESSSERPFGGLLCDIMGFGKTIQALANIIDGKPSDP
FT                   EDPNKTTLIVVPSHLVTHWKTQINKHCEKKAIGDVLIYKANSRLETLDTLDTVESLVRY
FT                   DVIITTYDEVRKSYPRIKVADSVADNDKLAAWWDQSYEDEIGPLHRIKFHRIILDEGHT
FT                   IKNHLSSVSIAVRSLTGHFKWILSGTPVHNYLEEFYPLFDFLGVPGIRDPGFFIKNFCS
FT                   LPDVNERIVRVAFCAVERELYNAISEVFIENINGAPNTPRAILRSCAHLEQPKLAQYRC
FT                   FLSMILMLLKRLLSEGNLMKRLSRLAKQSGDRDPSFTIVKWLVSVRRNTTVLDERENED
FT                   TFQYATELHGDETALMQNFRQLMDELHDTEIWEERLARTNCPQCDFVPVNPVITSCRHL
FT                   YCEECYYSLRMDKDKMLMEPNCVSCRVPIMEAAYFKEDGDEKTRPATTLGAVNRKKKQG
FT                   KKTTTTKKQARSSMRRVTAPQIEESDEEPDADEDTDWIKACARHMPSAKLTKIREILTE
FT                   WLAQDSPGKIVIFTQFLDFVQILATMCQAENWPYVLLTGKLSLAVRENNMTLFSDKDSE
FT                   KRIMIASLKAGGTGLDLSAANKCILVDLWWNEAIQEQLLTLPFQAFCRLFRIGQESEVE
FT                   FVKLIIENSIDDYLLNLQTHKTAIITGAMGERALAGRDTIEDLLRMFADVEKDPRGVLH
FT                   LKAKTASRDIRIGAGFRPTFGVF"
FT   CDS_pept        join(complement(937813..937878),complement(937604..937748),
FT                   complement(935357..937481),complement(935188..935230),
FT                   complement(935006..935157),complement(934673..934874),
FT                   complement(933807..934391),complement(932887..933702))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113828"
FT                   /orf_name="An14g03730"
FT                   /product="Induction: transcription of M14 from M. musculus
FT                   is dramatically induced"
FT                   /protein_id="CAK46611.1"
FT                   /db_xref="HOGENOM:HBG325018"
FT                   /db_xref="UniParc:UPI0000EFC820"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3B9"
FT                   /transl_table=1
FT                   /translation="MAAVVASGHKAYQFTAGRRMDGSFLRASPIPDPATQRKATNSRDP
FT                   NNPHETTPRRPSLFETRHGSRNSNSEDIILGPPKTAFASASRIPGKGSIDATERSSRPN
FT                   DQDESKNDRFNLREKFFKDRETGDRDFDRRDGKLGTFNNNNTNNNNRRGDREDWNSGRP
FT                   RRTFGPEEQDRKPRRNGEFDRWENRDQREPNNDRGVRDKDARFFPRKDGTPGRARHEGS
FT                   WFRDENTHDAPEAEEEKTPIRNREWRRDRHGADRDWTRGAKFEQDPEWMDSTDRDEPRR
FT                   VHTQEDFERWKERMKAGSSQVQAEEKEVPLETTPAPAPAPKPEPRPTDGEIFSSNGAPF
FT                   TSDSAMERFFGLLGDSKPPQAPPLPQEISAPPPMMEPTMKKEPLPGKLGKSSRFAGLFS
FT                   PPPGSPAKEPESHPETRSSPSMNTVNTDADQEGFQRILQMLGGGKSRNATPHNDPVAYN
FT                   RPPSQVQAEQIRSAVSSPARDQIKRQEYLAMQETVARGAGPNPYVQETHARDREHLLRL
FT                   MQQVRVSPVANQGAQSQPQSAGPVGPAPGLLSMPEVLSPPPGIPTPQKGPNFLDDPAIA
FT                   NMQRPDADHLRRRPANGPPMGYFEDMPFPQGGQLPMTPGGTRAPQAQGHPPMGMQRPPG
FT                   FEHLPPPGWPGPQMPPQQAAGPAPLAPPPGIPTPTRGVNPSYMANMMPMHGNAPPLNER
FT                   EPFPRPPPPGMMPPPGYMNGPPPAGFPPMPPNGEALMGLPHRGQGPFEGNPGPQVPPPS
FT                   ARHLLDMFGQVGGEAPRGMLGPGQFRTMHLLIFLYLIHLCFEGVQERPSQLLRLGTDEE
FT                   TVSQPDSFASGCITTLGDYIKDSNRQIADTEMCLRRSDCSEWPVDSELRTFKPSRFPLL
FT                   FPTSYFHPLHLLEESATLSLTADVRHQLLIWIKIHHPKPQINPDPTMPHSTSPPSPSPT
FT                   QNTSNHHHPQSIQTTTAMITTTTRKRRAACDNDNGDSKNTSPGTLINTTPNATNNETGH
FT                   QPFKRPRIPSQFTRQAERFEEALNKEIQEQEDALRMNEYRMLAVRALENEAHDRAFRDA
FT                   MDMSSTYQQQQQQYTPSPHPPVAVAASEDMDMDVDGDDYHNPQHEDHHGTGEGEGQMVA
FT                   PTVQYTEGDTEPIITTRSGCLTSIIGMNNINPITRHRSNQHQHNNNNNHSTLTEFTIYE
FT                   DLSPDPGGLLSFPTQPNPVGQLQPDYHHYHYNNHHNNQEVRAYHQDWDSDKENINNNIV
FT                   AGPLHDPVGMITETEAESFSQVVDHSYHNADNVADEVDDEMRMDYEAGGSGGESGRWSS
FT                   GVPPWRVESESEYADTEVDPDEAGLGLQDYAHRRRRRYHRLRWQSRVLGSQDRGSVASN
FT                   SSVLVPRVLGEGLQDGAGAGGAGAGRGRRGSRRL"
FT   CDS_pept        join(complement(942405..942549),complement(939775..942350),
FT                   complement(939379..939705),complement(939007..939324))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175240" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888510"
FT                   /orf_name="An14g03740"
FT                   /product="Similarity to hypothetical protein SPCC14G10.02 -
FT                   Schizosaccharomyces pombe"
FT                   /function="binding"
FT                   /protein_id="CAK46612.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG325019"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021714"
FT                   /db_xref="UniParc:UPI0000EFC821"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3C0"
FT                   /transl_table=1
FT                   /translation="MSSHEGQLRNKRRKLDNGQDVDATATISSHTQLRSSLAFQQNPNE
FT                   SKQGIRKFKDFLTSIGQSEDEAEKARKFRILKAYCDSQFSRVNENEAVCFTDLVQTWGF
FT                   ADSNNNESLLTVVPSVLAQFLKTVSSNLDFRDFGVALCKYLLQKEQLRLFNRGLTALKS
FT                   KEHLISPCLRLLTEMVSFDGGAVARHVHAARYITFKRIEVFLTPNKAQLEEISEESSKP
FT                   TLRRNAQKYVLANLRFLQSNGKSDIIEQHKVIRAFFEYIRKDARDIVLETIRCIDKDII
FT                   QDASISRIAKSKFFNRWNLERLVTLYGYDRESEEPNPANVSTTDEIHKILMNVCTNTEL
FT                   GVLLPESGWYPHGSDPEALPTDDETLIDLGLDSALHVDKYSQSVPVRNGTLSYLIQTLR
FT                   PDTDSLQIELLVAIFKAAPELVADFFTKKSMFTADPKPTPSWMAESALLFSSVQLPVPV
FT                   NCGWKDKLPPTPPPVSVVIENVLPRPLTQKILTRCLNMNAEIVTLFAVRILTIAFNKLR
FT                   AVLKIFNGDHGVSQPLWTQAASKLVAEFSRRCPGVKEVILLFKRTDKEDFQQQDAVSEL
FT                   LASFYEVVPDAAFEEGLDVSLILVDVLKRLDEGKLDEDDTESVLSQLQNIMRIVQQSTS
FT                   MRWWQQPGSMQYSAFTSILKVLVETASRYSLREIDQLLRTVLTEYSVLQNPSSFPAILS
FT                   SFEISDSEKLQRQLSFFDNCACRIAKKPVHYQDLVDSLFEGFSSPVSPLVAAVIEQWPF
FT                   VVKSGDPAVESAVVAWIAQTLGSLKRAGENAKALKSARDKLVESAENKKSKSAFKKALK
FT                   DIEDAEEDHEMDIDAPSQDTTTTAKKEEVDLEEVFGTLPTESTTHNELHRWEKEDIEVA
FT                   VEQGRIAELVLCLCSAYEEVRKQAFTSIIRFMGKLKESKYVEWRSVYILTGELLETVKQ
FT                   IGLDSPVPWIVGECASSCLTVLTDPMHKMYGKVNKFLQKAPSWEVEKIPSYWIDKILLH
FT                   EPELDDGYFDETSWLLDLLIKGLRTEADMDIYRRANVFERALSFYESPSAGYSAKRKIL
FT                   QLVYRATQVQGSTTLVTRAGILSWIQGQIPAVKGKETSTLAAIADSLKQTSDNDRVSKW
FT                   SGGAALQVVENIVG"
FT   tRNA            943145..943217
FT                   /gene_name="tRNA-Thr (AGT)"
FT   CDS_pept        join(943919..944356,944511..944561)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888511"
FT                   /orf_name="An14g03760"
FT                   /product="Similarity to endoglucanase from patent WO9110732
FT                   -A - Bacillus sp"
FT                   /protein_id="CAK46613.1"
FT                   /db_xref="UniParc:UPI0000EFC822"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3C1"
FT                   /transl_table=1
FT                   /translation="MSPTPITKSSLIGAWTLISYTVEPPNPQDDDSPTHYPMGPDARGT
FT                   LVYTPDGQVTVSVLPKVTKKAWENSNDGVMYAGRYWIEYSNGSECDNGGDKRQQPGGAP
FT                   VVHHEVDMAYSAEFAGSQKREAMIFPEGRLRLSGLKLFEVGMREGKNELAAGSQSTDA"
FT   CDS_pept        complement(944802..948497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809611"
FT                   /orf_name="An14g03770"
FT                   /product="Remark: expression of human HRH1 in a S.
FT                   cerevisiae prp22"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /protein_id="CAK46614.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI0000EFC823"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3C2"
FT                   /transl_table=1
FT                   /translation="MDDLQSLELFSLVSRITSEIQNHLGVNDKTLAEFVIDQHLKCGSF
FT                   ADFSKSMEEMGAEFPRSLLESIDRLVLTMHPKYKSKKMETTNTSAGDDDMDVLDALEKK
FT                   ARVFKGLAVPDKVQQWDEEDVEEGDAKADAMDDTFAMLEGLAGKARQEKPAPALQSSSR
FT                   NDRGSTRKRSRSPDYDDHRRGRRRHDRYRSRSRSHSPRYSRKGGDDEVDEFGRSKSKYS
FT                   SRDDYRNGHSERKSRRDRDEDGEYFRKPPPVELDDQPVLYKVYDGRVTGVKDFGAFVNL
FT                   LGVKGKVDGLVHVSAMQEGARVNHPSDLVSRGQPVKVKVVSIQGSRIGLSMKEVDQVTG
FT                   LDLIPQRRLASGANMERLDGMTGKDRYGNLSSEVPVIEESDGKPMKNRKRMTSPERWEI
FT                   KQLIASGAVSAADYPDIDEEYHATLTGEGTFEEEEDVDIEVRDEEPPFLAGQTKMSLEL
FT                   SPIRVVKAPDGSMNRAAMAGTNLAKERRDIRQQEAQDKAAEQAAAVDLNAQWQDPMVAP
FT                   EERKFAADLRSTQQSKPDDSVPEWKRVTMGKNQSFGKRTSMSIKQQRESLPVYKFRKQL
FT                   LDAVRDNQLLIVVGDTGSGKTTQVTQYLAEGGYANNGIIGCTQPRRVAAMSVAKRVAEE
FT                   VGCKLGAEVGYTIRFEDCTSPDTKIKYMTDGMLQREVLLDPDLKKYSVIMLDEAHERTI
FT                   ATDVLFGLLKKTIKRRPDLRLIVTSATLDAEKFSEYFNGCPIFSIPGRTFPVEIMYSKE
FT                   PESDYLDAALITVMQIHLTEPSGDILLFLTGQEEIDTACEILYERMKALGSTVPELVIL
FT                   PVYSALPSEMQSRIFEPAPPGGRKVVIATNIAETSITIDNIYYVIDPGFVKQNAYDPKL
FT                   GMDSLVVTPISQAQAKQRAGRAGRTGPGKCFRLYTEAAYQSEMLPTTIPEIQRQNLSHT
FT                   ILMLKAMGINDLLHFDFMDPPPTNTMLTALEELYALSALDDEGLLTRLGRKMADFPMEP
FT                   ALAKVLIASVDMGCSEEMLSIVAMLSIQSVFYRPKEKQQQADQKKAKFHDPHGDHLTLL
FT                   NVYNGWKHSNFNNAWCFENFIQARQIRRAQDVRQQLLGIMDRYHHKIVSCGRNTLKVRQ
FT                   ALCTGFFRNAARKDPQEGYKTLVEGTPVYMHPSSALFGKPSEHVIYHTLVLTTKEYMHC
FT                   TTSIEPKWLVEAAPTFFKVAPTDRLSKRKKAERIQPLHNRFAGEDDWRLSAQRRQGRGG
FT                   GGGTWG"
FT   CDS_pept        join(complement(949986..950929),complement(948952..949936))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809612"
FT                   /orf_name="An14g03780"
FT                   /function="ATP binding"
FT                   /function="helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAK46615.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG327539"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="UniParc:UPI0000EFC824"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3C3"
FT                   /transl_table=1
FT                   /translation="MLNACKMDERKSVGPLRHIKDALHRSYLQNGVRGLINELEFHMYA
FT                   EDVTSRYSAPNLEAQKKVADLRRPAEWYPQARALQRTIHLHVGPTNSGKTYHALKRLEA
FT                   SKRGFYAGPLRLLAQEVFHRFQANGTSCSLITGDDVKIPEDGKPSRIVSNTVEMVSLGD
FT                   QYEVGVVDEIQMIADPHRGWAWTRAVLGARATELHLCGEVRAVPLIKELAALTGDKLEI
FT                   HRYERLNPLKVQNRSLKGDLKNLQKGDCLVSFSRVGIHALKADIEKTTGKRAAIVYGSL
FT                   PAEIRTQQASLFNDPDNDYDFLVASDAIGMGLNLSCKRIIFETLIKRVPGGLQRLSVPE
FT                   IKQIGGRAGRYRSAAQQQENGSSSEDDTNVGYVTSLEDIDLPYIREAMESEPPPLVSAG
FT                   ILPPDSVYQKVAAYFPSNVPLEYLIKRLMVVSQVHPLFFLCDPRNQLENAEVIDTVDGL
FT                   RTADQLTFMASPMHTRLIAGRDAAIAFIQCVAEHSDGRLLDIQALNLEILEEPVSGNKE
FT                   YLNELETLHKSVILYLWLSYRCGGVFTDRTLASHVKQLVEERMVRALTEFSANKKLRKD
FT                   ASLRRQIALQKQIQEQKRLLADADVDSYGTEDETAAVDLSADEEQMEEQLQERPEESGE
FT                   APQARAA"
FT   CDS_pept        join(952047..952080,952142..952179,952271..952358,
FT                   952419..952565,952616..952818,952865..953331,9
FT                   53383..954493)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962823"
FT                   /orf_name="An14g03790"
FT                   /biological_process="vesicle docking involved in exocytosis"
FT                   /protein_id="CAK46616.1"
FT                   /db_xref="GO:0006904"
FT                   /db_xref="HOGENOM:HBG384555"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="UniParc:UPI0000EFC825"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3C4"
FT                   /transl_table=1
FT                   /translation="MSTSILNIQRDLILNTIRYAAGNEWKVLVVDETSRKLIDNAVSED
FT                   DILNLNVTNVEQIEHRRSPNPTMDALYILSPLPHIVDCIMADFERKRYRKAWLVWTSFL
FT                   DPEQRARLDRSQLARDQIANVQIMNADYFPRESRLITFRDPWSFPVLFHPGCNHLIRAH
FT                   LEGLAQKIVSLCASLGEYPVIRYYRPRAPTHEASVLCSHLARFIQNELDQFAQFQRDFP
FT                   PPSPRPRGVLLIVDRSMDLIAPLLHEFTYQSMVHDLLPISDGDKVTYKTVINEGSHNEE
FT                   LKDMEINEEDNVWVEYRHMHMKDVLGKLGEDFAKFRAANPQFAEDNNKANVNTIKDMLA
FT                   GLTEFQKGRDAYTLHLNMAQECMSYFQKHKLLEVSSVEQCFATGMDENYKKAKNLASQL
FT                   VQLLDDDAIKQPERLRLLLLYIIYRGGILAGDIRKLLAHAQLAPQDGEIVANLDLLGAR
FT                   VEKPLKDDKPPVQPLFTRKPPSGPIDEEESLSRYDLNLKLILEELVRGTLDPSVFPFTR
FT                   PHTDTDTPGQQEGLSQASLRSAKPTWARTRSTGEQPKQRIIVFMAGGATYGEARTCYEI
FT                   SQTCGKDVFLATSHMLSPGLFLRQVGDLSVDRRRLDIPAERPKPTAPAHLFEREAPPAP
FT                   AQPVKKPVPVNLKPMAPTSALATMSLGTNGKAANGAAPPEKEKDKKEKKEKKEKKHRFF
FT                   R"
FT   CDS_pept        complement(954694..955512)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175296" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888512"
FT                   /orf_name="An14g03800"
FT                   /product="Similarity to sexual differentiation protein
FT                   esc1p - Schizosaccharomyces pombe "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK46617.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG327540"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI0000EFC826"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3C5"
FT                   /transl_table=1
FT                   /translation="MPPPHQNNNNEENNNNNDDDDEYFLPLEDQRVFGAGIRRKRVPFV
FT                   RSSEHHLSTTDSTTHISSEPATPASTGQSIANKYLSIVLSKSNPATPTPESEPSSHPQK
FT                   DDADDDDICPVCNLPYTTPTHHTSDTTTDNGEGEERSRRRRHIHEATLPHQLSLPHSHP
FT                   PSHLDRTRPGLRYLAAYGWDPDSRVGLGPQGREGIREPVKGKLKEDTVGLGAVVPEVKD
FT                   KSGRVQKKQKAKVLNAKEVRRGQLEERKKGERLRELFFRDEDVLRYLGGK"
FT   CDS_pept        join(955762..955938,956010..956468,956562..957155)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888513"
FT                   /orf_name="An14g03810"
FT                   /product="Similarity: the protein shows weaker similarity
FT                   to a human patented sequence"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAK46618.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG327541"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC827"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3C6"
FT                   /transl_table=1
FT                   /translation="MPIPIITTAITEGTNSIPHLWTVLKILPWAVLLAALKYYFGGARN
FT                   TSERLMHSKVVMITGGTSGIGAQVTSALASRGAQIILLTQHPPTDIFLAEYIEDLRRST
FT                   NNQLIYAEQVDLSSLHSIRTFATKWIDNVAPRRLDMVILCGNAAPPVSQKRKLTVDGID
FT                   EEWMVNYLANFHLLSILSPALRAQPAHRDVRVVFTTCSSYIGAKWDLRQLQREKPKNKK
FT                   KKTKGVSLYGLSKLSLMVFAQSFQKHLNSFKRPDGQPCSARVIMVDPGFSRTPGMRRWM
FT                   TGGSLWGLLVYLVTWPVWWLVLKSPQQGAQSVLYAAMEAEYGRGEGGWMIKECKEVDLA
FT                   RKEVKDEEAGKMLWEFSEKLIEAKERESAVRRALANKEKEVAEENEKNKASGSGAKEQT
FT                   PGSRRSRKGK"
FT   CDS_pept        join(complement(958753..958781),complement(958450..958684),
FT                   complement(957893..958349),complement(957440..957834))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168001" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888514"
FT                   /orf_name="An14g03820"
FT                   /product="Function: GAL10 of S. cerevisiae converts UDP-
FT                   glucose to UDP-galactose"
FT                   /EC_number="5.1.3.2"
FT                   /function="UDP-glucose 4-epimerase activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="galactose metabolic process "
FT                   /protein_id="CAK46619.1"
FT                   /db_xref="GO:0003978"
FT                   /db_xref="GO:0006012"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC828"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3C7"
FT                   /transl_table=1
FT                   /translation="MPAGSVLVTGGTGYIGSFTTLALLEAGYKVVVADNLYNSSAEALK
FT                   RIELISGKKAEFAQLDVTDEAGFDRVFEAHPDIDSVIHFAALKAVGESGEKPLDYYHVN
FT                   VYGTICLLRSMVRHNVTNIVFSSSATVYGDATRFPNMIPIPEECPLGPTNPYGNTKFAV
FT                   ETAITDVINAQRNNAIKAGNEAEAQKWNGALLRYFNPAGAHPSGIMGEDPQGVPYNLLP
FT                   LLAQVATGKREKLLVFGDDYASHDGTAIRDYIHILDLADGHLKALNYLRANNPGVRAWN
FT                   LGTGKGSTVYEMIRAFSAAVGRDLPYEVAPRRAGDVLNLTSNPTRANNELGWKAERTLE
FT                   QACEDLWLWTRNNPQGYRQQPPAELLEKLQK"
FT   CDS_pept        join(959461..959472,959636..959724,959811..959944,
FT                   960119..960170,960460..960535)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962824"
FT                   /orf_name="An14g03830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46620.1"
FT                   /db_xref="UniParc:UPI0000EFC829"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3C8"
FT                   /transl_table=1
FT                   /translation="MCMSYLLGLNCTTTTTTYYLFAYLFPASYKVPYPSRSRYHQFGRV
FT                   QDTHLEAKVPTPRLSSKCEVDRFHPIPRVQSIVESAGDDDGDDQGDEGLSMQAICPQRG
FT                   LPVRIIPHCREKALSK"
FT   tRNA            960593..960684
FT                   /gene_name="tRNA-Gln (TTG)"
FT   CDS_pept        join(complement(962654..962864),complement(961752..962602),
FT                   complement(961587..961697),complement(961362..961528),
FT                   complement(961230..961312),complement(961041..961093))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962825"
FT                   /orf_name="An14g03850"
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46621.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327222"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0000EFC854"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3C9"
FT                   /transl_table=1
FT                   /translation="MALDTSHIWLALVGIASFYVLRSIYRLYFHPLSGIPGPKLAAVTH
FT                   LYEFYYDVVIHGRFLFQIEKMHQQYGPIVRINPREVHISDPSFYDEIYASSTRKRERDP
FT                   LAYGAFALPYSMIGTMGHEHHRFRRNILNDFFSKRSVLAISPFIEERVEKLRGRFEGFY
FT                   RDQSVVNLSDAFAALTSDVITYYCYGKRWGFIEDKDFRSDVHGGNEENTGLAHFNRFFP
FT                   IVPETMRKIPLHLMALCLPGKAGMLQFQGSILSTISENTHDKASEKEDRTIFKRLTDPN
FT                   LPVAERSQRRIEDEVFTLLGAGTETTASTLMIMTYYVSRDRSIRDKLRSELKQVLPTPT
FT                   STATWPELEKLPYLTAVVNESLRLSYGLIMRLPRVAPTETLKYKDYVLPPGTPMSTSTW
FT                   FVHRDPSLFPEPDRFDPERWIKAAEEGVNLTRYIVSFMRGSRACIGMNLAYIELYLTIA
FT                   HVVRRFNFDVEITSPEIWAILLVLATTIQSYQA"
FT   CDS_pept        join(963014..963063,963157..963271,963339..963439,
FT                   963485..963632,963724..963765)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656943"
FT                   /orf_name="An14g03860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46622.1"
FT                   /db_xref="UniParc:UPI0000EFC855"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D0"
FT                   /transl_table=1
FT                   /translation="MAEEGNGKRSNWLTNYCLEQDGDALARRNPAYHCRRDIVVAFGGK
FT                   NDTSILRIRHGFLFTPNWCAKSEVAKGQQLLVDTKSAGSQALMLLMELPMQALSPSEAT
FT                   TLGWPAENTGVWHESCSQQVISLLTGLRIRQIRAAKAGKMLDCCLGI"
FT   CDS_pept        join(complement(964663..965551),complement(963938..964584))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888515"
FT                   /orf_name="An14g03870"
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46623.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG325771"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000EFC856"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D1"
FT                   /transl_table=1
FT                   /translation="MDLLGCVVIAVAGYIIYQVWFHPLSSYPGPFVAKLTNLYSVVHAI
FT                   RGDRHEDLYHLHQRYGPVVRVGPRRVSILDAKALEPIYGFHANVQKAKSYNIFYGVSIF
FT                   NAIDRTVHARKRRVMSHAFSSQALRGMEPHILSAIRDWCAALGDQHPDKQVLSACSRPG
FT                   SWSRPKNMVHWSACVVFDALGEICFGKTFNTSFSDANHFFFPLMALNLRIMNICGQMPI
FT                   LCSLGLERYLRRGTVANRQRQIDFSRQQLQTRLAAESTQRRDIIFYLQQARDPKTNEGY
FT                   SEAELMSEVMTLLGAGNDTTNTTLTAIFYYLAHNPAILARLSAEIRAVFPTLEAIVAGP
FT                   DLSQMAYLHACIDETMRVCPPVPTDLPREVLPGGLRVGEWYFPAGTVVAVPTYALHHSE
FT                   DHFYRAFVYDPSRWLLCGSKGTEQGEGVSAEVLSRQRQAFAPFSMGPRACIGRNVAILE
FT                   LELTISRALWLYDIRLAPGTEQLGVGYQGEYKIKDHFAVGKEGPVLQFRMRQK"
FT   mat_peptide     join(complement(964663..965488),complement(963941..964584))
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D1 "
FT   sig_peptide     complement(965489..965551)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D1 "
FT   CDS_pept        join(complement(966677..966972),complement(966494..966629),
FT                   complement(966320..966385),complement(966236..966281),
FT                   complement(966060..966154))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18113829"
FT                   /orf_name="An14g03880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46624.1"
FT                   /db_xref="UniParc:UPI0000EFC857"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D2"
FT                   /transl_table=1
FT                   /translation="MSSCVLFNPISFILEYSVGSRGFCMDQPSSLALQCGGTPIISHLF
FT                   IFHSPAIPRSILNHSLSSLSANTFQEDISTSFSKSIQAWLDAIQFGCITITQITFGILV
FT                   SLCGSSHMPDFLCRHASIRTLKVPSAPPRASSLGLRNDQQALRVQQVLTIIDISVVEAE
FT                   GTDTNAQIIDLQRGLFIAAPTVLMQGYMFPNASTCDALQHYPCKVGNCD"
FT   CDS_pept        join(complement(969915..970063),complement(969340..969824),
FT                   complement(967584..969285),complement(967405..967498))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175318" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888516"
FT                   /orf_name="An14g03890"
FT                   /product="Complex: PAT1 of S. cerevisiae interacts with the
FT                   Lsm decapping complex"
FT                   /protein_id="CAK46625.1"
FT                   /db_xref="HOGENOM:HBG327546"
FT                   /db_xref="InterPro:IPR019167"
FT                   /db_xref="UniParc:UPI0000EFC858"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D3"
FT                   /transl_table=1
FT                   /translation="MSFFGFNTTLPRDRAPAGEQRGIFDTPDPFAEVARARLAANFQSG
FT                   EDDDVIDFEDTYDGLGDQLDDDQDAFNDDTFGGGFDTGPVGKDFDFFGKTAQVADVIGE
FT                   EQIRYSLQKPGAPATAPSQPSADTALPDTTAQKPKRSGYEKYNDPGYIPDLQAKSSVWG
FT                   MSKKPEQQLQQQQLQQQLQQLQQPTPQMVAQAKKMLSLEEVEAQLRRQEPTQPLQRAQM
FT                   PPLPEGFPQLPPEILQAQFAKGVPPAQLLHQPPMVPEPYPLPPNLPIHMLQNANLPPQH
FT                   MVPPQRQAMPPAAQRPQQQQPPLPQAPRGNNAQLPVITNSQQLMHLTEEQRVAYLMEDA
FT                   KRAKRNHKIFLLSRGNGLMTPQDKNFITRIQLQQLVAAAGNVADSDAEAVLAEDFYYQV
FT                   YSQIRGAPRQHPHQPLGHFAQTYLLQTGNRLGGHGSRRQFQSADNHMQRMQQQVQRAVE
FT                   AAKQKPKNKQLIIEGSLGKISFSNAKTPKPMLNIKRPESSEGAKTVKKPHTDLSVSDRK
FT                   SVLTNLESVYSTLMDMEDMERTMPPPPDENDPEAIQKHMEWRQKIRSLNQKLWRDLKVM
FT                   EPIVPNTNTPHPFIAFLAYPKGKKAIPRIFRHIDQEQRVTILTMIVVHLDSLDVVRRAQ
FT                   PVPGETQPSLAVREAIELFSQAVMPSLLGYVNEAPFNIIIGLLGLVIAQTHVQMIARTR
FT                   IGLGILTMLLSRAEIVKEAGQATERDWQQWVEKFNVLFDTLEPTFADIFPSSINAGDDM
FT                   YVWQFLAAVGIGASPEQQQRLVIAVNKTLPADMASARLGNVNLFMRAIGLDVELLG"
FT   CDS_pept        join(complement(971159..971172),complement(970893..971105),
FT                   complement(970711..970786),complement(970500..970622))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656944"
FT                   /orf_name="An14g03900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46626.1"
FT                   /db_xref="UniParc:UPI0000EFC859"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D4"
FT                   /transl_table=1
FT                   /translation="MRIRMNSEKWGLSINAGYDRPGEKCASQVFLEINLWAIGNDNADD
FT                   GPAAHQAKIKVSWQFGALVVDPDHGARAPQPLAYSPRYGEGDVISPVIGRATYVALGGV
FT                   YTENDVKEGTRSMLECISPSGRASIHPALGLGATYSP"
FT   CDS_pept        join(971296..971337,971391..972173,972225..972513,
FT                   972564..972628)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888517"
FT                   /orf_name="An14g03910"
FT                   /product="Function: kre2 of C. albicans is involved in the
FT                   synthesis of mannoproteins"
FT                   /EC_number="2.4.1.131"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK46627.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI0000EFC85A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D5"
FT                   /transl_table=1
FT                   /translation="MAIGPLRYLLFAITGLAIFFFISRSAIPIPENIGTKLTPATYKDT
FT                   FSSSHSSQNDALSSSGPIKDIPTDRVNATFVTLARNTDLWEMVKSIRTVEDRFNHNYHY
FT                   DWVFLNDKPFDEEFKKVTSALISGNTHYGVIPKEHWSYPEWIDQDKAKKVRQEMGEKKI
FT                   IYGDSESYRHMCRYESGFFFRHPLMLNYEYYWRVEPSIELFCDVSFDPFRYVKENDKKY
FT                   SFVLSLYEYYDTIPSLWGTVQKFMEEHPEHIADGNSMGFLSDDGGKTYNKCHFWSNFEI
FT                   GSLEWLRSKEYIDYFETLDHAGGFFYERWGDAPVHSIAAGLLLKKEQIHFFNEIGYYHV
FT                   PFTHCPTGEQLRLDLKCHCNPKDNFDWKGYSCTSRFFQVNDMDKPKGYENES"
FT   sig_peptide     join(971296..971337,971391..971423)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D5 "
FT   mat_peptide     join(971424..972173,972225..972513,972564..972625)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D5 "
FT   CDS_pept        join(complement(973570..974023),complement(973344..973444),
FT                   complement(973214..973279))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20656945"
FT                   /orf_name="An14g03920"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAK46628.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG747181"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0000EFC85B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D6"
FT                   /transl_table=1
FT                   /translation="MAPLVSSLALRTLRTLVQRPAAIKSTSCSITTLAAAAPRRPFQPV
FT                   LRTPTAVAAAAAARKTSIPSSSSSILRQFSTSPFRQATYNQVRRGCRVAQRARRSRSPA
FT                   LIGRSQMKGVCLKTGITKPKKPNSGERKTARVRLSSGKVVTAYIPGEGHNIQQHSVVMV
FT                   RGGRVPDCPGVKYHLVRGAMDLGGVASRLNSRSKYGTKKPKKD"
FT   mat_peptide     join(complement(973570..973915),complement(973344..973444),
FT                   complement(973217..973279))
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D6 "
FT   sig_peptide     complement(973916..974023)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D6 "
FT   CDS_pept        join(974428..974430,974517..974952,975045..975112)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962826"
FT                   /orf_name="An14g03930"
FT                   /protein_id="CAK46629.1"
FT                   /db_xref="HOGENOM:HBG325020"
FT                   /db_xref="InterPro:IPR008012"
FT                   /db_xref="UniParc:UPI0000EFC85C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D7"
FT                   /transl_table=1
FT                   /translation="MSLRIAPPSSNPTQTTNTTTRAVIDLPHPSKGAPSAPGLPDTLRD
FT                   NITLPAPRGPPSTATATPSSTHPLEARLLAWRATQDALKMESLRRAYGIAEPVRRGMEL
FT                   KIVRDGTFRPAALGGLGMGNLHEDILVLGGRDAEVGWEDVFKGDEFREPPAFHDEMEKR
FT                   LRMDH"
FT   CDS_pept        join(975485..975592,975673..975800,975875..976025)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888518"
FT                   /orf_name="An14g03940"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46630.1"
FT                   /db_xref="UniParc:UPI0000EFC85D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D8"
FT                   /transl_table=1
FT                   /translation="MAGQIGRGPPGSSVSTANWSVQALTQQKHSRTAKDHGSGRASENM
FT                   SLGYIRNKRKRSSIKQLMELCKPNGDHVVEQTTGQPHAMPCSKKANKREGGPKPTRTQQ
FT                   REATRLHRGLKETRVDESSSSTSK"
FT   CDS_pept        join(complement(976515..977037),complement(976367..976450),
FT                   complement(976156..976310))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888519"
FT                   /orf_name="An14g03950"
FT                   /product="Similarity to hypothetical protein EAA60774.1 -
FT                   Aspergillus nidulans"
FT                   /protein_id="CAK46631.1"
FT                   /db_xref="UniParc:UPI0000EFC85E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3D9"
FT                   /transl_table=1
FT                   /translation="MSVTEDAKVDPMSPTSDPNLTSQSTTIAVPSSESQELPSAAPHPD
FT                   NAQAESQEPSSVDAKPTENNEDNTSAPVLKQDPVDAAPSASASPQQHDEAKAPAAGSEP
FT                   SSQGSDEAAKEEEDTGPSLVITLLLITGSRHPFKIDGKYLRKRSVNVENYDPFAMSVYT
FT                   LKELIWREWRQDWEPRPSSPSSIRLISFGKLLDDKAPLSDSKFSRDAPNVVHMTVKPQE
FT                   IVDEEDAKSKPQYTRERESSERSPGCRCIIQ"
FT   CDS_pept        join(977145..977208,977252..977312,977394..977441,
FT                   977495..977570,977705..977830,977970..978077)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18962827"
FT                   /orf_name="An14g03960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46632.1"
FT                   /db_xref="UniParc:UPI0000EFC85F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3E0"
FT                   /transl_table=1
FT                   /translation="MDRSEFSVGDSCNRYGSLTGEGADEARRCAHGGGKGGQAERGGPC
FT                   DPKETSESEKGTAGGGEGMRVVKRIEYPVCKAERETKKGKGERERERDRVLKRGRRRSK
FT                   PVTAEGSPDLVGGSPGRHLGSASAVCLNGRNEHQFPRAAEASVAADPGRFRTYLRH"
FT   CDS_pept        join(980214..980352,980446..980541,980672..980763,
FT                   980830..980934)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888520"
FT                   /orf_name="An14g03970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46633.1"
FT                   /db_xref="UniParc:UPI0000EFC860"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3E1"
FT                   /transl_table=1
FT                   /translation="MANLDTGIELFTTVGAEYDIENCEPRIFGPDKAWQFRILYLCNDD
FT                   AVLYNPVTVLQYLRALKTHSQYKGIRRKCIGLVGICRVIQGSAVKRWCSSPMAMEVGYR
FT                   GPLRGAIGPTNAMCCFEKGFRPLDRTGIFELAFTVEKEI"
FT   CDS_pept        join(982415..982652,982719..983635,983710..983877)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809613"
FT                   /orf_name="An14g03980"
FT                   /product="Similarity to hypothetical 57.9 kd protein -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK46634.1"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="UniParc:UPI0000EFC861"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3E2"
FT                   /transl_table=1
FT                   /translation="MLRQSFSIAKKATRKLYAHDDSSDLSLDLNITEPAVFVPTFTNKP
FT                   AVLRGTCQLRLKHDLTVKRLTVNFRGTSRVTWPHGLHDTQTVTDSTLTLVSPQSSDPAL
FT                   PCYSSALSEGRKSTWHKDKRKLQNAAPSTLCVDGNWGKAAGSKYQRLPAGTHTYEFEMV
FT                   LHSHLPESIEIRQSHVQYRVRACVECPGFLRRSFAKKQAIATVHCPAEDDVEDAEPAYI
FT                   ARAWKGLLQCGILVSRRGAPLGDRLPVTVSLTELRKAEFRGLQVFLSENVQYHQKDGLA
FT                   CCPGPFRRVILYEKVEMTGPTMSLHRAENVDDERPVSATKGDGAHAKLVGDPEIPNGLE
FT                   TAEEETVLNLTLQLPGCHLHCVSTGTQGMHYDTNYKNVRVSHWLEFVFMVTPRDNTLGS
FT                   STERIVQKVAKVPLTLRSCYAQHANASLPAYCDAEEFRFGR"
FT   CDS_pept        join(984804..984900,984964..985071,985132..985672,
FT                   985727..986579)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888521"
FT                   /orf_name="An14g03990"
FT                   /product="Remark: the systematic name of hxt5 from S.
FT                   cerevisiae is YHR096C"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46635.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC862"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3E3"
FT                   /transl_table=1
FT                   /translation="MAPPKYAGMSGRPLSLFLSGIATMGFLLFGYDQGVMSGIISDAAF
FT                   NNVFTATRNDNVMQATVTAVYEVGCLVGAIFALIFGETLGRRLMVISGAWVMIIGVIIQ
FT                   VTAMPGHIPLLQFIFGRVITGIGNGMNTSTIPTYQAECSKSTNRGLLICIEGGIIAIGT
FT                   AIAYWIDFGAHYGPPDLVWRFPIAFQIFFGILIIVGMMYLPDSPRYLIAHGKVEEGTRV
FT                   LAALAGSEIDDPHVQLEKQLTLDSIRASGSSQARFRDLLTGGPSQHFRRMIVGSSSQFF
FT                   QQISGCNAVIYYLPVLLEQSIGQSHDFALLIGGVNMICYAIFATFSWFFIEKIGRRKLF
FT                   LGGSYGQCAAMIIVFGCLIPGDSESAKGAVFGFFLYMCVFGATWLPLPWLYPAEISPLK
FT                   TRSKANAVSTCSNWLFNFTVVMITPVMVQHIGWGTYLFFAAWNGLFIPVIWFFYPETAG
FT                   RSLEEIDLIFAKGYVENMSYVRASKELPKLTDEEIEAKAAEYGILGDEEKAEERIAEKD
FT                   PPASAEFSQFQPTQL"
FT   CDS_pept        join(987778..988389,988440..990134,990198..990269)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217679" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888522"
FT                   /orf_name="An14g04000"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46636.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG327554"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFC863"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3E4"
FT                   /transl_table=1
FT                   /translation="MADTEPRKRRRPAKSCEQCRQRKVRCDRNVPCGPCTRARSSLGCS
FT                   YRRDSRFSTPTDHQASPIISREPQRNARSYPLPSGMPEGSTGSLGETLHIEPRCGSKEC
FT                   ISSQLGSTIRDLQLRLQRLEERLTDTDIVRPSAPEPDIQQALRELCDKVQRLEQRLLSC
FT                   TDSPQAPKGELSIAATPPRLHTSSRKMKLFGPTHYMHTMDKLQLVGSLETRGPQPLCPE
FT                   LKAELTARTKELRLLRGSVKAAQSPRLNDPVPDLLSTIPTRSVCDELVQCYLRTFERVY
FT                   RIVHIPSFNKEYQQFWDQPLAAPTPFLMKLALILAIGTTFHPQRGKAGKEYDTRLIQTW
FT                   IYAAQWWLTGPAEKNTFNLDGLQIFCLLLLARQMGSPGPSLYLSAGYLLQTATAMGLHR
FT                   DSAYFPFLPPFQSEMRARLWATVLELTLQSSLDSASPITIPYFDTKPPSNFNDTDINPD
FT                   IKPLPNPHPSTTHTDTSLQLLLNASFSLRAETIHLIHSPDRIPYQKALYLATKLRTTCH
FT                   TITTFFQSNTTTITTSPFHKSHLLTTLNRYILHLHLPFAHAASTTPQYHYSRKLCLESA
FT                   LTIASFAPSSSTSIPIPLDDFPLLTLTARGPLRGPLNLDIICTLALELITQIEEAPAVP
FT                   NTTTAPNPLTLLSSTIRAPILQTLENLALQSAHVLRMHGKSPALKRYIISEALVAQIRA
FT                   LEDGGGGGDVQGVVYEAVRGCLREGVGMLKGMEREGRDGDGDVGSLGMGMMVTPDSAGG
FT                   AVGGSDGMGLGIGIGMDDLEGWGLASFLYAPGFVDLGGW"
FT   CDS_pept        join(complement(991846..992008),complement(991660..991783),
FT                   complement(990504..991608))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175372" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888523"
FT                   /orf_name="An14g04010"
FT                   /product="Catalytic activity: Erg8 of S. cerevisiae
FT                   converts ATP +"
FT                   /EC_number="2.7.4.2"
FT                   /function="ATP binding"
FT                   /function="phosphomevalonate kinase activity"
FT                   /protein_id="CAK46637.1"
FT                   /db_xref="GO:0004631"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG737076"
FT                   /db_xref="InterPro:IPR005916"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000EFC864"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3E5"
FT                   /transl_table=1
FT                   /translation="MSYKAPTVTAVSAPGKVLLAGGYLVLDRDYTGTVFALDARIHVVV
FT                   QQLRRSHRSDEQASEDVIVVRSPQFVDAVWEYGIQRCDNGGGVKVVQKGDGRANPFVET
FT                   SLNYALTYISYVAASKDFGSLSITILADNDYYSETAFSKISSLQSPGRFVNFGVPLHEA
FT                   HKTGLGSSAALVTAFVSALVIHRTLQPEDLGAAREKLHNLAQAAHCAAQGKVGSGFDVA
FT                   AAIYGSCLYRRFSPSILESVGDAGSPGFEERLFSIVEDADPNHTWDTECLDFGMKLPRG
FT                   MQMVLCDVECGSQTPSMVRKVLEWRKQNPEESLMLWQALQSNNERLCLELKQLAQSPDV
FT                   EAPNSFDDTRRLIERSRDLIRTMTQKAGVPIEPKVQTELLDAITSIEGVVGGVVPGAGG
FT                   YDALAVLIEDKAEVIQRLNELFETWESKLEDDFGGKIGNVRLLGVRHGSAGVQNESLDQ
FT                   YAGWF"
FT   CDS_pept        complement(992190..992588)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15888524"
FT                   /orf_name="An14g04020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46638.1"
FT                   /db_xref="UniParc:UPI0000EFC865"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3E6"
FT                   /transl_table=1
FT                   /translation="MQITRPEWGWQPPVKPHMESSSHSLPVCLEMSGKWHINMSNSSVK
FT                   STVQTTDRCWMPLQLYTYLRSSATRRRSVSHHASALDLLLILFLLAGCLPRKTCRLSPL
FT                   SGAPPYRRSSQTIPSPICFCRPLLLPTH"
FT   CDS_pept        join(992948..993033,993123..993143,993204..993398,
FT                   993488..993668)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889504"
FT                   /orf_name="An14g04030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46639.1"
FT                   /db_xref="UniParc:UPI0000EFC866"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3E7"
FT                   /transl_table=1
FT                   /translation="MPQAHHGAKAMLGAGTEVRPVVTAHNLLKGPGPQTSVFRTEISLG
FT                   PRRKYVLRSETAGAKGHHPFGESQTQDGESAIRVSGGLSGSGSQTPGPKKKSRNGGCQE
FT                   RIQKMALLFFPTAPVCRVPRLGLAYDPGLAVRPPDQLLLGIPANPAPQATTTLLEG"
FT   CDS_pept        994514..998341
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809855"
FT                   /orf_name="An14g04040"
FT                   /product="Remark: a splice site was detected upstream of
FT                   the START codon"
FT                   /function="binding"
FT                   /protein_id="CAK46640.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG327557"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0000EFC894"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3E8"
FT                   /transl_table=1
FT                   /translation="MVFKPFTHLARQSFTKAFTHGYAQSVVAASQSSYASTTTFNQIAS
FT                   QPAAKLSRTTQLQNVFQPSSSSGAGAKASQGTSGSGDLGLAAYYAAWQHAQQTGDDSDW
FT                   KQMQLKRKVGWKPSLNEDGVKSKESDHLPSADNNFHNSPHITKASANADVSAKVEEAVA
FT                   REIQIQEEQAQVDEASEAKENTDTEAFPDLPPDVAAVADASTEQSRLASEHITDLASNN
FT                   KYAEIPGAFATILRDGLTPTVGAYNALLESAIQLHGDTAQAIQKALDVYSDMLRRRVVP
FT                   DEQTYQTLVQLFVVRANDAIKSKSLLEQERARYGGMEEPGKFMLHSSELERAILAEDHS
FT                   LGIAMKLFNTAATRHADLVFPLDTYRHLISACAKEGQVEDMVRVYGHMESHKVTPHASI
FT                   FPSMIDAFASTGDLQSAVECYNEYKGLAVSDDNGTFCIVQRLDGQVYAALVRAYLVCGK
FT                   EQQALRFLERIQASFEEVTENREARQQALESAVVQDGLVQHALTSGEHGRALDQAKTRL
FT                   RDGALDHAMSQICIAAADAGNLQTASEAYDALPTDMTIRQRPAISMLALHVRQGNVSAA
FT                   RAVWLTLNTTGQATPDMVQPTAMYAVALLKSGQIEEALVQARNMFSRVRNASAVADNSS
FT                   LNPIREQINESLHLIGRVLVQTAAVLSPQAAMSLLWSMVENGGLISPVAEHVVASLGPI
FT                   GISQLNARDLMLALQVQAGMLVNHSAVFDVAHPIRFSHMLDIALATGLPMDAVTTRVVD
FT                   QAVGKLFNSRPDMVKRWHDHLALTSSPSSFMSGRHSPSSDVSTMTPMSSTDDSFDPYAY
FT                   ATDFRGSSMISDELESTSGKLEAHLNDALSRVRNMRRNGRHPRYITYAKMITAATKCNR
FT                   VDLAYEILSMARRDVPLLPQYSAVKYGWVSILDAMVASCLTLGDRSQASKFHQELLKLG
FT                   SAPSANTFGLYITTLKESTKTFDEATEALKIFHRAVAEGVEPTSFLYNALIGKLGKARR
FT                   IDDCLLYFAEMRANGVRPTSVTYGTIVNALCRVSDERFAEEMFEEMESMPNYKPRPAPY
FT                   NSMIQYFLNTKRDRSKVLAYYERMLTRNIQPTMHTYKLLIDAHASLEPVDMPAAEKVLE
FT                   TIKAAGQRPDAVHYASLIHAKGCVMHDMEAAHAVFKSVAEERKVRMQPCLYQALLEAMV
FT                   ANHQVAQTEEIVRDMARRGVEMTAYIANTLIHGWATEGSVAQAKTVYDSIGIEKREPST
FT                   YEAMTRAFLANNDREGASRTVQEMLSRGYPAAVASKIADLVGTGAAVAAL"
FT   CDS_pept        join(999010..999073,999127..999549,999649..999824,
FT                   999906..1000099,1000414..1000624)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000242755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889505"
FT                   /orf_name="An14g04050"
FT                   /EC_number="1.4.3.5"
FT                   /function="FMN binding"
FT                   /function="pyridoxamine-phosphate oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="pyridoxine biosynthetic process "
FT                   /protein_id="CAK46641.1"
FT                   /db_xref="GO:0004733"
FT                   /db_xref="GO:0008615"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327559"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniParc:UPI0000EFC895"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3E9"
FT                   /transl_table=1
FT                   /translation="MNPGSLPDGPSHDAKHPKKLIFAPGDIQTTPEPKITPTETPDPSA
FT                   TATGVTTAPAPISRLAAEALRSNASTPDSVTENEIVSHPARAHQFVSNPPLTISQMHPT
FT                   NPLHQFHNWFRDPRLLPSSAPETCTLATASMPSGRVSARVVYLKELDERGWVVYSNWGT
FT                   GLQEGNKWAALTFCWSNLERQVRIEGLVEPLSRDESEMYWRTRERGSQIGAWASWQSKV
FT                   PGDVDATDIDDGRALLEKRVKEMEERFAGVEQIPLPPFWGGVRLVPESVEFWQGRRSRL
FT                   HDRFRSITPSNTLHTNTFNMSEPQSPSQEPQSHPNPEQQQQQQQQQQKPHQTKWLLLAL
FT                   SSGAFAALNGLFAKL"
FT   CDS_pept        join(complement(1003617..1004088),
FT                   complement(1003487..1003554),complement(1003076..1003435),
FT                   complement(1002950..1003027),complement(1002172..1002899),
FT                   complement(1001190..1002122))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809856"
FT                   /orf_name="An14g04060"
FT                   /product="Putative frameshift"
FT                   /function="voltage-gated chloride channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46642.1"
FT                   /db_xref="GO:0005247"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniParc:UPI0000EFC896"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F0"
FT                   /transl_table=1
FT                   /translation="MPVSPSSARPPPLSSERRNWRRLSGLSVVSPIHERPTPENGQPSA
FT                   ITEEISEIKRYEDFTTIDWVQDAVHEQARRRAKRRDGSGFWDQEETFGWRRKVRESYDA
FT                   GQAWLVITIVGAAIGLISAILNIITEWLSDVKLGHCTTAFYLNEQFCCWGAEGGCPEWR
FT                   PWTSYWIVNYFIYIFYAVLFAFVAASLVKSFAPYAAGSGISEIKCIIAGFVMKGFLGAW
FT                   TLLIKSIALPLAIASGLSVGKEGPSVHFAVCTGNVISRFFSKYKQNASKTREVLTATAA
FT                   AGVAVAFGSPIGGVLFSLEEVASYFPLKTLWRSYFCALVATGVLAVMNPFRTGQLVMFQ
FT                   VQYDRTWHFFELIFFVLIGVFGGLYGAFVIKWNLRVQAFRKKYLSQHAIMESVVLAGIT
FT                   AILCYPNMFLKINMTEMMEILFRECEGGHDYNGLCEYSGIIRLAQHVLTYYRAKNRWSM
FT                   VMSLAVATILRIFLVIISYGCKVPAGIFVPSMAIGASFGRFVGILVQALHEAYPKSQFF
FT                   ASCEPDIPCITPGTYAFLGAGAALSGIMHLTISVTVIMFELTGALNYILPTMIVVGVTK
FT                   AVSDCFGKGGIADRMIWSNGFPFLDNKEDHVFNVPVSQAMTSDPVSLPASDFPVREAEH
FT                   LLSDNKYQGFPIVDDRTRKTLVGYIGRTELRYAINRAKAEGPLSPTAKCLFTKEAAEAS
FT                   VTRRASTASHLHVPETFDDIQTNTGADYVDFSRYADHTPLTVHPRLALETVMEIFKKMG
FT                   PRVILVEHRGRLMGLVTVKDCLKYQFKVEAEEQALAATSPPQLALGGGGGRSGGDTLEE
FT                   RLWNLLQRIGSLLPWQRPPPQQQQQQQQRQQQQSRRRDTTAPEHHRDAETTANEADEED
FT                   AMLELEER"
FT   CDS_pept        join(1004120..1004158,1004392..1004518,1004599..1004730,
FT                   1004811..1004866,1004945..1005035,1005094..1005404)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963068"
FT                   /orf_name="An14g04070"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46643.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG327561"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000EFC897"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F1"
FT                   /transl_table=1
FT                   /translation="MGIAEASKRGNLGRLLESILFRTIHYSFTFLFRHAREWISTPHAP
FT                   EFPSLQLHLLGAIRYRPEHYLHDYLRRDVAMPPKDKAAAEASSSREITGQSALPNDDIV
FT                   QCSSNATFVIAMATELFIQYLTEQGHNVVKSERKPRKLIQYKDLATAVSRIDNLEFLSD
FT                   VIPKTTTYKQFKEKRAKEKEPGPEKGQRTLNGNLPAAVEDKEELEEQQSLQPVDDKPSR
FT                   GSRPPTVTMMVDRTVDTSAGDQDVEMTDQ"
FT   CDS_pept        join(1006018..1006312,1006471..1006559,1006645..1006795,
FT                   1006859..1007040)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000255193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889506"
FT                   /orf_name="An14g04080"
FT                   /EC_number="1.10.2.2"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK46644.1"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG668715"
FT                   /db_xref="InterPro:IPR004192"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI0000EFC898"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F2"
FT                   /transl_table=1
FT                   /translation="MSLSAASSSILRACARQQLPSSRAAIASCQQRRGVADASKSTFDS
FT                   PFGSSKEYSSTLKIPDFSKYQSKKPPRSNQVFSYFMAGSLGLASAVGAKATVQDFLVNM
FT                   SASADVLAQAKVEIGLGAIPEGKNVIIKWRGKPVFIRHRTQDEIQEAQKTEWQSLRDPQ
FT                   ADEDRVQKPEWLVMLGVCTHLGCVPIGESGDYGGWFCPCHGSHYDISGRIRKGPAPLNL
FT                   EVPQYNFPSEDTLVIG"
FT   sig_peptide     1006018..1006065
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F2 "
FT   mat_peptide     join(1006066..1006312,1006471..1006559,1006645..1006795,
FT                   1006859..1007037)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F2 "
FT   CDS_pept        join(complement(1008727..1009309),
FT                   complement(1007739..1008655))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048446" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889507"
FT                   /gene_name="she9"
FT                   /orf_name="An14g04090"
FT                   /product="Sensitive to high expression protein 9 homolog,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAK46645.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG327562"
FT                   /db_xref="InterPro:IPR008839"
FT                   /db_xref="UniParc:UPI0000EFC899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R3F3"
FT                   /transl_table=1
FT                   /translation="MQSMPLLLRQSFKSTLNLTRTTRPVQRRPLLPAVGPNSLYPAPRN
FT                   FSICLQCQFRTQSSLYSSDSLKDGKPAEQPKEDASPVIALPAGNANLEADAGSQQQAPP
FT                   AAAEAGESTQSQQQQQQQQQQQEEKSEANGKGWGDGGLPSYIEQRRSQFTKRFSDVMDN
FT                   LQSNIFVAGQRLNDLTGYSAIEMLKKEIHRQEERLRTARLQVRTAKDAYAAAINNRSTS
FT                   QREVNELLQRKHAWSPTDLERFTHLYRNDHTNEVAEHEAQEALSQAEHEAEEAAAQLSK
FT                   SILSRYHEEQVWSDKIRQMSTWGTWGLMGVNVLLFLIFQIAVEPWRRKRLVKGFEEKVI
FT                   EAIEKEKALDRIQIVTAQNQMAQESSTTSTASTATPETAETAETAEPSASPADEPIADT
FT                   DAIVTIESTEPEVFSSDPADAEPPANTIVSKPTPDNIREYIKFQLARVSPLLESLRQYL
FT                   HDLFSDRQVVLTQRDLSTVALQSAAAGAAVIGMLSMIIRQR"
FT   CDS_pept        join(complement(1010364..1010421),
FT                   complement(1009891..1010300))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114074"
FT                   /orf_name="An14g04100"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46646.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG741476"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniParc:UPI0000EFC89A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F4"
FT                   /transl_table=1
FT                   /translation="MCGSDIFLAILAVFFPPVSVWIKVGICTADSIINLALCCLGYVPG
FT                   LLHAWYIILKYPEPDYDDPSYEPLPGDAENGRVTYYYVSHQPIQHPSQRGYGTLPPQQP
FT                   QAANAPPQNQQPTPNHSQEQAQAGSSSQEHHDSRPPPTYAEAVKGDHKVQD"
FT   mat_peptide     complement(1009894..1010298)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F4 "
FT   sig_peptide     join(complement(1010364..1010421),
FT                   complement(1010299..1010300))
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F4 "
FT   CDS_pept        join(complement(1011902..1011987),
FT                   complement(1011716..1011801),complement(1011493..1011617))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889508"
FT                   /orf_name="An14g04110"
FT                   /protein_id="CAK46647.1"
FT                   /db_xref="UniParc:UPI0000EFC89B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F5"
FT                   /transl_table=1
FT                   /translation="MLGSSNRDEELAYHRTWHAASALIRRRARSRPGCSEVPHIFSASL
FT                   SVSWHLYHIPLADNITRGRGSCFTHRPSGIGTSWHDPVADGCVKYCPCCSTDI"
FT   CDS_pept        join(complement(1013043..1013073),
FT                   complement(1012857..1012985),complement(1012654..1012779),
FT                   complement(1012491..1012566),complement(1012239..1012413))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114075"
FT                   /orf_name="An14g04120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46648.1"
FT                   /db_xref="UniParc:UPI0000EFC89C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F6"
FT                   /transl_table=1
FT                   /translation="MLCACSKDANGGVAGFARNSGTSKRKKRRKGRINAGTGNFIALII
FT                   ARNFVMHRSTDCAGHSEWPSLHYSDEVYPLPLALIKPAQYSVSGCKHLCSEPGKAAAAI
FT                   RVGLANTGAEPNCATLWLTIPKCSGCKLETPSAEHLSVYRKYVTYIHFGPIAIVASLAW
FT                   LCDTTAHERLLAAWL"
FT   CDS_pept        join(1013145..1013189,1013330..1013683)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889509"
FT                   /orf_name="An14g04130"
FT                   /protein_id="CAK46649.1"
FT                   /db_xref="UniParc:UPI0000EFC89D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F7"
FT                   /transl_table=1
FT                   /translation="MGVIMNRVGIGSCTSFNWKDAGYSCEPPARPPFESVFSSRGPSGA
FT                   SASLPFFVSCASSVIQDCSVKEPTSIESNRAVLPVLCFPGSLPFGGPRTQAAITSSPDW
FT                   ESTAFLQVPCLAPAFSAVDRRLFSFLLP"
FT   CDS_pept        join(1014111..1014205,1014257..1014340,1014399..1014561,
FT                   1014620..1015837)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114076"
FT                   /orf_name="An14g04140"
FT                   /protein_id="CAK46650.1"
FT                   /db_xref="HOGENOM:HBG327566"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI0000EFC89E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F8"
FT                   /transl_table=1
FT                   /translation="MSGTCISLSGSTQCPAFDSSSVSTNSSLYTDFPFMQYVSNLTQFD
FT                   NELSSYVMQGYVREKYEEYLGCQGVNLTDTDDYYARYTTSVLCSSLVQSSKSDCNLSDE
FT                   ESRPLCADTCASMAISEEAIVTDTNLCSGKASDYMSQIRSDFTICALPADSLTVTCITG
FT                   AENEPKNCGFRSNVLGLCSYCASGSSNSTDSCCTDSNAATRCSNVTVPSSTLPPIFTST
FT                   AASNSTAGSNDLSGGQIAGIVIGSVAGFALLAALAVLALIYWRRRRRAENDSSLNQPNP
FT                   QRKGSPSMQQDQSPHEFAAIPGGRVARMSALREVPSSSPARSRYSALFGGAKYSDTSDS
FT                   DHGASPGAMSKKIPPTTGKRHGSLSSNSALAGAGTDSSPRSGTGGQYSSPDGLTSGQSE
FT                   QLSAFQDYYSQDDIHPGDKVAVLWAYQPRAGDEFALDRGEMLKVIGIWDDGWATGIRIP
FT                   ETAEDHDARHREQRDSGVSNGSRRAATSPAPVGDIKAFPLVCVCLPQHWRKIIDGGQAE
FT                   DD"
FT   CDS_pept        join(1016240..1016332,1016499..1016645)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889510"
FT                   /orf_name="An14g04150"
FT                   /protein_id="CAK46651.1"
FT                   /db_xref="UniParc:UPI0000EFC89F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3F9"
FT                   /transl_table=1
FT                   /translation="MSITGAVAGFFYVTTYSPSCRVNDGKLYGLEAAYTCIRLGQPGTM
FT                   IFVMMTDSTRALPMSLGINLGTAQFSCPDVILLG"
FT   CDS_pept        join(1017552..1017557,1017621..1017631,1017740..1018000,
FT                   1018068..1018116,1018179..1018319)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889511"
FT                   /orf_name="An14g04160"
FT                   /function="actin binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK46652.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG628477"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniParc:UPI0000EFC8A0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G0"
FT                   /transl_table=1
FT                   /translation="MSLASGVSITDECITAFNEFRMSGNSRGSKTKFIIFKIADNKKEV
FT                   VIDEVSQDEDYEVFREKLAAAKDAKGNPAPRYAVYDVEYDLGGGEGKRSKIIFISWVPS
FT                   DTATLWSMIYASTRENLKNALNIHTSIHADDKSDIEWKTVLAEASGGKAGK"
FT   CDS_pept        join(1019266..1019575,1019671..>1019675)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175160" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889512"
FT                   /gene_name="cox5"
FT                   /orf_name="An14g04170"
FT                   /product="Cytochrome c oxidase subunit V cox5-Aspergillus
FT                   niger"
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46653.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG395767"
FT                   /db_xref="InterPro:IPR004203"
FT                   /db_xref="UniParc:UPI0000EFC8A1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G1"
FT                   /transl_table=1
FT                   /translation="MFLRSVTRAAARSSAVPTTGLRSYRTVSGPMACLNARPQTEKKSI
FT                   APQQTRAASEHAISNPTLAGIEKRWEAMPPQEQAELWMQLRDRMKVDWHQMTLQEKKAA
FT                   Y"
FT   gap             1019677..1019776
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<1019779..1020244,1020308..1020390)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000009605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657180"
FT                   /orf_name="An14g04180"
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAK48510.1"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="HOGENOM:HBG443688"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI0000EFC8A2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G2"
FT                   /transl_table=1
FT                   /translation="TKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGI
FT                   YPAVDPLDSKSRMLDTRIVGEDHYNTATRVQQMLQEYKSLQDIIAILGMDELSEADKLT
FT                   VERARKLQRFLSQPFTVAQVFTGIEGKLVDLKDTIRSFKAIINGEGDDLPEAAFYMVGD
FT                   FESARAKGEKILAELENKA"
FT   CDS_pept        join(complement(1024011..1024065),
FT                   complement(1023817..1023941),complement(1023615..1023714),
FT                   complement(1023447..1023559),complement(1022693..1023384),
FT                   complement(1022305..1022640),complement(1021622..1022252),
FT                   complement(1021530..1021556))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889513"
FT                   /orf_name="An14g04190"
FT                   /EC_number="2.4.1.18"
FT                   /function="1,4-alpha-glucan branching enzyme activity "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK48511.1"
FT                   /db_xref="GO:0003844"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG302308"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EFC8A3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G3"
FT                   /transl_table=1
FT                   /translation="MASTETQTALQSAPPDGTGVIQLDPWLEPFRDALKQRFQFVESWV
FT                   KTINETEGGLDKFSRGYERYGINVNANGDITYREWAPNAVEAELVGDFNNWDVTAHPMT
FT                   KNSFGVWEITLPAKDGVPVIPHDSKIKITMVTPEGERIYRIPAWIKRVVQDLTVSPTYE
FT                   SVFWNPPATERYQFKHSRPKRPESLRIYEAHVGISSPETRVATYKEFTANMLPRIKYLG
FT                   YNAIQLMAIMEHAYYASFGYQVNSFFAASSRYGTPEDLKELVDTAHSMGLVVLLDVVHS
FT                   HASKNVLDGLNMFDGSDHLYFHSGGKGQHELWDSRLFNYGSHEVLRFLLSNLRFWMEEY
FT                   KFDGFRFDGVTSMLYTHHGIGTGFSGGYHEYFGGSVDGEGVMYLTLANEMLHSLYPDCI
FT                   TVAEDVSGMPALCLPHALGGVGFDYRLAMAIPDMYIKLLKEKSDDEWDIGNLSFTLVNR
FT                   RHGEKTIAYAESHDQALVGDKTIMMWLCDKEMYTHMSVLTEFTPIIERGMALHKMLRLV
FT                   THGLGGEGYLNFEGNEFGHPEWLDFPRAGNNNSFWYARRQLNLTEDHLLRYKFLNDFDR
FT                   AMQLTEEKYGWLHSPQAYISLKHEGDKVLVFERAGLLWIFNFHPSNSFTDYRVGVEQAG
FT                   TYRIVLDTDDKEFGGFGRNLKETRFFTTDLPWNGRSNYLQVYLPTRTALVLALEETL"
FT   CDS_pept        join(complement(1026092..1026727),
FT                   complement(1026000..1026038),complement(1025743..1025944),
FT                   complement(1024872..1025671))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889514"
FT                   /gene_name="rhgB"
FT                   /orf_name="An14g04200"
FT                   /product="Probable rhamnogalacturonase B "
FT                   /EC_number="3.2.1.-"
FT                   /function="polygalacturonase activity"
FT                   /function="rhamnogalacturonase B activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="pectin catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK48512.1"
FT                   /db_xref="GO:0004650"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0045490"
FT                   /db_xref="GO:0046576"
FT                   /db_xref="HOGENOM:HBG324408"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000059132F"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R3G4"
FT                   /transl_table=1
FT                   /translation="MLLDKLSVLSFLGLAPIFAAAQLSGSVGPLTSASTKAATKTCNVL
FT                   DYGAKADKSTDLGAPLASAFADCKSGGLVYVPSGDYALSTWARLSGGEAWALQIDGIIY
FT                   RTGTDGGNMIYIEHSSDFELFSSTSEGAMQGLGYEFHADDNWSGPRLLRLYEVTDFSVH
FT                   DFILVDSPSFHFSLDTCTNGEIYNMAIRGGNHGGLDGIDVWSNNIWVHDVEVTNKDECV
FT                   TVKSPSKNILIESIYCNWSGGCGMGSFGSDTNVSDITYRNIYTWSSNNMMLIKSNGGSG
FT                   FVENVLLENFIGHGNAYSLDIDSYWASMSAVDGDGVQLSNITVKNWKGTEAYGAERGPV
FT                   KVVCADGAPCYDITIEDFAMWTEEGDSQWYSCESAYGSGYCLQDSDDHVSYSVTTSTVS
FT                   SAPSGYSATSMAADLTTDFGSTVSIPIPTIPTSFYPGATPYSALMANSASTAAASSIAS
FT                   HATVHSSSASVAASVPSAVAPSESIPAATSAVVSSAAAIAPSPAVGAQEGSTTSAPSFA
FT                   APSGAGNSPQGPTGASGFGEKGQQGEQGEQGEQGEQGVCYV"
FT   mat_peptide     join(complement(1026092..1026664),
FT                   complement(1026000..1026038),complement(1025743..1025944),
FT                   complement(1024875..1025671))
FT                   /product="Probable rhamnogalacturonase B "
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R3G4 "
FT   sig_peptide     complement(1026665..1026727)
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R3G4 "
FT   CDS_pept        complement(1028194..1029093)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234986" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889515"
FT                   /orf_name="An14g04210"
FT                   /protein_id="CAK48513.1"
FT                   /db_xref="HOGENOM:HBG327568"
FT                   /db_xref="UniParc:UPI0000EFC8CC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G5"
FT                   /transl_table=1
FT                   /translation="MKASFITLFAALATSALAAPTGGVPGVSEVTKTVNIGSASSNVIS
FT                   TPSASASAGATGHIVQDVGNGVNQVLTVTGADAKKLLIQLSPDVANLLSGLGLPGLGSS
FT                   VGTIIKTAASVGDLVQDVGKVVDGLLTVVDKDGRALLIQLDPVVTGLLSGLGLPELGVP
FT                   VGSIVGTLGENLKRSADGKIVQDLAPKVKDVLEVTGSDSKRLLVQLSPSVASLLSNLDL
FT                   PSVGTPVGQIIKTAGSVGDLLKDISTPVEQLLTVVGQDGSYLLIQLSSDVSSLLSGLGL
FT                   PSLGSTVGSVVATLGQNL"
FT   mat_peptide     complement(1028197..1029039)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G5 "
FT   sig_peptide     complement(1029040..1029093)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G5 "
FT   CDS_pept        join(complement(1029615..1029754),
FT                   complement(1029364..1029469))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889516"
FT                   /orf_name="An14g04220"
FT                   /protein_id="CAK48514.1"
FT                   /db_xref="UniParc:UPI0000EFC8CD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G6"
FT                   /transl_table=1
FT                   /translation="MSRWLHAPSTPISGSGWLPIGQTTFTARVAHCLAGDIHSTGIGEW
FT                   QRDDRTSTKLVAVSTTQQRCAHHAYALAILTSAITT"
FT   mat_peptide     join(complement(1029615..1029652),
FT                   complement(1029367..1029469))
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G6 "
FT   sig_peptide     complement(1029653..1029754)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G6 "
FT   CDS_pept        join(1029928..1029980,1030115..1030179,1030432..1030491,
FT                   1030721..1031044,1031164..1031375)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889517"
FT                   /orf_name="An14g04230"
FT                   /protein_id="CAK48515.1"
FT                   /db_xref="UniParc:UPI0000EFC8CE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G7"
FT                   /transl_table=1
FT                   /translation="MSGPCRSKTSHGRVIKGAQVGGQPSANANSTPGICDITATGTATA
FT                   YASAPQIMRVIDFTRSELRPLNTEHATRTLELRILVANLIFDIPVRGMRGSQPSAPMER
FT                   FFREMIPYSPWKGWLASPPRGTRSTDGSRLLNKKNLPLRYTAGIPTVYRDQQGLRRSDG
FT                   PSGGGERPGGAHYCKHTVLPGNKSQLPPFGRLTVCLQFNCDANSSGHDPWYSQNLMLLN
FT                   HLSCSQSTFTSKNGS"
FT   CDS_pept        join(complement(1033614..1034013),
FT                   complement(1033122..1033555),complement(1032301..1033067),
FT                   complement(1031757..1032213))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000122165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889518"
FT                   /orf_name="An14g04240"
FT                   /protein_id="CAK48516.1"
FT                   /db_xref="HOGENOM:HBG325423"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="UniParc:UPI0000EFC8CF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G8"
FT                   /transl_table=1
FT                   /translation="MMHEQGTGGAPKYGTVSQLPLIGNISNPLSNITIGRSGADEASVG
FT                   YYKAQTAEGTVVELSASAHAGIYQYTFPNGSDGNVLIDVSHVLPSYRGMGLSQGYKGGN
FT                   ITIFPDGHYEGHGVYDNGWNRSPDWSIYFCGHFDAAPVSNKTYVGTIAGGSVEQHSGFA
FT                   SSSSGSTRVGGLFTFKNAVVTSRVGISWISTEKACQNVEDEIPEDKEFQSVVDDAQSEW
FT                   ETKVLSKVTTTNTNETTLTLLYTSLYFMHLIPTNQTGENPQWTSQEPYYEDIFTYWDLF
FT                   RCSTALMQVLQPAAYEEQIRSLIDIWRFEGYMPDARSSNYNGRTQGGSNADNILADAYV
FT                   KGVRGAVNWEDGYKAMVKDAEVTPSNDPVDPQAPDSSTKEGRGALPDWLSLGYITPRFS
FT                   RAVTRAVEYSCNDFGLYQVASGLGKTDDAEKYLNRSRNWRNHWNANQTSLGFSGFVVPR
FT                   NESGFIETDPLNDSGYWGDPYYEASSWAYSWASIHDMKTMIEKMGGNQTVLDRLNIMFT
FT                   EGASGSSGIIFDPTNEPMFNVPYLYHYIDRQDLSVFRSRDIAKSYYGTSVSGLPGNSDA
FT                   GAMQTWILWNMIGLYPVTGQSTFLIHSPWFDSLVIDLGGGKKLNVSSSGGDGNGGGNIY
FT                   VQSLRVNGKDWKKNWLTWDDIFAQGGTLDFELGATASDWFTGELPPSPAS"
FT   CDS_pept        join(1034209..1034641,1034827..1034918,1035186..1035358,
FT                   1035461..1035503,1035997..1036110)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114077"
FT                   /orf_name="An14g04250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48517.1"
FT                   /db_xref="UniParc:UPI0000EFC8D0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3G9"
FT                   /transl_table=1
FT                   /translation="MTDSRDSTYNKSTWEVKFAARAAGSSRLKISMVYQLAMANLAQRK
FT                   AAEKRIVEPPISKGFTKYISQEPVLGTASGGSQWELSCGYQCYQFSSVQKRVGEIPGPA
FT                   GIQIGLSTTVTGRLKGWITSSGESSAHWAHRDPAHAMITGGGHIPIICWYVSFRGLGQG
FT                   TGQGRGKEGPHSSLGDTESWLQGRPANCAWALDLLFAPWAQLSGRSFQPMVSPHASAFR
FT                   GPSFEWFHWLLLCNGPENLIFTLKLGNEPKHSELEKNLLDISAIRRGKAFLKGSGFLGL
FT                   AQP"
FT   CDS_pept        complement(1036844..1037590)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000278855" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114078"
FT                   /orf_name="An14g04260"
FT                   /product="Similarity to hypothetical protein PA4181 -
FT                   Pseudomonas aeruginosa"
FT                   /function="RNA binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAK48518.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG669249"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniParc:UPI0000EFC8D1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H0"
FT                   /transl_table=1
FT                   /translation="MGVTTSPHELLQAARIAPEIFKLRPDYRALLMVVENIPPGASDAS
FT                   SEVLLQEAETCVQELLSKHSSITDFPHIAAWRDAYKAFGAKPQKTRNSLESLTRRADGG
FT                   LPRVNRLTDIYNAISVKHQIPLGGEDLDKYDGSPFLIRATGQEPFETFSGGEPKSELAA
FT                   PGEPIWCDNTGITCRRWNWRQGPRTALTDETSRVLFILDALDPLSDDSLVQAADELASA
FT                   LKSLSPEVQTTCRIIRSAEMNDDVKA"
FT   CDS_pept        join(1039457..1039505,1039896..1039993,1040077..1040286)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809857"
FT                   /orf_name="An14g04270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48519.1"
FT                   /db_xref="UniParc:UPI0000EFC8D2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H1"
FT                   /transl_table=1
FT                   /translation="MRVMLGSFMPIAEWGARTCASNARLSPSIPTPSHFIYAAGHYKIS
FT                   TLYRLHSIVFRPVQQHGYILVHAATSSSWIRLSPHVIQQILAISHGMIIRDYCYSNKQS
FT                   YCWIFQSQSSRSLA"
FT   sig_peptide     join(1039457..1039505,1039896..1039906)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H1 "
FT   mat_peptide     join(1039907..1039993,1040077..1040283)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H1 "
FT   CDS_pept        join(1040724..1040793,1040853..1041991,1042048..1042395)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889519"
FT                   /orf_name="An14g04280"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK48520.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC8D3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H2"
FT                   /transl_table=1
FT                   /translation="MSLLKNYRVYLLTAVAYSGSLLFGYDTGVMGSVLSLTSFKEDFGI
FT                   PTGSSGFASSKSSEISSNVVSLLTAGCFFGAIFAAPLNERIGRRYALMIFTVIFLIGAA
FT                   VQVASKHHIGQIYGGRVIAGLGIGGMSSITPVFVSENCPPSIRGRVAGMFQEFLVIGST
FT                   FAYWLDYGVSLHIPSSTKQWRVPVAVQLIPGGLMLLGLFFLKESPRWLAGKGRHEEALQ
FT                   SLAYIRNESPDSEEIQKEFAEIRAAIDEEVAATEGLTYKEFIQPSNLKRFGFAFTLMLS
FT                   QQFTGTNSIGYYAPEIFQTIGLSATNSSLFATGVYGTVKVVATAIFLFVGIDRWGRKLS
FT                   LVGGSIWMASMMFIIGAVLATHPPDTSASGVSQASIAMVVMIYLYVIGYSASWGPTPWV
FT                   YVSEIFPTRLRSYGVGLAATSQWLWSFVVTEITPKAVHNIGWRTFLMFGIFCVAMCVFV
FT                   IVFAKETKGRSLEDMDILFGAVNEADRRAAVEHTMHKRGSSHIEDVDEETERVRHEQDK
FT                   V"
FT   sig_peptide     join(1040724..1040793,1040853..1040854)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H2 "
FT   mat_peptide     join(1040855..1041991,1042048..1042392)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H2 "
FT   CDS_pept        join(1043955..1043957,1044074..1044195,1044247..1044314,
FT                   1044366..1044631,1044690..1045676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963069"
FT                   /orf_name="An14g04290"
FT                   /product="Similarity to hypothetical amidase -
FT                   Schizosaccharomyces pombe"
FT                   /EC_number="3.-.-.-"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK48521.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG481888"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="UniParc:UPI0000EFC8D4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H3"
FT                   /transl_table=1
FT                   /translation="MAHIARISEIDVQFGTILELNPDALSIAKQLDRERDQGYIRGPLH
FT                   GLPVLLKDMIGTKDKMQTAAGSWALVGAKVPADSTVAAKLRDNGLVILGKTSMSEWANF
FT                   RSVNSSNGWNARRGYTFGAYYPDQDPNGSSSGSAVATDLGLTIFALGTETSGSILLPSE
FT                   RNNIVGIKPTVGLTSRYMVIPLSERQDTIGPLARTVKDAAILLQAISGPDDKDNYTSAS
FT                   PFAAKLPDYLAACKPSGLQGKRIGIPRNVIEYLGPAGAPIVAAFEKAVTVISAAGATVV
FT                   DNANFTAYSDFYGSLKPAMVVAADFSTNIKDYLGELERNPNDIHSLEDIRKFTQHNALE
FT                   GYPSRDTEVWDQTIALGIDNTSPGFWSLYQETLYFGGEGGLLGALSRDNLDAVILPTLV
FT                   GFDIPAVVGTPGITVPLGAYPDGTPVEYNTRGDLIQRAPGVPFGISFLGQKWSEEKLIG
FT                   MAYAFEQQTLVRNKLKRHLKVDS"
FT   CDS_pept        join(1046004..1046232,1046299..1046512,1046585..1047590)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281219" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114079"
FT                   /gene_name="uba4"
FT                   /gene_synonym="cnxF"
FT                   /orf_name="An14g04300"
FT                   /product="Adenylyltransferase and sulfurtransferase uba4 "
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /function="nucleotidyltransferase activity"
FT                   /function="sulfurtransferase activity"
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK48522.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="GO:0016783"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG535305"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR007901"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC8D5"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R3H4"
FT                   /transl_table=1
FT                   /translation="MNGVEQTCASLRTQIAATEAKLADLKRELEIAEQAAASHKQNAAD
FT                   AEGGSERRWPLLDEEYRRYGRQMIVPQLGIQGQLKLRSAKVLIVGAGGLGCPAALYLAG
FT                   AGVGTLGLVDGDAVESSNLHRQVLHRTRNIGKLKVDSAIEYLKELNPHSKYIAHREHLA
FT                   PEAAPEIFSNYDLILDCTDNPATRYLISDTAVLLGKPLVSASALRTEGQLMVLNNPPRP
FT                   AGDKTGGPCYRCVFPKPPPANTVTSCADGGIVGPVVGTMGVLQALEAIKVITADETTTP
FT                   PPPSLHIFSAYSTPLFRTIKLRSRRPNCAVCSAEASVTVDTVRSGSTDYIFFCGTTGPE
FT                   NLLSPEERITPLEYRTRHHDKEEKEPTIIDVREKVQYDICSLENSINIPISTILASASS
FT                   SMSNGDSLADGVPALPSWVPPDVASSQSTDPVYVVCRLGNDSQVAVKKLKELGLDQGGK
FT                   RVVADIRGGFRAWKEQVDPEWPEY"
FT   CDS_pept        join(complement(1048669..1048797),
FT                   complement(1048306..1048583),complement(1048128..1048263))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809858"
FT                   /orf_name="An14g04310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48523.1"
FT                   /db_xref="UniParc:UPI0000EFC8D6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H5"
FT                   /transl_table=1
FT                   /translation="MSDRIDPKIRGSSRPLIHGLTSPDHVIRSATPNATRLNSRRVQRG
FT                   IFASLLLRQRKKRVKRGRSLNFATVEIVAIGRRLSQVDPWAVCQEHNQFLHRVGDLLPL
FT                   FTDKLSVLVVEWVTFPEDVECSEDESSSSSFKLNGDAAWCLDLAGMTGTAQMLGGWTHC
FT                   HAGIDIIMLEVVELLRS"
FT   CDS_pept        join(1048853..1049007,1049058..1049090,1049146..1050484,
FT                   1050534..1051666,1051737..1052097)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217528" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963070"
FT                   /orf_name="An14g04320"
FT                   /product="Similarity to hypothetical protein SPAC57A7.05 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK48524.1"
FT                   /db_xref="HOGENOM:HBG327575"
FT                   /db_xref="InterPro:IPR018820"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="UniParc:UPI0000EFC8D7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H6"
FT                   /transl_table=1
FT                   /translation="MAAQVDSDQSSSRVLPGEDDGRRNREWKLFSKLKRAWKSLELDMP
FT                   TLLLMMKGALAPTICVAIYQADAVASLFNTVGYLVAIISVLGFSIMPRAKFIQMMVLDV
FT                   LAVCVASAVALLMMYSCVKAREHSESASAAADGSTVYNSSAAAVSGVWLFFEIYLVHTF
FT                   RAKFQQFQFPVIIYSIVANVAFVYASRLGTMAAAIALVKKLLEACLTGLGVATGVSLFI
FT                   LPKSTRGIVFKQMAGYIGALRAALNAHTAYFETLEKDDMFGRAETYDSTVEKVTDKGKV
FT                   YSPEAQAIRTACQKVTDLHAKIHGDLTFAKREVAIGKLGPDDLQAIFRHLRQTMIPVVG
FT                   LSFVVDIFQRLSDYNKWNQPIDMTETEIPDQVRQRVRQEWNEIMRAVHDPFSSMIHTID
FT                   EGLHHVSLQLELTKPPKPSNAGKESEDVEATASPKPGEKGFGEYYEKKLRNFKYAKRVA
FT                   LRTWSEEKGIILPPDFFEHPSSVHLDVDDIPDDKFGVGRDRSRRQLYLILYVEQLLEST
FT                   GHVVYDFIQFADEKVASGKLARKRLVIPGSKRLLKWLISAFKAEDSHEDDNLGGDINSQ
FT                   NNILQLGEAYKHRKDPEHLPPENMLQKIGDKIRLIPTALRSPESAYGFRVACATMTVAV
FT                   VSFLHDTQDFFVKQRFVWAMIMVNLSMSPTSGQSIFGFVLRLLGTVLAMVLSLLAWYIP
FT                   GQKTPGIIVFFFIFLTCVFYVPIKIFRFRIIGIITIISTSMIVGYELEVRKIGEQVAAS
FT                   NGQQYYPIYLLGPYRLATVSAGIAVAFIWTFFPYPISEHSVLRQSLGASLYLLANYYSV
FT                   IHETVSARMRGDEGDLALKTSSGRRLLKARNKVFSKQMLMLNNLRTYAGFLNWEVAIGG
FT                   RFPKKRYNSIITCIENIVSYLSLLGYASDTLLQLDGDDESDSAWLHDFKRLVASARVTT
FT                   HEITTVLCLLSASITNRQPLPPYLKAPRPYGFSKRLEALDKDILSLRHIAEPGFATFSV
FT                   LQISTRCIVGDVERLMR"
FT   CDS_pept        join(1052699..1053098,1053160..1053500,1053677..1053907)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889520"
FT                   /orf_name="An14g04330"
FT                   /product="Similarity to hypothetical short chain alcohol
FT                   dehydrogenase cta - Cucumis sativus "
FT                   /EC_number="1.1.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK48525.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC8D8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H7"
FT                   /transl_table=1
FT                   /translation="MTQPKTILITGAAGGIGLATSRHFNTLHPTSTIILTDLPTHQEAT
FT                   ESLIQSTFPHPEKAVFLPANITDWGRMTHLFRTIAQKYGGVDVVVANAGMMESTPVLDL
FT                   EDIDEETGELRESLEARRVVDVNLMGTLNTLRLAMYHMKEKEKKNGSIVLVASTSGYFG
FT                   GTGVTAYVASKHGVVGLLRASQVTAQKYGIRVNAVAPFMTPTRMTAGLSQSWQDAGLEA
FT                   NTPERVAEVIEQVGMDTARRGSCMLTSEAMCFLLDYREIGYRQSREGIFLGWHGATLLP
FT                   RSLDHCSGVKSPRAEPTYQSLRGRPFAPVARVGHWASRTEGM"
FT   sig_peptide     1052699..1052755
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H7 "
FT   mat_peptide     join(1052756..1053098,1053160..1053500,1053677..1053904)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H7 "
FT   CDS_pept        join(1054219..1054461,1054544..1055263,1055314..1055937)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217529" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657181"
FT                   /orf_name="An14g04340"
FT                   /product="Function: urdJ from Streptomyces fradiae is
FT                   involved in the urdamycin biosynthetis "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK48526.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG327577"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000EFC8D9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H8"
FT                   /transl_table=1
FT                   /translation="MGVEYIEFSHAKDGLESQLCNCASSQNLVEVASAEHLRHNATANL
FT                   AAEWKPGVKEWLVLTCVSLLLTMDAFNATVLLPMITPLGSTLWIEASYILASAASQPFS
FT                   AMLAAIFGVGPIALGAAVLATVGTGVCSGSMSLACLVPGRFVQGVGCGGAITTSLLMID
FT                   EVIPCPHQARFTGYALQARAVGAIVGLIFGGVLVNHAVWTFYTSFVFCALGLLVIPFAV
FT                   ELRTYKRIAKCKVCELDWQGAVLTFMGMGCLLIGINWGGILYEWSNWHVLVVLGAGAAS
FT                   IIVLVLYESLWSIHPLFSSAVFSDIARSMLYLGSLLHGFLLSCHLVNCALYLRLVQDLS
FT                   SAFEGLSLLTVVSPALLALILTEKVRLLRGPSAFPWMVRIGWFCSVLATGFFIILDVST
FT                   PPQAWVFILLGGGMGHSLLISGYHRGVHYIHQPSRDNEHYPASGILMYSLLRTWGMCIA
FT                   VPVSGAIILNRMFREEGTEESMNFDVQAGGSSLSQQGRSQKLMLVDGFHMLWRVMVGAS
FT                   ALGGISSLFVK"
FT   CDS_pept        complement(1056372..1056725)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114080"
FT                   /orf_name="An14g04350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48527.1"
FT                   /db_xref="UniParc:UPI0000EFC8DA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3H9"
FT                   /transl_table=1
FT                   /translation="MDKIVSFSNWLKVVKTKNQPTTSMYASQTNNNNHEPPKKKQKVSH
FT                   HHPLFVVDGAVEQTPTQDKEQNICVSEGEVVEMMGIDDYDFGAPLKRVPTPYPKKNKDQ
FT                   YDDDKDDEDEREQ"
FT   CDS_pept        join(1057400..1057435,1057502..1057627)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963071"
FT                   /orf_name="An14g04360"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK48528.1"
FT                   /db_xref="UniParc:UPI0000EFC8DB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I0"
FT                   /transl_table=1
FT                   /translation="MIVIAACIPHHTRGKGENPGLSLNAKNIRFQDDASTNKRLFGSVK
FT                   YSRLGYPD"
FT   CDS_pept        join(complement(1058923..1059269),
FT                   complement(1058745..1058870),complement(1058600..1058696),
FT                   complement(1058303..1058536),complement(1057913..1058248))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175137" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889521"
FT                   /gene_name="pelA"
FT                   /orf_name="An14g04370"
FT                   /product="Probable pectin lyase A "
FT                   /EC_number="4.2.2.10"
FT                   /function="pectin lyase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="pectin catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK48529.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0045490"
FT                   /db_xref="GO:0047490"
FT                   /db_xref="HOGENOM:HBG437419"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI0000591338"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R3I1"
FT                   /transl_table=1
FT                   /translation="MKYSTIFSAAAAVFAGSAAAVGVSGSAEGFAEGVTGGGDATPVYP
FT                   DTIDELVSYLGDDEARVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCEN
FT                   YEPDAPSISVEYYNAGVLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVT
FT                   DINPKYVWGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDY
FT                   SATCDGYHYWGIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAF
FT                   EIGEGGYVLAEGNVFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGSSGT
FT                   FSEDSTSFLSDFEGKNIASASAYTSVASSVVANAGQGNL"
FT   mat_peptide     join(complement(1058923..1059209),
FT                   complement(1058745..1058870),complement(1058600..1058696),
FT                   complement(1058303..1058536),complement(1057916..1058248))
FT                   /product="Probable pectin lyase A "
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R3I1 "
FT   sig_peptide     complement(1059210..1059269)
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R3I1 "
FT   CDS_pept        join(1059646..1059738,1059809..1059863,1060019..1060072,
FT                   1060316..1060419,1060499..1060545,1060584..1060754,
FT                   1060969..1061115,1061195..1061283,1061367..1061431)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809859"
FT                   /orf_name="An14g04380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48530.1"
FT                   /db_xref="UniParc:UPI0000EFC8DC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I2"
FT                   /transl_table=1
FT                   /translation="MDGVIGIDDNQDWKGEGGVVATWLSITVMAPGVGGFTAFHDARAG
FT                   ALSHGCYGWKAGRARQLGLFISGARNAGQVAHSGTFGLRRYQDTTHQVDLRAAIAPRSE
FT                   RVTGHDKVGVSRTPGDGVTLPLSIIFPVQLHTILRHFPVKLGFRCLGSSSFEAVEGAYS
FT                   TPEKYTESDNTGIIPEAVVFNSDGFLDIEYDGCRVQVLRLLDWLTSDMGAKPRFLTASR
FT                   VEGIRNHPEETCWFQPHQGHHSLQTLSFLGGGELDVESHAVGVGYTRMAGRT"
FT   CDS_pept        1062370..>1062549
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657182"
FT                   /orf_name="An14g04395"
FT                   /EC_number="1.3.5.1"
FT                   /function="succinate dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK48531.1"
FT                   /db_xref="GO:0008177"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="UniParc:UPI0000EFC8DD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I3"
FT                   /transl_table=1
FT                   /translation="MAALRTTSRLFASSKPLFRPGAFSRSYATVDALSQVSASGHASSK
FT                   TIPESKTSNVQDPSP"
FT   gap             1062550..1062649
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<1062655..1062675,1062731..1063054)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166750" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889522"
FT                   /orf_name="An14g04400"
FT                   /EC_number="1.3.5.1"
FT                   /function="electron carrier activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="succinate dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42002.1"
FT                   /db_xref="GO:0008177"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG521079"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI0000EFC905"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I4"
FT                   /transl_table=1
FT                   /translation="RDTPTADGLENRQSPEERKKLDGLYECILCACCSTSCPSYWWNSE
FT                   EYLGPAILLQSYRWLADSRDEKTAERKAALDNSMSVYRCHTILNCSRTCPKGLNPARAI
FT                   AEIKKMMTAH"
FT   CDS_pept        join(complement(1063837..1064696),
FT                   complement(1063564..1063615),complement(1063461..1063526))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963072"
FT                   /orf_name="An14g04410"
FT                   /product="Catalytic activity: EC 4. 1. 2. 13 catalyses the
FT                   reversible cleavage of fructose-1 "
FT                   /EC_number="4.1.2.13"
FT                   /function="fructose-bisphosphate aldolase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAK42003.1"
FT                   /db_xref="GO:0004332"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG327581"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000EFC906"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I5"
FT                   /transl_table=1
FT                   /translation="MSLPNNRALPILDHAYQHHYGIPAMCCYNLEGILATVRAAEKLRS
FT                   PAMILLFPWAXHYAGSILVHAAAEAARNASVPITVHLDHAQTPEIVRQAADITPGFDSI
FT                   MIDMSHYERAENLALTRELVAYCHERGIATEAEPGRIEGGEDGISDTADLEGVLTTPEE
FT                   AEEFVNTGIDWLAPAFGNVHGSYGPRGIRLEYDRLESIRERVGDRVRLVLHGADPFDKG
FT                   IFDRCIGAGVSKININKVLNGEWVGVMGEKANGKGVGVMGLVEEATERMERAVERCIEV
FT                   LGSGGSSDFNCLHARGSRISMIQVAKTGLDQDGICYHLLPGHGF"
FT   CDS_pept        join(complement(1066086..1066341),
FT                   complement(1065547..1066040),complement(1064938..1065498))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657183"
FT                   /orf_name="An14g04420"
FT                   /EC_number="1.1.1.31"
FT                   /function="3-hydroxyisobutyrate dehydrogenase activity "
FT                   /function="coenzyme binding"
FT                   /function="phosphogluconate dehydrogenase (decarboxylating)
FT                   activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /biological_process="valine metabolic process"
FT                   /protein_id="CAK42004.1"
FT                   /db_xref="GO:0004616"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0006573"
FT                   /db_xref="GO:0008442"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG327582"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC907"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I6"
FT                   /transl_table=1
FT                   /translation="MSKPAIGFVGLGAMGFGMATHLVHEGYPVYGYDVFPASVQRFQAA
FT                   GGTPASSLRESAERKLFYVCMVASAPQAQTVLFGDEGVVQYLPQNATLLLCSTVPASYA
FT                   QSVAAELASRGRSDVHFVDAPVSGGAKRAADGTLSIIAGGSDSALQIARDILQAMSAPN
FT                   KLYLVPGGVGAGSNMKMVHQVLAAIHILGASEAMGFAAHLGLDAVNTAERIKSSEAWTW
FT                   MHENRFPRMLEEDWNPGASALTIILKDAGIITTSARQNNYPVPLCATAEQIYLSALVQG
FT                   YGPKDDSAMIRQYYSHPLKDLNTSTASEDPETAIQLVLDLMQCVNLVAAAEAIAFARSL
FT                   GVDMAQFFELVSDAAGGSKVFITRGLEMIEGKIGAQAPAGTETLDAVVSRLEKVVQKAR
FT                   DMHCPLHLGNAALNVLLMSKGQGFGSEGSTSVIRVYP"
FT   mat_peptide     join(complement(1066086..1066284),
FT                   complement(1065547..1066040),complement(1064941..1065498))
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I6 "
FT   sig_peptide     complement(1066285..1066341)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I6 "
FT   CDS_pept        join(1066419..1066552,1066649..1066736,1066841..1066897)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889523"
FT                   /orf_name="An14g04430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42005.1"
FT                   /db_xref="UniParc:UPI0000EFC908"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I7"
FT                   /transl_table=1
FT                   /translation="MGRFEVRERGGCRGGFGGGPINTIASGLWTLPFGITIRNVSSELG
FT                   DDRPVLDVVGLFRRPLNFVPTSRSIAMLTHTRSKGRKSWVLDDDDVN"
FT   CDS_pept        join(complement(1067416..1067469),
FT                   complement(1067258..1067341))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889524"
FT                   /orf_name="An14g04440"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK42006.1"
FT                   /db_xref="UniParc:UPI0000EFC909"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I8"
FT                   /transl_table=1
FT                   /translation="MAFCSVCCIGIVTVFYAIAISDIARAVQYYHYSYHSPGHILGLFC
FT                   "
FT   mat_peptide     complement(1067261..1067338)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I8 "
FT   sig_peptide     join(complement(1067416..1067469),
FT                   complement(1067339..1067341))
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I8 "
FT   CDS_pept        join(complement(1069592..1069923),
FT                   complement(1069146..1069232),complement(1069008..1069099),
FT                   complement(1068677..1068756),complement(1068387..1068529),
FT                   complement(1068233..1068292),complement(1068054..1068165),
FT                   complement(1067894..1067968))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889525"
FT                   /orf_name="An14g04450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42007.1"
FT                   /db_xref="UniParc:UPI0000EFC90A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3I9"
FT                   /transl_table=1
FT                   /translation="MDIVSLVHHYGARAHTELNSPFLPPRESFSALRKPDNPRVLVFSA
FT                   GHTAESEYYSRSGVESLHKRSAGADAVGFRAFVPREVAYMQAPLWRRKARGFRPVVPRR
FT                   QGLLLSTGRWAPGARLRLRLTRQTSSGERLSRKWSKAVLLDLQCTSSLVAGKRKIRGAL
FT                   PQPRLYQKESCTHDVTVNETQARTVESSCHYSSEPDGLAALNTVADDQRVDSDETHFHP
FT                   LKATLYPSVDDTLAKLTRIDLPAPATEDVMASGQQLEQSRVPGRGRHFLYGLLAALIYG
FT                   QVYALRVWFAVGIPSEKARKAQFTSRAEGVRAVCTLYGFPGLIVN"
FT   CDS_pept        join(1070436..1070477,1070548..1070652)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114081"
FT                   /orf_name="An14g04460"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK42008.1"
FT                   /db_xref="UniParc:UPI0000EFC90B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J0"
FT                   /transl_table=1
FT                   /translation="MAEGQVPDWAISEAAAYENWTQVGPSGSALMAGPWIFLQYASSGI
FT                   QGQ"
FT   CDS_pept        join(1070720..1070801,1070903..1071087,1071123..1071373,
FT                   1071472..1071541)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657184"
FT                   /orf_name="An14g04470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42009.1"
FT                   /db_xref="UniParc:UPI0000EFC90C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J1"
FT                   /transl_table=1
FT                   /translation="MLGRGRLDKSADRMYDVKDVLPANTRRAGHESGGRVVVENHGRER
FT                   VVTPAGRADRQTLITIDFMTVPYGKPSLCAFYGMQLGDEASGIGVGRMHTSLSGVLPRQ
FT                   LTGSNGLTSSCCVLMTLDRPEFDLPSYPPVRNKLHGPTHPALHACALLHVIALLAVMTF
FT                   RCSRCRQSYQSRGHPHTVLISPRSLKPRGRSS"
FT   CDS_pept        join(1071594..1071779,1071847..1071984,1072179..1072313)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114082"
FT                   /orf_name="An14g04480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42010.1"
FT                   /db_xref="InterPro:IPR012589"
FT                   /db_xref="UniParc:UPI0000EFC90D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J2"
FT                   /transl_table=1
FT                   /translation="MAAIDLLALEARHQVIKRSNWAGENPGVVLVFCIVFIVAVGIIAL
FT                   FIYRKCMARKAAKQSYEDGGYKFGLATSLQRSIRTFFLSLCAFCPSVEDTRSGFWWIWA
FT                   LTDRYYERAATARMGHFRMGPAIAPMMGLQVVQMATDLVFGWIVISTD"
FT   CDS_pept        1072468..1073157
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000158681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657185"
FT                   /orf_name="An14g04490"
FT                   /product="Similarity to hypothetical protein AF1318 -
FT                   Archaeoglobus fulgidus"
FT                   /protein_id="CAK42011.1"
FT                   /db_xref="HOGENOM:HBG327589"
FT                   /db_xref="UniParc:UPI0000EFC90E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J3"
FT                   /transl_table=1
FT                   /translation="MPSFLSVSSLVLAASLSTITYLTFLHRCLKNRIRHETHCGTLSSS
FT                   VSSTISTIPPEVYTPEYYALHDRASRRVPRQLLPRQKDAEILTILLRRNMTAFAHFPQC
FT                   YMLWLISPASKRPTFHTSYIDSLDFNKGDVVCGVYRVLDRTANKVEFGMTYKGVDGRLV
FT                   IRFWDEDKDVVFASETAMWTKVDETERATMPLENPVLRFFHELAAWWLLDSGVKYLTDL
FT                   DAELEDD"
FT   sig_peptide     1072468..1072518
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J3 "
FT   mat_peptide     1072519..1073154
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J3 "
FT   CDS_pept        1073431..1074543
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114083"
FT                   /orf_name="An14g04500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42012.1"
FT                   /db_xref="UniParc:UPI0000EFC90F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J4"
FT                   /transl_table=1
FT                   /translation="MCQYTFHNNPDCGHIANFTLDICVEMMNALREGTKNPPDHKVTTV
FT                   HDLLPKGPSYQCRPCEGKLSRVDTNCSECSDSEYVVLEGQNAGVPIVHSYMEMCLNEKN
FT                   TPPDGCDSFVHVNRQETPPSAPKPMSASQTLKMRDLASTEPEIHSPLNIMETLEGYEDF
FT                   LKKSNEQLRAHRLPSTPIRGPDSGNHEGIPVANQTWYESDSETEPDHVQSPRPLGSPFG
FT                   SPHRASRPKEAPLRVSDLNGPPPSQQPGYLKATPRLTKTGIQGEAAPVHRSNGTTTPPN
FT                   KHLYPTLLPCTPSHLIIPPSYSPPPAPRKTHRKNYTDYNPFDTPGLPFGREYRLPRHGV
FT                   MNTVLQSPPSQYPEVYNRSYSRQYWGPYMV"
FT   gap             1075079..1075178
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(1075253..1076095)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963073"
FT                   /orf_name="An14g04510"
FT                   /product="Similarity to essential protein #47 WO2003076464-
FT                   A2 - Aspergillus fumigatus"
FT                   /protein_id="CAK42013.1"
FT                   /db_xref="UniParc:UPI0000EFC910"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J5"
FT                   /transl_table=1
FT                   /translation="MPRHLSEILKVYPEDEPWCAGFAPSQGRRCHNPTNARNRRHASSL
FT                   LEQGTRLLRAGQSIEHILEDLAPLVLCTRNHQNQAVGLTNTWVSRVDTYVAKHRSTPRS
FT                   LPSKSTPRRSPSPTMRNETSMEDRLAELERKMQDAIRKAERAQREKERAERDAERTRRD
FT                   TENMVRRSAAMGYARGQEEARRRRSSPPPTVEIETTTVEHNEEYGVQRNSMSSGLLSSQ
FT                   RQDPRGGSVETTLQVNTSTSTNLQLRRSTIVSTTRVQRTSDAPATPAQAERHAATPEL"
FT   CDS_pept        join(1077008..1077021,1077101..1078499,1078621..1078787,
FT                   1078892..1079002,1079156..1079241,1079490..1079577,
FT                   1079695..1079827)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889526"
FT                   /orf_name="An14g04520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42014.1"
FT                   /db_xref="UniParc:UPI0000EFC911"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J6"
FT                   /transl_table=1
FT                   /translation="MEPNRPKRHLLSLPAEIRILIYKAVFDDNDVCEIQRRPIPVWCPV
FT                   DKCWHQVRRQFMADQTNRNSWDGFCSHPGCQTKQGQTVSRDIYVGHGPLIASGHYPCPQ
FT                   SLDRNPALSLGFLRTCRQVYEEARHFPYSRATFFTQELGSFANFTYCLKAWQVASIAHL
FT                   RIRIPLVQSVETHLAEWNETLSLISLAFYGLSTISVEVHFRYAEQTWRDTFWDGGLLEL
FT                   DRLKLKGMQLVIYEGERDPRQFFEYSAGTLASPKPNQKAATPNPISFHHARDTLRQRDQ
FT                   SRIDPNDTGRLFFRLSPNDFPLYVCNLIHLLPQRPRTEAEIRREDRHQRDYNYHYAYPE
FT                   DDPGHVNPIFGFQFSDALKENKDEIARGLDKLQRSRKRLQQQRAKSPLPLPYKPSRRGV
FT                   YPQSRRNSQEYQSDRSDMGEEVERPGDWRRRLVQEKFAPFMESFPLSATRKYPGPQSIC
FT                   LNCPGEATGDSEHQHQYSIVSLSPDLQPGPSSETGRQSVSSLVPEAPCLYSDVERYVML
FT                   WGKEEWGNFRGQSGNKLQQLRWREASGAAPFRASVVISPFLFVIPNRSRVEGGRLYWIG
FT                   ARKGSRWITTSSSPLRALRNFTPSPDWLLRSFKLDPRMGERQEYYYQVRKAFPCAATND
FT                   LNMTDSGDRPALCASPWKAVFSCFLVLTPG"
FT   CDS_pept        join(1079869..1080123,1080180..1080839)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000035269" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889527"
FT                   /orf_name="An14g04530"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK42015.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG672646"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC912"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J7"
FT                   /transl_table=1
FT                   /translation="MATTLLITGATGNQGGAVINALLAQDADVEILAVTRNPQSGTSQK
FT                   LAGKSPKIKLFQGDLDHPSEIFENAKKLATRPISGVFSVQNPMAKGQNVDKEEVQGKAL
FT                   VDESIKQDIRHFVYSSVDRGGDASTDNPTNIPHFISKHRIEHHLFEQTKDGAMTWTVLR
FT                   PVFFFENLVPSFIGKLSATAWDAYLQGKPLQCVAVSDIGVFAAKALLEPQNYKNQCISL
FT                   AGDDLTFEHMQKLFKAKTGETMPTTYRVVCYVLMWMVTDLRLMFNWFYSHGYGADIQGL
FT                   RKIHPGLKNFEAWLEEDSEWVKH"
FT   CDS_pept        join(1081145..1081330,1081517..1081756)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657186"
FT                   /orf_name="An14g04540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42016.1"
FT                   /db_xref="UniParc:UPI0000EFC913"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J8"
FT                   /transl_table=1
FT                   /translation="MSHVVSMLSSGLLISLPPLSSSSSFLYLIPICIQLPSFTSSITFI
FT                   YIHLYHLLYTYSVSIYSSLCSSLYRLVPRAYMRMDVRISCGQKGGCRIKNTAIRLCTQM
FT                   GRLRNHCSGSLMGNPSLMDSSRRFPPSHGVGVYFMDD"
FT   sig_peptide     1081145..1081210
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J8 "
FT   mat_peptide     join(1081211..1081330,1081517..1081753)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J8 "
FT   CDS_pept        join(1083266..1083373,1083461..1083517,1083749..1083808)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889528"
FT                   /orf_name="An14g04550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42017.1"
FT                   /db_xref="UniParc:UPI0000EFC914"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3J9"
FT                   /transl_table=1
FT                   /translation="MKSPSSYCVDTASLNPHDGHDVKNSLGKSVVHISTYAALTASSGA
FT                   STAYMALELEFHDEAVFDVITVGMPRVAI"
FT   CDS_pept        join(complement(1085904..1086169),
FT                   complement(1084901..1085822),complement(1084179..1084835))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177060" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963074"
FT                   /orf_name="An14g04560"
FT                   /product="Similarity to hypothetical protein B15I20.30 -
FT                   Neurospora crassa"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK42018.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG327596"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000EFC915"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K0"
FT                   /transl_table=1
FT                   /translation="MTPSRDKPDSAIDKRDFDAHRPLLDDADAEADEQQRGHLRSRPQS
FT                   CLSATNNDDGLLNDVVDEILERDRKKMAKEVVRVSSFAWGVISCLGAGSITAFSLYGPL
FT                   LLTRLHYTQLRVNAVAIAAEVSMYLPVPLFGYLCDRYSPSPLALFSGFVFGAGYLLAAL
FT                   AFKSGPPPDAGGDGWPFWVMIVAFIAIGVATSCMYLAAVATCAKNFGRGKHKGIMLAVP
FT                   IAGFGLSGMWQSQVGTYFLCDRLEDGTRGDVNVYKYFLFLAILLFCVGVIGTFALRIVD
FT                   ENEDKYIDEAVEELERSGLLEESEFFRPRNDDRTAYGTFSQAEDGTGSDGDQTLTLSEE
FT                   EREAARLEKEREEEERRKKNWLLNYETRIFLQDKSMWWLAIGFFLVTGPGEAYINNLGT
FT                   IVQSLTPVSNITNASSPAGLPSTHVSTIALTSTIARLLTGSLSDLFAPPATHLFPGPSS
FT                   RPASITSDTNRTTFTRLAFLLPSAFLLSIGYLLLSSPILLYHPGFTHLTTALIGLGYGS
FT                   AFSLVPIIISVVWGVENFATNWGIVAMVPAAGAAVWGLVYSQGYQDAMDDGNGTNDGQC
FT                   HGWRCFGFWAVGCTVSVWIAIGAWLIAWRYWRRRGVVV"
FT   CDS_pept        complement(1086400..1086684)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114084"
FT                   /orf_name="An14g04570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42019.1"
FT                   /db_xref="UniParc:UPI0000EFC916"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K1"
FT                   /transl_table=1
FT                   /translation="MTVLHCMCAAQGLQASNHVRAAISGVVIASRLYYLIAAWLIASSV
FT                   SQSVGQQPISAFPSPHASQGFAGFQSRCLGGLIRCAEGLWFFFPSLISC"
FT   mat_peptide     complement(1086403..1086639)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K1 "
FT   sig_peptide     complement(1086640..1086684)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K1 "
FT   CDS_pept        join(1087024..1087074,1087187..1087378)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889529"
FT                   /orf_name="An14g04580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42020.1"
FT                   /db_xref="UniParc:UPI0000EFC917"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K2"
FT                   /transl_table=1
FT                   /translation="MQRPSIMHPAWIVKVSVRGYSAGPDRWTGPKPAVFLWYASFDATC
FT                   RECKKNLPCRHWGQSSPDNSGSKARESRRGRRWQE"
FT   CDS_pept        join(complement(1089448..1090754),
FT                   complement(1087436..1089302))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114085"
FT                   /orf_name="An14g04590"
FT                   /function="inositol trisphosphate 3-kinase activity "
FT                   /protein_id="CAK42021.1"
FT                   /db_xref="GO:0008440"
FT                   /db_xref="HOGENOM:HBG327599"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="UniParc:UPI0000EFC918"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K3"
FT                   /transl_table=1
FT                   /translation="MKPERSSSRGRRGRVEQSIEANLANAEPTSHVRSRKSSHYLGLFK
FT                   ENTTSPDRKRKEERVSRLDELPEPHDKQQLTTHSEPRYSGERRDSQLHIPSVSEDTGLT
FT                   GSKSLSHLSIADAPLFTPGTEGETGPQMSTDNVVKSQPKALPRSLLEEIRNFHLTPGGG
FT                   HGTSFSRSIPTQYAERNRDYFSKAPELHGHVESRLSPSDAGREQRRGSGQFEEEEDEQI
FT                   SSAVYFPHERVTLSEEVDQVQPFTDGQDSVEPVDIPTAQSSHVLVPKRQVVPEEQEANH
FT                   VDISLRSKNDSRILHGDLQGRQDAPIDKLNEESLRSIPERPAEYSTESEPASADESGMS
FT                   VRDEESSVTDEAEVTPTATPTQRPRLTRPRHKQEPAGPLGAVELKPYRHQVGGHTTVFR
FT                   FSRRAVCKQLNNRENEFYERIERRHPEMLMFLPRYVYVNAMHSTNSAENDGPAAADARS
FT                   PTKNDTEPQRIFSQKQVTGIIPKVILENNRHIIPADLFSRGQRPRTADGSISATKRFPG
FT                   DFGQLRDDEAQSCLLDGSQTLKKKQWGATTVNRKLQEQVLREVFSPPAVHHHRRHARGH
FT                   LNLPRTSSDGIEIRRRANLSEDHTASSRRVVPEESDSTQSGAIDINRQAGDGPGLSSSA
FT                   STALDAGHNRLEKVRTEESPQRSSSLSRTRQVRRRRSGSGLQRRGSMTCGQPGGDLLFF
FT                   DDDGYGGDKEDGIFSMEGDNPVQPPSHPVTNASIPVAPKVLGADPVHLDGRMSSNVPSR
FT                   SPVPPNAKDVADAQLPSNPKEAQTRKDDRVQFFLLLEDLTAGMNKPCVLDLKMGTRQYG
FT                   IEANEKKRKSQRRKCQSTTSQQLGVRLCGMQSWNVKKREYSFEDKYFGRDLKSGREFQD
FT                   ALTRFLYDGASYRSVAKKIPAILEKLAKLENMIRRLKRYRLYASSLLILYDGDPLNLDK
FT                   APQNNGPSGSASMRDTLQRQVSDDGYSDVQLKIVDFANCVTGEDEISPNAPCPPQHPDD
FT                   IDRGYLRGLRTLRMYFQRILKQITEDDYVERGEGEAIALGSQHASRDDSSQRYWDENVL
FT                   ETDPGEVSF"
FT   CDS_pept        join(complement(1093685..1093885),
FT                   complement(1093458..1093601),complement(1093270..1093376),
FT                   complement(1093087..1093158),complement(1092745..1092921),
FT                   complement(1092559..1092652))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889530"
FT                   /orf_name="An14g04600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42022.1"
FT                   /db_xref="UniParc:UPI0000EFC919"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K4"
FT                   /transl_table=1
FT                   /translation="MDAIEDYYLPLGASFSPLDKEVPGVPEGFSKQDNHFPPHALLINH
FT                   LPIQTNRMGQMPQGRYLAGYLETSISGILRSRTPPGTKINSTSLVAIKATSSWIVASAR
FT                   SSNLQPFQGEMINFGISFQMQATIPIWVDPFDFYFHGLIFKQLFGCRAPVDGDLSRILR
FT                   PVQGISPRRARNTGCGMPDYQTQGVSSTGPSGHEFGNDLGHFHYKSRPEEKDPINDRGV
FT                   LTVRKTGEAFALVPVPWTWLRGGSSVAESSRKRVLCVKLGTQ"
FT   CDS_pept        join(complement(1094100..>1094252),
FT                   complement(1094000..1094041))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889531"
FT                   /orf_name="An14g04610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42023.1"
FT                   /db_xref="UniParc:UPI0000EFC91A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K5"
FT                   /transl_table=1
FT                   /translation="GQKVETAWYYYRENQEIASIADVERKETREMQTDQNEVVRTARNR
FT                   QGWSFAGTVANGQQADHVD"
FT   gap             1094263..1094362
FT                   /estimated_length="unknown"
FT   CDS_pept        1096275..1097798
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809860"
FT                   /orf_name="An14g04620"
FT                   /product="Similarity to hypothetical protein EAA35125.1 -
FT                   Neurospora crassa"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAK42024.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI0000EFC5F0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K6"
FT                   /transl_table=1
FT                   /translation="MASSSIVPIQVGQVAERQCAKASNPRSPSGEHHPFTMPSKGITVY
FT                   SYIGVPGYEVGFAVPQQEVLHDVTHNFTSRQLEIDSSHIQGLGNFTGRFEWTVFRYGER
FT                   VAGAHNDVSSLTGKIEGGTMVATQDFHPVVTEDTIITYGFYAAGHGEVGLTDRHQCYVT
FT                   ICSRENREWMGSVAPPGSPAAQQPFSRFVLAAPHDNGMNGMTACEAIFQHLDSDMLAAV
FT                   RRLVPQLEHVNHVPDHFLMKKLPHIVYGLSITQKKTVSTMLAMGARYFEFRPAKLLPMF
FT                   QKVSALRDTFYFQHACIPGLAFDEFLREQVAFLDENQTEIVTVHIRWDNVVADCQRPTE
FT                   DEISNLLNEACARAVRGPITWGTRECFEQPIEELRRTGTRLIVVIEADKYDSWTAEAYA
FT                   TLSADPIIDRFESMTTEGQADSDLTILQCQATSQSIKEVLVYSVFSAAAASSCLTSTKG
FT                   MLDMQTLPWIRENALDRLRAERTIVLMNDFIDGATVDTSIMLSRQRLSL"
FT   CDS_pept        join(complement(1101113..1101119),
FT                   complement(1100580..1100899),complement(1099780..1100484))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114086"
FT                   /orf_name="An14g04630"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g07840 - Aspergillus niger"
FT                   /protein_id="CAK42025.1"
FT                   /db_xref="UniParc:UPI0000EFC5F1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K7"
FT                   /transl_table=1
FT                   /translation="MACNSGSPFKHNVYISGPKYPDGSGSRVLSEVNSSQAREYYHAYY
FT                   FSYIENENDNKPFEKTKLQHPGKMFGVYIGRLKFMAQALDKAGINNVLWGDAVKSLLIH
FT                   PEIPKRIDYIVSDGMTGKACQALLADGLEACKRGEQCMVKQPWNGPVAAAHAHLCSSGI
FT                   GEIDLPVVFWDKSSLLFAFPDLPSSPLSSDDPYYMPIRIPRTHYDPTARCPPLDLVPAR
FT                   MIRPVKTVEALIWLMCRDRTPNGQLERGWEDEWVKALEFWLQEATRLAEKGLFALDELR
FT                   PDFAPLWYFFCNGEVSRTSKQYRACYLRLQEKLRAENALPLTPQMRNEKSQAVHLKWSM
FT                   KKV"
FT   CDS_pept        join(1103629..1104406,1104470..1104705)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177083" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657187"
FT                   /orf_name="An14g04640"
FT                   /product="Similarity to hypothetical protein EAA58284.1 -
FT                   Aspergillus nidulans"
FT                   /protein_id="CAK42026.1"
FT                   /db_xref="HOGENOM:HBG327603"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="UniParc:UPI0000EFC5F2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K8"
FT                   /transl_table=1
FT                   /translation="MNRQLQLNTSNLGSNPRYSYMETPLEMHAPGSRLRDEITPPAATT
FT                   NTQSTESQTVMEHFQPPVNEKSQQYQQDMAVQGYPCGPNLEQHPANYAPYADEIQQVQQ
FT                   NPKVPEYSYAQPPQSPGPLPVKKDLEMSEPLPNKQPMAVVPDTNPLHSPQLPQFPPPVA
FT                   HGAPATPAGFDLMAYHRPGQITHPDLEIKGGSWRTSMCGCYDVGSCCLGLLCPCILFGK
FT                   TQYRLSMKSRSEDPTNMLGYETCNSSCTAMALACGCQCFLATFQRRRTRKAYKIEGDIV
FT                   SDCVRATCCTCCTLIQNEVEIKKREEERGRYASATGAALVSPYLPPTQMSYGPPPR"
FT   CDS_pept        join(1105690..1105798,1105892..1108089)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889532"
FT                   /orf_name="An14g04650"
FT                   /protein_id="CAK42027.1"
FT                   /db_xref="HOGENOM:HBG327605"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniParc:UPI0000EFC5F3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3K9"
FT                   /transl_table=1
FT                   /translation="MGEPAHLTPRQIWAQPTTTTTRTYEADCTPFLLPSSGYVYLNRSY
FT                   SIALTENAIYDPICTGTGTATATAHAVAALDVTDPFYSSVTPALYAMGCTTVVSYLLVI
FT                   ILLITPRTFYVGGPGGGANFLGRHGMISGSYSGNSSVVGVGGRPWLQKVAALLVAVSLT
FT                   IATVDSFRVAEQQYYYGYSDAEALADEVIDGMEIRVVRIISSTFLWLAQIQTLIRLFPR
FT                   HKEKIMIKWAGFALIVFDTTFSILDKFLVKTDTVHPRLYEDAIPALSYLFELALNLLYA
FT                   AWVIFYSLSKHRFAFFHPKMRNICLVALLSLCAILIPVVFFVLDIAKPKIAGWGTYVRW
FT                   VGSAAASVVVWEWVERIEALERDERKDGILGREIFDGDEMLEVTPSEEVDWPRYNPDGH
FT                   DRGGGGGTSSGWGGMMGLAHRPLRTRVGRNWQSNLENQQHNIPMDPRRRRMAPRPTPPP
FT                   AAITPVSRADTTSAASTVYNIHYHPVSSPTPPVAMPHMEEEDEDIDETVAAKEMTTEGQ
FT                   QAGLAHDVLAQQQTREQSPQIVHVDKRWRALLNPFKRRRASLPREVASAQAEEEGNPAG
FT                   AQVELQRHSLDDSDDEHSLQHRHDFRFGFHRRLRPGSGRQGSDSPLPVTVIPARRRGQQ
FT                   TWSPQQYHEPSSRTTTSNQRVPPGRDDLPVRVIQPQTRTAAPWSAADGQGFSHGNYELR
FT                   YDPEAAALVEPGENCTESQPALDADGSVSEPTRGPAGRQQPEQEFDPMEGAPLSPAQPF
FT                   PDEVPEDSRGSHGQQ"
FT   CDS_pept        join(1108944..1108947,1109006..1109136,1109196..1109918)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217256" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114087"
FT                   /orf_name="An14g04660"
FT                   /product="Similarity to hypothetical conserved protein
FT                   PA2839 - Pseudomonas aeruginosa"
FT                   /function="ferrous iron binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /protein_id="CAK42028.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008198"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG325197"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniParc:UPI0000EFC5F4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L0"
FT                   /transl_table=1
FT                   /translation="MGLTPVHFFSHGSTMMLGEESTSADYWRRCGDEALVQGIKGVVIM
FT                   GAHWACHGDGIEVATNPNPGKSPVAYVHPSKYVDYKLNPDLPTAHRCISLLSQAGFKAT
FT                   GNDTFEWIHDVYLILIRMFPNACPPTTIISSNARYDPHYHMKVGSTLRQLRRENYLIIG
FT                   TGGAVHNLYRNRWAPMLRFRDNFAMETPPEDWALEFRQAVEDVMVKCPGGPKMRRAMTR
FT                   LMKHPEYRDAHATDDHFMAALFVAGAVGEWEDEGSKVVLGAETWELTNMCNSQFTIGEW
FT                   SKLG"
FT   CDS_pept        join(1110806..1110916,1110986..1112749)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657188"
FT                   /orf_name="An14g04670"
FT                   /product="Putative sequencing error "
FT                   /protein_id="CAK42029.1"
FT                   /db_xref="HOGENOM:HBG327606"
FT                   /db_xref="UniParc:UPI0000EFC5F5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L1"
FT                   /transl_table=1
FT                   /translation="MAAVNRNMFEASVTTDRPQGAPLMILPLNLIAVIVSYVDDPGDLA
FT                   RLCRACRVLNYMALPQLYKHITLTSYDKIRYRDDEPEGMGSASPFSMGLNAIITRPYAT
FT                   LVRSLTLRGNWRELELEEHARVGRVPDSSMMLNIAVRAAVDRMTELESFSWELNTKMLE
FT                   TVYLGLAQLPKLTALTIRFPSSRHPRPTIVIPPMPHLRYLKVTDIDPLCYPDDISTLVF
FT                   RCRKLRELNLHWSPRMRNAQEPSVMVHDYFRKCIAAKQPLSIKKIGLQNLYALHTEDFG
FT                   LGVDSATVEDVTILQHGGADLSMNTFVDSTWPTTPAHPIRIKAIRQDAVSKKHAQFLNQ
FT                   FTGLERLYFVNATLNPNDDINSPRPLTSSAALSPPSSDTSQPATNGTSTSCSAAASNSP
FT                   SLQASIRDLYLNNITMNHAATLRHLLLPARWPLSAPTVARLVHASPQLEQLGFATEFSD
FT                   LEALGLLLPFLRNLKALRLLIPTCPSPXETARAGPLPKTFKYFSPSANALTSARTLSDL
FT                   VEADDDTLIARLSESLADQQVFHRLKVIGLGRKGFQLGDYYTVPAEQAENYGHVQLQTP
FT                   TGSRATSAEANVGYDKSPPAGGPSPTANGHNAMVPSQRNGHLPPFSTG"
FT   CDS_pept        join(1114490..1115011,1115138..1116327,1116522..1117776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809861"
FT                   /orf_name="An14g04680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42030.1"
FT                   /db_xref="UniParc:UPI0000EFC5F6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L2"
FT                   /transl_table=1
FT                   /translation="MLVSVVHLVVALRNIDHTGSESCPITQKKRVDTASLWRTSTNTAL
FT                   SISIASTAKGTITSSPARNLRAGDAKLKDIIKLSVQIRQNVRCYAEESTCTPYRSADAL
FT                   NIGLSPVPDRSKQHGIFSTTSKRLISTSELKSFKRQKTSGHYSLVNLNISVQSPEHSEK
FT                   RWFAIDENVRNKLLPGSSSPHCNYPEIINEHGGADTVAEYLIQLINPHIIQFQGHEVTN
FT                   AALNTIVALQIDNDEPWNMPSGYASLICDDRDPLWWRLYVGQCSLSWRRIVCQHAQQIM
FT                   NNSTASLYYFNLWIGNGHRYARFIKLWSFPKDTVNDTWYQACSNLLEALFCKAFRTHHG
FT                   MLNRLGSEHQDDGKASSSGLGWGLNIMSPLVQGNTALNKELRTKANAGPSKAPDRQIQH
FT                   WAVFNSRQKSAAGKQREVGGKGSNRAVFQRDFDKALRLALHNDEGAFEEVKESLQLQQK
FT                   EPDLSEDLAYIPFCGSLTSEVAAILDYAAVSGADDMPMRASNNDDNRQTLTIPWSLDGC
FT                   GFTENNILVWTYDFRDFASIGLKHLGHDITDRSRCQKISRNFARNQPSQDRFLIFAVNF
FT                   IPSLKHEIRPFFCENSSVVGYILRQARKERLGGEALTADTVDEGVRLWLARRNMGKAED
FT                   IKEIEKIGGSLTRGLLMVLKFLPRRPKSDENKPKERCSQPSGRITERVRVHKPFDMQQY
FT                   QKMGDFVHKRLDERETDYRNQLSQLRAETPWPQGEGSLSTGPEQGGSDVPSTDLESIVA
FT                   LRSFSRLQGQEPQAGAEEMQKLVEQCQAEAEDRDYETPTSILQGLTARVIDEGFLDSVD
FT                   ATAEQPVIAETGDKKRQGVKSVVWKNEGVQNTEYSYNLKDQLRRHIFIYYCEILFPDDM
FT                   DIMDGKVFVKLELCPRGETHTSLYATSSSEAHDDPALRLAFRIRYTDSFGREVVYYATN
FT                   SAMGMVFKANTFVEVLEKKSLEEISQSPRRFIHIGNENTAHPLLERFRRGAHTSPLPR"
FT   tRNA            complement(1118040..1118166)
FT                   /gene_name="tRNA-Ala (TGC)"
FT   tRNA            complement(1118455..1118582)
FT                   /gene_name="tRNA-Ala (TGC)"
FT   CDS_pept        join(complement(1120442..1120761),
FT                   complement(1120113..1120390),complement(1119812..1120060),
FT                   complement(1119415..1119752))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114088"
FT                   /gene_name="pepA"
FT                   /orf_name="An14g04710"
FT                   /product="Aspartic proteinase aspergillopepsin I pepA-
FT                   Aspergillus niger"
FT                   /EC_number="3.4.23.18"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK42031.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG323988"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000004F5FB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L3"
FT                   /transl_table=1
FT                   /translation="MVVFSKTAALVLGLSSAVSAAPAPTRKGFTINQIARPANKTRTIN
FT                   LPGMYARSLAKFGGTVPQSVKEAASKGSAVTTPQNNDEEYLTPVTVGKSTLHLDFDTGS
FT                   ADLWVFSDELPSSEQTGHDLYTPSSSATKLSGYTWDISYGDGSSASGDVYRDTVTVGGV
FT                   TTNKQAVEAASKISSEFVQNTANDGLLGLAFSSINTVQPKAQTTFFDTVKSQLDSPLFA
FT                   VQLKHDAPGVYDFGYIDDSKYTGSITYTDADSSQGYWGFSTDGYSIGDGSSSSSGFSAI
FT                   ADTGTTLILLDDEIVSAYYEQVSGAQESEEAGGYVFSCSTNPPDFTVVIGDYKAVVPGK
FT                   YINYAPISTGSSTCFGGIQSNSGLGLSILGDVFLKSQYVVFNSEGPKLGFAAQA"
FT   mat_peptide     join(complement(1120442..1120701),
FT                   complement(1120113..1120390),complement(1119812..1120060),
FT                   complement(1119418..1119752))
FT                   /product="aspartic proteinase aspergillopepsin I pepA-
FT                   Aspergillus niger"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L3 "
FT   sig_peptide     complement(1120702..1120761)
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L3 "
FT   CDS_pept        join(complement(1125109..1125313),
FT                   complement(1123913..1125010),complement(1123108..1123869),
FT                   complement(1122669..1122967),complement(1121855..1122616))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177127" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963075"
FT                   /orf_name="An14g04720"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42032.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG327608"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EFC5F7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L4"
FT                   /transl_table=1
FT                   /translation="MAAPASNGQHHHDAAVSASQSLYSHDPRAPKSPSPQLQQQLQSQQ
FT                   PQHRRGYQACDPCRKRKVKCDLGSVDNPRPPPCVRCRRESKRCEFSATRRKRKPSEVEE
FT                   PTEAVLRRDKRMMVGEVISNSGSVSDGGSSYAPERTSSFDNSTSLSRPKWTEESPAANN
FT                   AQLPSSSTPSQRFPSNPSPSGNAPFAEPRSTRLPMYPAAERSHAASFSLEGGQPMMNRT
FT                   AVELLSPAISNSHDALHLLSEAAGRTEDLNRQSLENRYAARQSVSSFNSPMSPLTQAGT
FT                   PRSGGGSFSRPPRSGTVPGGTYYSAGASGSADARLPDGRGPADAAETAQDPGFVDAVKA
FT                   WSRLRFVRAGWLSVEESMAYVAYYYEHLAPLSPIVIPDFSHPSTHRTLLTDEPVLAVTI
FT                   LTTASRHMKPKGDGAYTRAFYIHDRLWSYLRGMIERISGPRSFDLAPTSSKVSHKGNLR
FT                   SLGTIEALLILTDWHPRNLHFPPGDDENALLDLDAQTQSRYEKELETEVDNSANRVPNS
FT                   AAEGRLAFQKWLEPAWRSDRMSWMLLSTAQALAFELGVFDQKSDAKVAGESPSEQTRKR
FT                   RLRRLILVYITQSSGRLGIPSMLPLPQWTNDIQPTSATAAKGADTIVDRMHDCWIGISK
FT                   IMYQSNQLLFASSEQTSELIRSGRYRDQIDRFQPFLREWRHNIDTIDCECSLTGLYVNS
FT                   LALQAVVDRWTTMSNEAAQAQNARPNSGPSSGTGWFHVLMELYRVNEQYIQEVVDASRK
FT                   ILQTVLEILVPRDHLKHAPVRTCFRILSGMIFILKTFTLGAKEDDVRVSLDLQDRTIEA
FT                   LKTCVVDDVHLNHAIARLLELLTTSIRTRFLRFAPLDRSGDGEQERPSAPVSRHQSPRP
FT                   REGPQNRREGSAHAWTPAQSATQNLGYVDSNSQTGTSMTSVHDPLAGIPAQPINSSNIN
FT                   VSFMPPPPSVYYNYYDPSATPPAGELDGSNVPSQAMHDNPGTSGGLPDWFALPLDQFFN
FT                   SSTAVVDQGLGGTGPMVGEFDMLEVLLNEQYDGHEGIESAGGGNLPSQFLQS"
FT   CDS_pept        join(complement(1128299..1128361),
FT                   complement(1126427..1128184))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177140" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963076"
FT                   /orf_name="An14g04730"
FT                   /protein_id="CAK42033.1"
FT                   /db_xref="HOGENOM:HBG327609"
FT                   /db_xref="UniParc:UPI0000EFC5F8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L5"
FT                   /transl_table=1
FT                   /translation="MALPATAWGFADNDDDTGSRRGLSVRNLVVSPPSRPRGKTIDDDN
FT                   IPNSLHTPLKALAEDAAKPLHQSRSFTDLKSTPASSAEGRPRKEQPPPLRQWQRRNTLP
FT                   WNGPNPRARQVKLEEITSSRMADTWFSIHCDGVDEPVYVSEVVEHATNPSFRSFDLNIC
FT                   GPAIARRDQVTVKVWARTAAMEEYLLLVELQLCLQSLQFLGKSLDNFHQPLPPNSILFH
FT                   FADGVYTNLTDLPPVVTPVPSRHPRSADGATLPTSSYDALMRLANLDECIQDALTTRDK
FT                   LEAQISLILEENQRALTTTSNASRARDKLALTKHAVATERKQLRSATKRKEELLASLQA
FT                   RREAMERGRQTQARARSHLPDAQEKLGSSVKLLEQNTDEGRGQIRRMSEDLLAIYPIEP
FT                   IPDKPLAFTIAGMALPNSNFTDVDRDGVAAALGYTAHLVYLLSFYLSIPLPYPINPYLS
FT                   HSLIQDPVSASLPQRTYPLYPVNVQYRFEYGVFLLNKDIEFLLNKQGLRVLDIRHTLPN
FT                   LKYLLYVLTAGTTDIPARKAGGIRGLLPGRLTPSLSRRGSEASSTNGETVFPRKGVSSV
FT                   ISANGEAIAPDKGKRAMASTSLADAAPSVA"
FT   CDS_pept        join(1128856..1129134,1129241..1130014)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177151" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114089"
FT                   /orf_name="An14g04740"
FT                   /product="Similarity to hypothetical protein SPBC18H10.17c
FT                   - Schizosaccharomyces pombe"
FT                   /protein_id="CAK42034.1"
FT                   /db_xref="HOGENOM:HBG327610"
FT                   /db_xref="UniParc:UPI0000EFC5F9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L6"
FT                   /transl_table=1
FT                   /translation="MASQQVTKTPFQKILDPTKIGTWNIVRRPPVENHSIIQGKPREQN
FT                   SNAFKTHQAKEGTRLRKALKALTHGKNIFAYHNIRTNQVVYSLTRYLENNTTLKQLLYH
FT                   GKKTVPARLRKDMWVPYFSVHFNDSKIGLRAYHLLREFSMQRQLSPPKEMITITDAWID
FT                   QKRPRDPKGAEDFLEKYKDKIGRIMPKHHRKRAVMDQKATSVADIAAVLKIQEEEVQNG
FT                   FANGKRGYLTPTARKRRRAARAKEEQVAAEQAARVAGLEQALSSEVVEYKVQETADTTG
FT                   ALEDQGVKILWRDLHDARFAEAWPERVRHGELELSRDHVMPGQKGVRSEVLAEGEFRER
FT                   TEQQQQGEKN"
FT   CDS_pept        join(complement(1131277..1131397),
FT                   complement(1131045..1131193),complement(1130839..1130942),
FT                   complement(1130366..1130765),complement(1130171..1130254))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19809862"
FT                   /orf_name="An14g04750"
FT                   /product="Similarity to hypothetical protein AAM35689.1 -
FT                   Xanthomonas axonopodis"
FT                   /protein_id="CAK42035.1"
FT                   /db_xref="HOGENOM:HBG406836"
FT                   /db_xref="UniParc:UPI0000EFC5FA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L7"
FT                   /transl_table=1
FT                   /translation="MTTYQFHDVTKSVTDIDRRKCRREVPMQVLALGLCRTGTDWYNDT
FT                   YHGYAAVLENPRDCEMWHAALSAKYEGKGRPFGREEFDQILGHCQAVSDFPAACFADEL
FT                   IQAYPEAKVILTVRDVDDWHRSVSKSFTPLLTHPLLPLSTILETLLLSRTRWIRPTWQK
FT                   IWKYYFNDDFDANGRKAFEAHNSHVKDIVPAENLLVYNVKDGWEPLCEFLGKTVPLDGK
FT                   GDVVPFPRGNDPGIFRNRFRDAIWYNFLELGERVLKLGMVKGSYMASRDQCSVICSNAI
FT                   ASFL"
FT   CDS_pept        join(1132902..1133035,1133101..1134361)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15889533"
FT                   /orf_name="An14g04760"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK42036.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC62D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R3L8"
FT                   /transl_table=1
FT                   /translation="MLDYYQGKTIFITGGSGFLGTALVHRIATSVEFKHIYLLQRGGQT
FT                   GLSAKWHQCLRFNTAQWLLEHPQITILDGDMMKPSLGLDNDETEMLKQNVNIIIHAASS
FT                   INLAQRLQKLWPSVIRATEYAVELGLQCGKLERFVYVSTAYSNTHLCSLFPNRDVEVEE
FT                   RIIPLEQMPPNNGNSTVAEEYSELQSRGSTKEYESNDFPWGYGYAKHLSERLVTDKFTR
FT                   HGKYDRLLIVRPSVIGPAESMPYPGYAVPTSAPMTMVAAVFVNHPAFSLELSSRLDNPE
FT                   SDSNLDEVPVDVVVDRLLAHLAYQTQGCVHAVSGRKARLSFKEVEAAVYQVRWLPWHFR
FT                   VKWLKNDGWNTKSDAISRLYKLFGTSFDFHEEKTEQLVSKLSGEERRTLQLFNTRKVGA
FT                   WELMSRSKQMYDCSTIFATKIAYPYRALYRLLWLIWWVYVKLIVAWAAFDLQTVRRQLF
FT                   ADRKAL"
FT   CDS_pept        complement(1134623..1134823)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657189"
FT                   /orf_name="An14g04765"
FT                   /product="Putative uncharacteriz