(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_12

ID   ASPNC_12; SV 1; linear; genomic DNA; GRV; FUN; 2132688 BP.
XX
AC   AM270995_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Aspergillus niger (strain CBS 513.88 / FGSC A1513) chromosome 5R,
DE   complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus niger (strain CBS 513.88 / FGSC A1513)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Aspergillus.
XX
RN   [1]
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A.E., van den Berg M., Breestraat S., Caddick M.
RA   X., Contreras R., Cornell M., Coutinho P.M., Danchin E.G.J., Debets A.J.
RA   M., Dekker P., van Dijck P.W.M., van Dijk A., Dijkhuizen L., Driessen A.J.
RA   M., d'Enfert C., Geysens S., Goosen C., Groot G.S.P., de Groot P.W.J.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.T.W.,
RA   van den Hondel C.A.M.J.J., van der Heijden R.T.J.M., van der Kaaij R.M.,
RA   Klis F.M., Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X., van
RA   der Maarel M.J.E.C., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N.M.E., Ram A.F.J., Rinas
RA   U., Roubos J.A., Sagt C.M.J., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J.J., Wedler H., Woesten H.A.B., Zeng
RA   A.-P., van Ooyen A.J.J., Visser J., Stam H.
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88.";
RL   Nat. Biotechnol. 25:221-231(2007).
XX
CC   This Genome Reviews entry was created from entry AM270995.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2132688
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88 = FGSC A1513"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 5R"
FT                   /db_xref="taxon:425011"
FT   CDS_pept        complement(609..1760)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116403"
FT                   /orf_name="An16g00010"
FT                   /EC_number="1.1.1.1"
FT                   /function="alcohol dehydrogenase (NAD) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42681.1"
FT                   /db_xref="GO:0004022"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniParc:UPI0000EFCBCC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6H3"
FT                   /transl_table=1
FT                   /translation="MDTVSSTTATYVYIGSFVMPQPGKHEGLHVFRVDNGTGALTLVAS
FT                   YVPGLNVGSFAIDYKRGMLYVTDEVPNGGQIYAFSMDPSTGGLTERGHWPSYGTQPSGI
FT                   ALVDTEDMVIVSHFTSRTGITTIAGDAQSGYHIECRYDDATTVLFTLDATGCSDQPSHV
FT                   HFHTTSGHQSKPSCLHSVSLSPDGSFLIECDMEKDQLVTMTIDYGLHSLHLQGIRDVPH
FT                   GSGPRYSAFHPTLPVFYVNFEYRPVIEAFLYRVGGDYESLGTVDVLPENLNGGSGVLLS
FT                   DLRVHPTGKYVYTLVRGHNVVSAFAVDEVSGRLRRIQTANINGISPKGCTFSPDGRFFY
FT                   VAVSVSNEVQVWAVDANGILVPTQETAAVPRPSAITMVELTPP"
FT   CDS_pept        join(2211..2414,2474..2744,2796..2963,3025..3302,
FT                   3356..3706,3755..3949)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116404"
FT                   /orf_name="An16g00020"
FT                   /product="Function: Agt1p of S. cerevisiae is a high-
FT                   affinity"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK42682.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328361"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCBCD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6H4"
FT                   /transl_table=1
FT                   /translation="METNPPLNIKTDGRPNQHEAMLLERAHAANAADHALTWWKAIFKY
FT                   RKAVFWACIFSFTLTMQSADATSTTSFYGQTQFKERFGTVDNGVLEISAEWQTGIQQAM
FT                   AVGELIGLAVAGFMADRFGWKPILSGMMVWLTGSLFLFAFAQNLGMMVAAMVLCGIPWG
FT                   AFQTGCIAYSSEMVPTCLRPFVTAWIGICWGLGFFIGSLVNRGCLNLIGQWAWRVPFLV
FT                   QFVWPLPLLICFLLAPESPYYLVRRGRYEDARTTLRRIRQKDITDEEIEQSIALIDYTN
FT                   KMEVQIKDSSSYAECFRGKNRWRTEIVCIVQIAQTWGGNGINVQTVQFLEQAGLSEQGA
FT                   FDLNLILNSQYLTFGLFCIWLMTKFGRATIFTTGLILSDVFLFAIGILGCVEQSTAVSN
FT                   AVGSLLLVSTVIYISTVAPSSYTIIGEVPSGKLRAKMVSLARVAFNVSSLISNVLLPKM
FT                   LTGGSWNLGAKTAFMFVSVLTPDLSPADSR"
FT   CDS_pept        join(complement(6087..6523),complement(4793..5987))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000091866" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116405"
FT                   /orf_name="An16g00030"
FT                   /product="Catalytic activity: cholinesterase 2 "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK42683.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG716688"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI0000EFCBCE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6H5"
FT                   /transl_table=1
FT                   /translation="MTSSLPPVVVNGGLIEGKTSDVDASITLYLGIPYAAPPTGPRRFQ
FT                   PPQPVLPWDGVKQCHQIGPICPQAPPDPRWINVLQGHPQSEDCLYLNVFQPGEAHEKPY
FT                   PVFVWFHGGGFREGGSADPNFDGTALAKKGLIVVVPSFRLCNAESASGTSGMMGMLDAI
FT                   EVLRWVQSNIAAFGGNPNQVTIGGQSAGNAMCHTLLVSPLARNLLHGVILQSGPRSLQE
FT                   PAVANGPMSYRTLQQAEEDGVQLLRELGLQSIEELREFNDIDKLCELSTRRDHRCWGPP
FT                   PLFRLTLDGHVIPKPWHQMLAECPSNDVPILAGMNSEEGGTYNEPRFTYDDFVECVESR
FT                   FGPHSTYGQGDSKWVKRFHELYTPTDHETGKGPLDAWNRAARDNTRNNIALWAQEYHQK
FT                   TASPVYGYYFTHPIPPWNNWQPDYSQPKVPGFTNQKGPVTGAYHGAEFAYTFNSLTTNN
FT                   LRPWSNTDRIVGEKVSTLWANFVKHGNPNGPPGENKGPEGVACWPNLNDHPHTLLELGG
FT                   EWQTIRTTDPENEQFWTSYVRSQKAW"
FT   CDS_pept        join(6797..6800,6912..7040,7111..9091,9248..9329,
FT                   9405..9512,9591..9746,9812..9937)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659434"
FT                   /orf_name="An16g00040"
FT                   /product="Remark: the CZF1 gene"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42684.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCBF8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6H6"
FT                   /transl_table=1
FT                   /translation="MCERAVCQLPLVTLMQLNETSDPVSDTSVRVMPEPSQKRKRAKTG
FT                   CLTCRARKVKCDETRPRCNHCRNLGVECRWPEPATKRFCRISTPPSCNTQGPQSIATGG
FT                   PRLSACFPCRYARSKCSKDRPTCARCRSHGHECKYPEPQGSHALTSSAQSWMRRLQTAE
FT                   MGNSAELSRPEILTSLTSSPEPESAPTHPEITDDQRPEMPAGDASPPETSDRLDDVVSA
FT                   LCESQSSPTQAAAGAVVTLSPRRSFLPSQDSIERLAVAFFRHVHVYRANAFLHRDQTLM
FT                   AIRDGTFCVPVVLALCAVGARFTSPPQPDDVVISWATEAANWVTTATEVSRDHVVVALL
FT                   LAIYMQQAGRFAQSHLWSAIANTHAVSLGLHRESAPGTSSFVESERDRRLFFACYAISR
FT                   FISNGAPESIQCPASRIKLRLPCDGFNYRLDVSIETPYATLEADEPEPPGPNGMQRNVG
FT                   AMGFWVRLVSVRMKIKRYFHSMTEDREERHAHQQPSAIGTTLAPWGASSPFVVCLAQLA
FT                   SLSESLPPRLQLSPELVLRQHDAPVLGQIVMFYLWWNECHLELYSIALHGYPQSLDSTV
FT                   MSTAPAGWIDQARHNCLRHAQAITDILDLVDREMPRQPLTISDHTIAHVVYLSVRVQLE
FT                   LLMPTLKDSGMRLELKKRFDIMLGFVERTSKYFHQVSLVVSASPRFCCQVLRRRRKKPD
FT                   ALHAPAPRDAPLSQTASLPWFCRQKALDSRRAAEQAGISAAHFEANLAELLPDCIPLGT
FT                   MSWIRGYGVNDPCRLPETAESSWDILPNLWMGAPPTGQSTNNPVTAMSDFSSLGIFNTW
FT                   GRIDPNGTGSRFDPLLPSHSFAHPSATGTCGTSTVISSDAPFSLNPLNT"
FT   CDS_pept        join(10607..10901,10973..10994,11065..11203,11276..11363,
FT                   11424..11611,11665..11828,11904..12017,12258..12707,
FT                   12819..12940,13063..13292)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170863" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659435"
FT                   /orf_name="An16g00050"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK42685.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG328580"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCBF9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6H7"
FT                   /transl_table=1
FT                   /translation="MASDRKSTTVITAPGNCDSLGIHPHPSPTDYDVTVVLGPVASTYD
FT                   KSSSDENHADGDNHMQGRHSVTKGTGKELQTQTNLLPMKQLLVVFSGLSVAMLCSMLNQ
FT                   TIVATALPTLGAVFNQADIVSWVGTAYLLTCTACQPLYGRLTDIFGRKVILLGSLFLFL
FT                   IGSVISGVSRGMTMLIIARAVAGIGGGGIVTVVSIVVSDVVSLQDRGKYQGIIGIVVAA
FT                   GTALGPLIGGLFTEKISWRWCFYISVPLSGVAMVVVAFALPLRKVEGHALEKIKQIDGW
FT                   GCLISFSASIAILLPISWAGTQYSWTSAAVIAPLLLGVALIGVFLFVEFKVARLPLSSS
FT                   MFPSHTNIPPQLPQFYQVARGDSALRSGILILPLILSQIVTSFTSGFLVSKYSCYRINL
FT                   IVGYALWTIASGLFTMVTPSTSAAVLVVFQLLTGLGSGQTLQTTLVAIQAAVKREEMAV
FT                   ITGARNYLRMMGSTLAVAASAAIVNNIVRTKLEAINFPRSIISEIIADPTKIASMSLSA
FT                   AQKTDALNAYAHGVQVTYYMMTALAGIQFFLCVFFVKDYTLKRDDDQQKKEAARAWLMQ
FT                   KKNKRAGGNHNAEPSPAEARQHVEDKV"
FT   CDS_pept        join(complement(14850..14904),complement(14473..14789),
FT                   complement(14250..14401),complement(13782..14196))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659436"
FT                   /orf_name="An16g00060"
FT                   /protein_id="CAK42686.1"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="UniParc:UPI0000EFCBFA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6H8"
FT                   /transl_table=1
FT                   /translation="MTVADKSDEVYPPIPAYGGRWTPPKHLLDCYNHMWIDTDVWELPE
FT                   NVIYELYSQPTRGPGAQGSYLVVLPPGYDDRDVNGERYPVLYWLHGGFSCSRHAMWSLQ
FT                   FYARKMELGTMPKVILVAPQSLPKGRWINSYDGSRRLGDIMRHDLVTAIDERYRTIRHP
FT                   SARWLEGHSAGGYGAFNLGLKYPDVFGGALSSLAGSFRTELAKEGLEVTYDTYNGSQAF
FT                   FTSNHALTLLKAILPRVHRDKPELRLLIGGEDIRLREAHEHMWTSLDALGVPYMKAIVP
FT                   GAPHTAEHVLGGLNNEGLQFWWNARAKVIEA"
FT   CDS_pept        complement(15651..17036)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178051" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898759"
FT                   /orf_name="An16g00070"
FT                   /protein_id="CAK42687.1"
FT                   /db_xref="HOGENOM:HBG328732"
FT                   /db_xref="UniParc:UPI0000EFCBFB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6H9"
FT                   /transl_table=1
FT                   /translation="MATSRSFSGVLSLLLLFQLSSFVSAAPWIVTADYQEVVTTERHYY
FT                   ATYTTTLVEQITPTVTSMPEAVSTATSLGSSNYYYYYNDDEDAEKDVTIIQQLYPTGVG
FT                   SVVDDYDYGYGYGYDDDDIYHSTKFVVNMTYSAPTGCSSRWTQTTAVEVVPPTEVQDLL
FT                   PRTAVATSISVDSSRPFQPTTYTIDIVYVDPTQIPTSSLESMSLYNRPTSLYTASSCAY
FT                   TGSNGNGYYSGSSYYGDYGYDDDYNWFTDDYYVGISPLALTLILTLGWIGLWLILGFLE
FT                   AWIRFRRLMMGWQTRRGLPVCWSLTILPFTLLLLCFFRKGYRARTDADGEVLRKRWKAM
FT                   GFWTKLRLFFVWGFRYKYPPVLGPAPARVKTSKQPAKNPGPRLLEPSPSPSVAPQSRPG
FT                   SASAPTAAAAAAPASTSADPEMAIVSSTPVTHPQEATVPPPTTTTAPEAPSHHQDDEIS
FT                   RAN"
FT   mat_peptide     complement(15654..16961)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6H9 "
FT   sig_peptide     complement(16962..17036)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6H9 "
FT   CDS_pept        join(17443..17548,17625..17667,17820..17876,17965..18156,
FT                   18245..18396,18508..18685,18778..18787,18879..19020,
FT                   19096..19298,19365..19455,19539..19600)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812214"
FT                   /orf_name="An16g00080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42688.1"
FT                   /db_xref="UniParc:UPI0000EFCBFC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I0"
FT                   /transl_table=1
FT                   /translation="MDSDKSRVMFGRLPFAWQTLLGARTVSAVALDTRSSLPGWPLVPK
FT                   SLALSHEAMQIFHASRYAWSSACGPFAEGSSTIFPQYEWRNIRVNRVQTIACGLAILST
FT                   NPIEKTERQVEFAFRPSLQNIHGLNLRPMHLSKVKSPELVSIVARVFSKCSCHTTTDPV
FT                   TANPCTMSTIASMPAGHRAAGPHLTVVEVQIYFAVRDLRRHIRCHICLAGGSNCHSNPK
FT                   REFWADAEHSSNLECRYRYGMYNKWVDLIEFLNLHRENDGQVVVSGSHDYAVEDCKNKI
FT                   CFIPDDALSCFCVAYVIVRIILCDDGHSEMLSSYSPSLLQVIPTASVEHSALVLKLLSP
FT                   RMTVGNIIPAFAAAAAENWRPVMGYSVRVSAVEAMVSGRVTEISKCDAILAVVLDISTP
FT                   SMALGAYATEGE"
FT   sig_peptide     17443..17526
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I0 "
FT   mat_peptide     join(17527..17548,17625..17667,17820..17876,17965..18156,
FT                   18245..18396,18508..18685,18778..18787,18879..19020,
FT                   19096..19298,19365..19455,19539..19597)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I0 "
FT   CDS_pept        join(21796..21989,22074..22530,22595..23419)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898760"
FT                   /orf_name="An16g00090"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK42689.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCBFD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I1"
FT                   /transl_table=1
FT                   /translation="MGASDPIANPDLEKGQPPATVQPTERHQDNIVDYDGPDDPENPFN
FT                   WPRWKKGRQLVLMAFNTFITPLASSMFAPGVEDVMIDFHSTSTMLASFVVSVYVLGYMI
FT                   GPFLIAPLSEIYGRVYLYHACNILFLIFTIACAVAQTMPQLIVFRLLAGTAGVCPLTIG
FT                   SGTVADMVPKEKRAGIMAIWAMGPILGPVVGPVAGGFLAEAEGWRWVFWVIAIATAVMS
FT                   ILCMIWYRETYAPVILERKAARLRKATGNPNLRSVHDRGQQAHELLLVALARPVKLLVK
FT                   SPIVLLMVLFAAITYGYLYLMFTTITSIFEDVYHFSPGVAGLAYLGFGVGCLIGLVICG
FT                   AVSNHIARTHSARGCFTPESRLPPMVFGCWAIPIGLFWYGWAAKAQTHWIVPILGTGVF
FT                   AIGLMTVFMSASTYLVDSYLRYAASVTAANTGLRSLVGALLPLAGPSMYDALGLGWGNS
FT                   LLAFIALVMCACPLLFWRYGARIRTHPRFQVKL"
FT   CDS_pept        join(23533..23646,23754..23831,23922..24199,24290..24359,
FT                   24450..24593)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898761"
FT                   /orf_name="An16g00100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42690.1"
FT                   /db_xref="UniParc:UPI0000EFCBFE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I2"
FT                   /transl_table=1
FT                   /translation="MDEFTYIYSEWSALSDPDKLHPMHRLLTVGAAAGSYSLTGSLTLT
FT                   AIIGGASSATKRMKQLLPQGYTSRYPFLLQIEQLQLTTGYSDSGGDSEKRKRTAPQWQL
FT                   PWCMLCSDVGVGKKDMMIGRWDWELVTVRGKFCSLQLPRLPGDLGFLLKGVILPSPQKS
FT                   DISADDRSSPVNRLMLRKSRIPTYIDPRFTLSLPPAIKFFRPLLYLTTLLSIGLDAKSG
FT                   DGMDT"
FT   CDS_pept        join(25047..25141,25221..25730,25807..26074)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965378"
FT                   /orf_name="An16g00110"
FT                   /product="Catalytic activity: EC 4. 1. 2. 13 catalyses the
FT                   reversible cleavage of fructose-1 "
FT                   /EC_number="4.1.2.13"
FT                   /function="fructose-bisphosphate aldolase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAK42691.1"
FT                   /db_xref="GO:0004332"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG327581"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000EFCBFF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I3"
FT                   /transl_table=1
FT                   /translation="MSNCPQSPHSNRTRTILHAAKNGKYAVGAYNCYNTDGIMAVIRAA
FT                   ERMRSPAIIQLFPWTMHFHGAHFIRFVVAAAHAASVPVAVHLDHCINPEDIDLALTLPF
FT                   DSIMIDGSSMNEAENIAVCASTVSKAHERGMTVEVELGRIEGGEDGLPSVDLGSVLTRP
FT                   GDARRFLEATQADFLAPSFGNVHGGYGLVGAEKCWDLDLLQQIQQAISSTPLVLHGTHP
FT                   VSDELFLKAIECGMSKVNVNRTVRDKYTEFVAENAGELELTTLKVQAVEVYTESVERVM
FT                   KLLGSAGKA"
FT   CDS_pept        join(complement(28234..28380),complement(27241..28182))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659437"
FT                   /orf_name="An16g00120"
FT                   /product="Catalytic activity:"
FT                   /EC_number="1.1.1.37"
FT                   /function="L-malate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42692.1"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG553037"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="UniParc:UPI0000EFCC00"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I4"
FT                   /transl_table=1
FT                   /translation="MSSSNQSQYYADPEKAKDFAAALLVKAGLMAEDARSMAECLVLAD
FT                   VRGVDTHGLARLPQYLDRVSNGRVNPRPSINITQKTPVVAHLDGDNGFGFVVATRGMDE
FT                   AIKRAEIYGIGMVTVNHSNHFGMAATYVLQALKANMISLVFTNSAKQMPPFGGKETLLG
FT                   ISPFAAGAPSNTEVPYILDMAPSVVAKGKIRRAARRGESIPLGWALDADGNPTTDANVA
FT                   LNGSMAPIGGPKGSGIAILMDIMSGVLAGAEFGGQVGDQYKDTKPQNVGHCFIAIKPDI
FT                   IMSTDDFKARMDILAQRVHGVSPAPGFSEVLFPGEPEHRLGLQRRAEGIPYMEAEKTLF
FT                   TKAAKQYEVPELPLSDYPLALR"
FT   CDS_pept        join(29592..29786,29852..30125,30176..30960,31034..31291)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812215"
FT                   /orf_name="An16g00130"
FT                   /product="Remark: hpaA gene forms a transcriptional unit
FT                   with the hpaX transport gene"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK42693.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG326782"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCC01"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I5"
FT                   /transl_table=1
FT                   /translation="MEHKSVEHNEFVSSSKADLEPDRLTPARILTPEQFALAERKLKHK
FT                   LDLRLLLCVWIIFVMNYLDRNNISAAKVAGIEDSLSLSSTQYATAVALLFAGYVLMQLP
FT                   SNIFLAHLRPSLYIPSVMIIWGMLSALVGVVHNPAGLYALRFLLGFVEAAFYPGALFLI
FT                   SSWYKRSEMGVRSAFLFSGSQLGSAFSGLIGAGITSGLDGTRGLESWRWIFIIEGSATV
FT                   FIALMALFVLPNYPSNTPWLSPEERAVAEWRLIEDAGQVDEDDERWSYGFKMAFSDWRL
FT                   YTFALIFLCIQVASATSNFFPAVVKTLGFGTVNTLLLTVPPYLVALVVSIANNWSADRL
FT                   RNSSFHAIWPLSIAIVGFVVAAATLNTGARYFAMILMVAGGHGSNAVVLAWTQKTMLRP
FT                   RIKRASAVAFVNAFGNLSQIFSSYFYPDNSAPRYVTAMAANSAFSLGAILLAIFMRFVL
FT                   LRANRRIERGESTVTEEMRGQSQREIAGVSDEERVARREGFRYIA"
FT   CDS_pept        join(complement(32476..32538),complement(32230..32400),
FT                   complement(31989..32159),complement(31608..31889))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000107599" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659438"
FT                   /orf_name="An16g00140"
FT                   /product="Catalytic activity: cephalosporin C + H2O  "
FT                   /EC_number="3.1.1.41"
FT                   /function="cephalosporin-C deacetylase activity "
FT                   /protein_id="CAK42694.1"
FT                   /db_xref="GO:0047739"
FT                   /db_xref="HOGENOM:HBG324715"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="UniParc:UPI0000EFCC02"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I6"
FT                   /transl_table=1
FT                   /translation="MTATAEPQEIIERLKQWGACDVADGLSKLKHPHGGFLEGLTLYSP
FT                   EYQAGETKIVGQAFTVKFVPKDDEAAPKLSGNYIDMVPPGAVIVISQPLPQVNAVYGGL
FT                   MTLRAQALGAAGVVIDGRVRDLGEHRALKFALFARSLGTTAGGAVCRPSEVNVPVRLHS
FT                   EHQEAWINPEDYIVADLNGVVRVPREVVEKVLDVIPEIVEADRKCAEGIRAGRSVEDVF
FT                   KVFRKR"
FT   CDS_pept        join(complement(35022..35257),complement(34057..34967),
FT                   complement(32859..34003))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659439"
FT                   /orf_name="An16g00150"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42695.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCC03"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I7"
FT                   /transl_table=1
FT                   /translation="MEQPSPPWYPTTEVRPSANALSKTHSSTTSTRHKRRPAACVRCRR
FT                   RKVRCDGAVPTCSNCAKAGVDCMEGRAASAVSRSRLYYLERRVRELERLEISPLRDNFD
FT                   NSQSAFDQNQLLGGHNASPPQTSVVAEHHGLDLSQNHHSPPVQSSAVPSSTQITHNQPP
FT                   AHEVGLLSLASNTDPKYLGPSSGVSFAQLIYESAPQSQGLPLPLLRSQGTRQELHALPP
FT                   TVTGQALTSEVSSIPPIHLPSPTECQQYAEAYFESTCLYPFISQDRLYELLSQVRKFKE
FT                   TSTWNHPVPIRLAAAQLGLVLSLGARFLELRLGSEFDSHDFFVSAMTHCSQICLQDSVE
FT                   GVQVLLLMVLHSFYSPKGLNAWYLLHTIIASCLDLGLQRRHGYAPELNLTTYPVTAQRR
FT                   SAIFWSAYSMDRTLTTILGRPLTLRDEAIDQPFPGLEGSDEVDEAGTQWHRACITSEMN
FT                   MQPSEQIPSTYLAFIYSLRFDRIIAEIKLMIYRVSRSPRRFPWPSNIPAWQRETEQACN
FT                   NLLTEVHNQQRGRPLCGRSSLSGTTVQCLEIKFHQCIILLYRPSPQLPYPSFDAIKTCF
FT                   GSAMKIIQINAELHRFLNMELSWLSAHSIFVAAITVLYCLWAYPTVRGLMPVNVPLSRV
FT                   ESALELLTFLKRQWSVAVQPCEKLSRLIALTRESISETAENPRQSETTDNNIRNPTAET
FT                   QVGNGASAVPQEDGRSLLIDELGILRDLFDLGWLSDWGSDPTQPPVWDTSGFMTGFDAR
FT                   RDSGAARRGG"
FT   CDS_pept        join(35870..35892,35933..35988,36053..36747)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898762"
FT                   /orf_name="An16g00160"
FT                   /product="Catalytic activity: 2-pyrone-4 "
FT                   /EC_number="3.1.1.57"
FT                   /function="2-pyrone-4,6-dicarboxylate lactonase activity "
FT                   /protein_id="CAK42696.1"
FT                   /db_xref="GO:0047554"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI0000EFCC04"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I8"
FT                   /transl_table=1
FT                   /translation="MLGSTPLGDSHIHIIESDKYPLNPDREYTPKAATREQAAAFERSI
FT                   GIQHAVIVLPSVYGTNNSVLVDALRSSNGTYRGVCVLDLSAEIDNTTLQTFHDAGVRGI
FT                   RINYGNEGTDAQITADTIRAASIARIHNWTLELWVPIAAFKSLHPIIPTLGVRVVADHY
FT                   AHAMTGSRTGNPINSIDPFSILGFREVVDLMQRHHLFVKISAPYQNSRNEPLYSDLRVV
FT                   AETLMLHGPDMVVFGSDWPHTASKEGNEAGGRLVE"
FT   CDS_pept        join(complement(38329..38467),complement(37446..38278),
FT                   complement(37235..37393))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000026138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898763"
FT                   /orf_name="An16g00170"
FT                   /EC_number="6.3.2.4"
FT                   /function="ATP binding"
FT                   /function="D-alanine-D-alanine ligase activity "
FT                   /biological_process="peptidoglycan biosynthetic process "
FT                   /protein_id="CAK42697.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008716"
FT                   /db_xref="GO:0009252"
FT                   /db_xref="HOGENOM:HBG327671"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI0000EFCC05"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6I9"
FT                   /transl_table=1
FT                   /translation="MFASRAVRISAQAARAFGTKTPTVAILHQAIDPPVINGVTKPRKP
FT                   GGYQDSGADIAFTLQQKGVKIIKSDPAVSVSSHKGWAFPDTEEGICSAIHQGATHLWAN
FT                   TILVNSHPLQTSSKLTPLASEIYVVGQPPSLVEDFDDKAYLNDKLRELGRYTLPSSWLV
FT                   SPKDFSEVINKINSYPIVGKPIRGRGSHGVKVCHDKTQLQQHIQTLLHESPLVMLEGFL
FT                   AGEEATITVMPPTRDRPQHWSMLPVTRFNHAEGIAPYNGVVAVTANSRAISPNELKDPA
FT                   YGKVMRECESVAALIGATAPIRVDVRRFAEGSDFALFDINMKPNMTGPGRPGRQDQASL
FT                   TAIAASAMGWDYSTLLQNILMGAQPLNVFRNYKSPF"
FT   CDS_pept        join(complement(40222..40322),complement(39606..40147),
FT                   complement(39101..39546))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659440"
FT                   /orf_name="An16g00180"
FT                   /product="Catalytic activity: dTDPglucose  "
FT                   /EC_number="4.2.1.46"
FT                   /function="coenzyme binding"
FT                   /function="dTDP-glucose 4,6-dehydratase activity "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAK42698.1"
FT                   /db_xref="GO:0008460"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000EFCC06"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J0"
FT                   /transl_table=1
FT                   /translation="MTVQQPRLEINGSDEENTMKNVKTILVTGGAGFIGGWFVRHLLQV
FT                   YGTKYTVLCFDILDYCASKRNFQPVEHLPNFHFFPGDLCDRDRVTALFQQFKVDAVVHF
FT                   AANSHVDQSLVNPLSFTRSNVTGTHVLLEAARQAGTVIRFIHISTDEVYGGNMPGQDYA
FT                   FTEEDQLNPTNPYSASKAAAEMIANSYRYSFHMPIIITRCNNVFGPCQYPEKLIPKFAM
FT                   QMLRSQRMTLHGQGEAVRGFVYVSDAMSAFDIILHRGLVSETYNISSKEQIKVVDVAKR
FT                   IIQWFHAVQSDTCEQYLETVADRPFNDRMYWTNDSKLRQLGWTEKVSFDEGLIMTLEWY
FT                   RDHGETFWSGPGPACKLNGRQG"
FT   CDS_pept        join(complement(44057..44298),complement(43552..44023),
FT                   complement(43348..43373),complement(43273..43311),
FT                   complement(43126..43225))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898764"
FT                   /orf_name="An16g00190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42699.1"
FT                   /db_xref="UniParc:UPI0000EFCC2B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J1"
FT                   /transl_table=1
FT                   /translation="MAGMARDTPQPNRNKNSRSSTDMIISGSRTSDSNIMLGVIKVNPR
FT                   TAGQNGPMRSTTAPPIGEQIMGSVLDGNTMAISVDRTASKAVMNEFSMNIPVIAVMNLG
FT                   MHSKYKSAGFLGDTVVGVPAASVINGRLSSSVRFRLLSVFSDGLMRSTRRTNSSTTSTK
FT                   AGTKTAKYPARSYKKPPTMGPANKPTLRLMLVKPMARPMCCSPTVSSIRLNPIVNTMAV
FT                   EQPCRIRARRITANDLHDGRPVASNEAYTLGEGKGKHGPPKLQKWLMTGTASPTCCGGQ
FT                   NGNARQCNKIA"
FT   CDS_pept        join(complement(45949..46000),complement(45282..45809),
FT                   complement(44680..45225),complement(44529..44608))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898765"
FT                   /orf_name="An16g00200"
FT                   /product="Catalytic activity: trans-1 "
FT                   /EC_number="1.3.1.20"
FT                   /function="binding"
FT                   /function="trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42700.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0047115"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG407231"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCC2C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J2"
FT                   /transl_table=1
FT                   /translation="MSAHSAPVPFCLRWGILAFAKDLLIDPASRGVTDVSHLLVAVASS
FT                   RSTEIASRFINKIGAPSSCIAYGSYDALVADPRVDVVYVASPHSHHYQNAMLGLQAGKH
FT                   VLCEKPFTVTARQAHRLVETARERERFLMEGMWTRFLPISAQIRREIQKGAIGPVIRVF
FT                   ADNSIGTDALKELKDSYLTKKELAGGALLDLGVYPIHWIFQALSPMPDPKPSTVFSTTM
FT                   PLVSAGVDESTTVLLTFSAKSPSPVSVQAIASASLRATADPDGHTPVVRIQGDRGEIQI
FT                   YGRPWCPSKYWVVKREQRFGVVGEAEEFEYRIPGGGHGLCFEADEVARCVRDGRQESAS
FT                   MPWVESLAVLDILDAVRKAHGLHFSDIVEADEYPLCNLHDRIIALLNQAPGSRVTRDLS
FT                   AE"
FT   mat_peptide     join(complement(45282..45801),complement(44680..45225),
FT                   complement(44532..44608))
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J2 "
FT   sig_peptide     join(complement(45949..46000),complement(45802..45809))
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J2 "
FT   CDS_pept        46622..47821
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898766"
FT                   /orf_name="An16g00210"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAK42701.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG660897"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000EFCC2D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J3"
FT                   /transl_table=1
FT                   /translation="MSEASIPTFQPTVTGQELEAIQEVLASRTLTGKGKYTALCQRWIE
FT                   SSMPHGKAFVLSSCTSALEIAALLADLRPGDEVIVPSYTYVSTVNAFVVHGALPVFVDV
FT                   EETTLNIDAQKVEDAITPRTKVIVPVHYAGIACDMDTILDIASRHDLLVVEDAAMACGS
FT                   TYRGRALGTIGHLGCISFQEKKVFTSEGQGGALLVNRDSLVARAEILYEHGTNRAQFLR
FT                   GEVDIYRWLDVGINATLSEIQAAFLYAQLQAAPQILSCRRRLWSRYHRCLAPLADAGVI
FT                   CLPQPAAEADHNAAVFWLRLTDATNRSAFIEHMAAGQIQTQAQFVPLHSSPFGERFGRF
FT                   HGEDRVTTRAAAEIVLLPLYAGLTECQQEIVIRRVLGFWQEATSTPRTEASRDAEVNNS
FT                   "
FT   CDS_pept        complement(48117..48791)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216746" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116406"
FT                   /orf_name="An16g00220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42702.1"
FT                   /db_xref="UniParc:UPI00005B5852"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J4"
FT                   /transl_table=1
FT                   /translation="MAALSRLNGQISTFLAVGFLASWVITALSLTAINVLNTEATFTAQ
FT                   AASVSLLTFLVCRLLVRLQPVAPTEGRTIAHLLATADYGSRHGSLILVSFCSTWLYELL
FT                   TKGVLLLLLTFFGGVMATVIYNDPNFSENWQAEPLADQTQTTTALAEIDEFKEKAGFDP
FT                   TQLFRWIPPQAIVYFIALVWLNFISLGLYILGHGLKALCRVLGFTVTRNTSKDDRTVEG
FT                   RS"
FT   mat_peptide     complement(48120..48710)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J4 "
FT   sig_peptide     complement(48711..48791)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J4 "
FT   CDS_pept        join(50777..52651,52773..52815,52867..53084)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898767"
FT                   /orf_name="An16g00230"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK42703.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="UniParc:UPI0000EFCC2E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J5"
FT                   /transl_table=1
FT                   /translation="MFTRILLQLSQELIGVISSLEQSDAISPRGENPPTSPLSPTRGRR
FT                   GTAGDADFVSPTRRVSGRDGSGAGVRRRSSAASRRSGGSGIPSLAPRTTLAERTQGRFT
FT                   MAGPEETPQLRLAHEPFVQPGYGDLNPSYEQPANSKPVWGLAKPLPRVVRPGMVPTKEE
FT                   LLEARQNIQLPAENSQKLGLEVDPNDLELGQIEKTADPRKMAAQVEDARIQRENNFMNK
FT                   ILSGDATTTRQGSRLSRTSSSRIRRPSAWDLPPENLSTVPEGETPAPSETHEEPPQMSS
FT                   EEPLEPVLEEPELRADDGKDGMMDDLPNLEEIEAAYPEDLHPLVQELVEEEVHNNHTTW
FT                   SVIRTHHREALAESLGVFVQLFVGFCGDLAVTVANAGNPNTTDWVWGFATMMAIYVSGG
FT                   VSGAHLNPTITIMLWFYRGFPKSKMPEYFAAQFLGAFIAALAAYGLYYHSIQHYLLTNS
FT                   TTGIITSFVTSQRETWIGPGTAFFTEFLGTMILTVVVLALGDDQNAPPGAGMNSLIVGL
FT                   MVTCNTMSFAYQTGAALNPSRDFGPRLALLALGYGSSLFTNPYWFYGPWAGSLAGSFLG
FT                   AFLYDFMIFTGGESPVNYPWERTQRAMRKSRMKWGKRLHLSHRDRGEKTLHDTLILTAM
FT                   SDERFQLLSYYFYNHSSIPTHGEVVLLLNSPAIGNFSRLYCASTCIFPCGKPIGIPRQV
FT                   SGHPEIDRDAGRLTQSS"
FT   CDS_pept        53394..54548
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898768"
FT                   /orf_name="An16g00240"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK42704.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328817"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniParc:UPI0000EFCC2F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J6"
FT                   /transl_table=1
FT                   /translation="MSQDAEGGYTMSPIRRVTSSVAWGWYAISLSWGGIAVLLHQTPNQ
FT                   FTGLTTIGTIVFIANLVIYTTVTLCLLFEAVRPQKVPKPLEESPNFAARWLHIKKPQDL
FT                   YFVPVSLLAFATIIFCTSYYGTPHCGRWLILTLNVFFWVYTGVSLLLSILLGWWIPYTG
FT                   TNHGDHFAIVNILPYFPPMLSGTMAGVLAPNQDPAQAVPMLVGGTTMQGFGFLMFLVIL
FT                   VQSLTEISSEGLPVPNFRPEMFIAVGPPSFTIIAMISMADAAVEKLPDHYISAATSVRT
FT                   ADVLLIVAVVASVFLWLLAFFLFCMAALSMLEALWHRTIRFELIWWCMVFPITGFVLAT
FT                   IDMGEYLASPAIEWVGSGMTIFQVCLWLTITACQLFKWVYKREF"
FT   CDS_pept        join(complement(55808..55947),complement(55615..55756),
FT                   complement(55172..55555),complement(54723..55121))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965379"
FT                   /orf_name="An16g00250"
FT                   /protein_id="CAK42705.1"
FT                   /db_xref="HOGENOM:HBG328395"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="UniParc:UPI0000EFCC30"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J7"
FT                   /transl_table=1
FT                   /translation="MGELAPDQSTVLETFRSCCAAEGLLGRREGLQAGDVVDGINDNTT
FT                   LLRYLGARRMDPKAALKQLQEATQFQADRQVLRLYDLISVEHYEETRKLYPHWTGRRDR
FT                   RGRPILVLDLAHLNASTMAAWRKTRDISRNTELTASGTIIPDMEQRAAIYFDSITRFVL
FT                   PLCSAMSDRPDPTXPIDKSMYIVDASALSLKQAWDLREFARDISWILSTCYPETIDRII
FT                   LGNAPFYFAKIWAFMKNFVDPITADKLVITRPADAYATMAEHMDHKDIPSQFGGGFQFT
FT                   NGMLPDLDEGIQQALQWTSSSKEALPQGPLKWTEDENGQRRAVATGSIDGRQRSEEVAI
FT                   LPVNPTTLPSELPN"
FT   CDS_pept        join(57020..57296,57355..57401,57459..57706,57764..58394,
FT                   58454..58608,58675..58940,59005..59071,59128..59296)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216975" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812216"
FT                   /orf_name="An16g00260"
FT                   /product="Catalytic activity: EC: 2. 5. 1. 29: trans "
FT                   /EC_number="2.5.1.29"
FT                   /EC_number="4.2.3.9"
FT                   /function="aristolochene synthase activity"
FT                   /function="farnesyltranstransferase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAK42706.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004311"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0045483"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR005630"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI0000EFCC31"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J8"
FT                   /transl_table=1
FT                   /translation="MAFTGSFSDDYSDPVPRTCPDIQGFCENYALRRHKFEDWANAGSQ
FT                   QCRDDWEQYIGPIERWGCCNPWEGHFSAVVLPFCRPDRIAIISYCFEYAFMYDNVVESS
FT                   AKSTVNNNTDDIALDETEYRTVRSVTGTKQIQSKMLLDLLSIDPACAEVVIDSWKTMIN
FT                   TTAKQDKTRACSNLEEYVDYRIVDTGAPFVDTLMRFGMDILLTPEEEELVAPIVKPCYA
FT                   ALGLANDYFSSDIEWEEFQSSESSQTAMTNAVWLFMQWHQVGKEEAKRLVRQVTNDYER
FT                   EYQQRVQEYIAGEGKSNSKIQLYLTALGYQIPGNVTWSLRCPRYHPWLCEEGSALLQTS
FT                   MEEARDLPNVGKRRSVSEVSLSSESSVWSGTSDRSARSSVSSAPSLDDREKERDRVTLG
FT                   TEHLLAPAEYIASLPSKGVREAFIDALNVWLALPDRFVSVMKSIAKTLHNASLMLDDIE
FT                   DGSPLRRGQPATHTVFGQALTINSANFVLIQAMDQVRLLEDSRCLDIFVEETRNLFIGQ
FT                   SFDLYWTRQDECPSEEEYLEMIRQKTGGLFRLLARLMMQKATSKKNRCLPLEPLVDLMG
FT                   EYFQIRDDYKNLAEEVSLPTQNDYTCKLTQNRSIPDKRAFARI"
FT   CDS_pept        join(59452..59574,59653..59685,59795..59884,59959..60106,
FT                   60251..60315)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898769"
FT                   /orf_name="An16g00270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42707.1"
FT                   /db_xref="UniParc:UPI0000EFCC32"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6J9"
FT                   /transl_table=1
FT                   /translation="MTYTERTLRSLMSEIRHQIDGMEKKSGCPNWVLKLLVHRLEVTVA
FT                   MRSLGGLAGGRLCDTWTGTLGILISHPELHISVESSHGPLERLSRLATFRKAKTLSIDG
FT                   SIFLNLVSAPNNWTGMQVGSIDVSRVTGSATLMQTLLRDGPLSAYQPA"
FT   CDS_pept        join(60317..60607,60692..60743,61078..61397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898770"
FT                   /orf_name="An16g00280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42708.1"
FT                   /db_xref="UniParc:UPI0000EFCC33"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6K0"
FT                   /transl_table=1
FT                   /translation="MAAHEACSLMGPSIVPNTKGRETTSSSISTVSRYPGLSGNYRGGR
FT                   TAGAACYSCSRGGSIRVATKRLKAHQQYNAVITGQSKSLVYYQLYIRSFCGRLASSHPN
FT                   VHVLCKPVGVAVGRVIIRNTQAVCRYLRRTKEHIFIWAWWAGFPGSTPFCLRLQSHQSS
FT                   ANSLPSPVYLSRSYSSIDLFSPSLLVDHSVSIARGVRSRSIPWCIGHNQGAYGCVQD"
FT   CDS_pept        61709..62983
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965380"
FT                   /orf_name="An16g00290"
FT                   /product="Similarity to hypothetical protein CAD70538.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK42709.1"
FT                   /db_xref="UniParc:UPI0000EFCC34"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6K1"
FT                   /transl_table=1
FT                   /translation="MFLCSWSTLCINVPAPGDSSFKIFRRKLYLSALALLGPEFIFQIA
FT                   LSQWESACKSVKDFEASGIKGWTMTHAFYADMGGYVLKPRDWCQFPINAGQLHYLVTKG
FT                   YISPPSLDVSIIRDRNKVDGMLRIITVWQTLWFIITTAERAAQDLAITTFELTTAGFIV
FT                   CSFATTICWYHKPADIQVSEVIETDVTIEQILLEAEGHPGRPFSRTPLDFITRKEWAWS
FT                   LYWSNWTNILRKMRIVIFLSGRPVNRFQNTVVPEPSKLGYAMFLLLSAIYSAIFICGWN
FT                   YSFPTPAEQTLWRVSTVAVFCCVPLFWAVGSFAFSFWPSIASSHKSSSTMESGAIMVPT
FT                   SAHSSFWLSVKSRASRIANRIRNNSRERDPELTVPLKAILPIYVLGVVYCHARAYIFLE
FT                   DFIELRSLPASAYATVDWTNIFPHF"
FT   CDS_pept        complement(63310..64224)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659441"
FT                   /orf_name="An16g00300"
FT                   /product="Catalytic activity: S-adenosyl-L-methionine +
FT                   5alpha-cholesta-8"
FT                   /EC_number="2.1.1.41"
FT                   /function="sterol 24-C-methyltransferase activity "
FT                   /protein_id="CAK42710.1"
FT                   /db_xref="GO:0003838"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0000EFCC35"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6K2"
FT                   /transl_table=1
FT                   /translation="MSASETEPLIKENAPLVSYYNSLESRIGYRAFLGGTRHFGYYEPG
FT                   CWWPFPITAALRKMEDHLARSLNLPPGATVLDAGCGYAHVAIHMARKHGLRVTGIDVID
FT                   RHVTRGKENVRAAGLSNSVSLQKGDYHHLENFADRTFDGLYTMETFVHATDPKAALQEF
FT                   CRVLAPGGSIALYEYDHINIAGDNITEDMRRQFAQINKYAAMPANISFEQGTLQSLLED
FT                   AGFIEIQSTDLTENVKPMLRLFFIVAYIPFLLISFFGLEKYFINAVAAVMGYRYLYMHR
FT                   YICVTARKPGDRQGLDGEVKKAI"
FT   CDS_pept        join(complement(65709..65762),complement(65445..65489),
FT                   complement(65094..65202),complement(64914..64996),
FT                   complement(64495..64818))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659442"
FT                   /orf_name="An16g00310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42711.1"
FT                   /db_xref="UniParc:UPI0000EFCC36"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6K3"
FT                   /transl_table=1
FT                   /translation="MMLGPDGKVSDIRQYSLWATVFEHHQPASKLRKRLNKPPADGHTA
FT                   YPNKHYQRLGRDRSRVTFAESRPTGECSSPSWELMAGRTSCRAPADDPEVDTISRGIKL
FT                   GWPSHWISVSFALPPPRTTAKWHFNQSIIYANSGFGPEQPGHRASETCRLCPKVRTGGA
FT                   SSLEGKSGPMTGLDTSTAQASGLKTSFHWVGGQLAKRFSPH"
FT   CDS_pept        join(66040..66127,66174..66614,66678..66886)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659443"
FT                   /orf_name="An16g00320"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK42712.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG324508"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI0000EFCC37"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6K4"
FT                   /transl_table=1
FT                   /translation="MVSNAPSQCCMVGHLHEGRARGEVRQIADISTYIVYPTDRSTKNA
FT                   ILFFTDGNGHRFINAHLMADQFAARGYLVVMPDLFHGDPIPIDYGPDFDIMGWYNQHLP
FT                   PRVDPIVDAMLGQMRSTLGCQRVGAVGYCFGGKYVCRYLKAGKLNAGFMAHPTMVQVGE
FT                   LEGVEGPLSIAAAIVDPVFTTANRHESEAILARLGVPFQINLFSDVEHGFAVRCNLAEP
FT                   QQKFAKEAAFEQAVAWFDRYVKE"
FT   CDS_pept        join(complement(67824..67859),complement(67641..67772),
FT                   complement(67516..67609),complement(67362..67477))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898771"
FT                   /orf_name="An16g00330"
FT                   /product="Similarity to C-terminal domain of heat shock
FT                   protein groEL - Lactococcus lactis "
FT                   /biological_process="response to stress"
FT                   /protein_id="CAK42713.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="UniParc:UPI0000EFCC38"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6K5"
FT                   /transl_table=1
FT                   /translation="MVLPTKRASWSDGHVGEAASVMVAVGGQTSRLAIDNRLGDGTLET
FT                   AMTLLEPPARMVAGRAVVEDDLVIDERQEVQAGTARAKVGGEGTNVMADKCHSLHLRWT
FT                   NGSGALLALRPAEDSNFRGQS"
FT   CDS_pept        join(complement(68521..68587),complement(68349..68465),
FT                   complement(68168..68211),complement(67999..68064))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898772"
FT                   /orf_name="An16g00340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42714.1"
FT                   /db_xref="UniParc:UPI0000EFCC39"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6K6"
FT                   /transl_table=1
FT                   /translation="MTGAQSSSEDIPARAVRTLGRQVASPGSQDDTTSGSNGGLTLRML
FT                   RYITFAPQLPCMLRAEGVSPSTVDPSLRSMLRWVVRDHAGRQAKDKLTAARL"
FT   CDS_pept        join(complement(70864..71027),complement(70756..70769),
FT                   complement(70613..70685),complement(70211..70554),
FT                   complement(70007..70150),complement(69501..69941),
FT                   complement(69234..69433))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116407"
FT                   /orf_name="An16g00350"
FT                   /product="Similarity to N. crassa mtr gene product patent
FT                   WO9521263-A1"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK42715.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG332600"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0000EFCC3A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6K7"
FT                   /transl_table=1
FT                   /translation="MSTLDVKDIENGPARRVEEEGGMWENDMEKTPSVERDPFGNEAVG
FT                   EVHYKTLDWWQSGMLMIAETVSLGVLSLPATVAEVGLIPNAISAIILIVGMGIIATYSG
FT                   YVIGQFRARYPFIHSMADAGEVLCGRYGRMFTEFAQLVFFMFASGXHLVTFTVMMNTLT
FT                   NHGTCSVVFGVVGLVLSFACSLPRTMKNVSWLAVTSFLSIFTAVLITMIGVAVEHPNPP
FT                   PMQLTRSTSFVKGFSAVTNIAFAYCGHPAFFGFIAEMKEPKDFPKSLCMLQGFEIVFYT
FT                   VASAVIYRYAGQNVTSPALGSAGIVVRKVAYGIAIPTIVIAGVVLGHVAIKNVYVRLFR
FT                   GTDVMHKRSALGIGAWIGLAAGYWIIAWVIAEAIPVFSDLVSLVSALFASWFSFGLPGV
FT                   FWLYMYWGNYFTSVRKTLLTLANLALFGIGATICVCGLWVSGLSISSDSSGSSFSCANN
FT                   A"
FT   CDS_pept        join(complement(72649..72790),complement(72516..72565),
FT                   complement(72410..72475),complement(72198..72317),
FT                   complement(71928..72106),complement(71818..71887),
FT                   complement(71657..71764),complement(71502..71576),
FT                   complement(71336..71430),complement(71118..71175))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898773"
FT                   /orf_name="An16g00360"
FT                   /product="Similarity to human FAST-1 protein patent
FT                   WO200002910-A2"
FT                   /protein_id="CAK42716.1"
FT                   /db_xref="UniParc:UPI0000EFCC3B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6K8"
FT                   /transl_table=1
FT                   /translation="MVASDARSISDCNMTASYYLNRTTSSLQPNRAISNLSALFPNLHQ
FT                   IAPECTLHPLQCMIQDDAVDSDTSYLKVTVRSATGLNELNISSNEQQIAKQPASYQITK
FT                   AAIHGLLASAHCMSQAHVTTGKIVREAAKCSLAMSQGKKGSAADSGDPPDGSTWHGWGK
FT                   MGSRPIGIMASLAGAVTGRQTGLNFDFSRFDKFNGRQAGVLPGSPEASVWPPALTKNAA
FT                   GEGGKVENLEMGNLESATASLHKLNLILMLPPGPVPDQHAPAASCAIESLFVPERCMVR
FT                   PVEPRGPAGARCRSRILRAANSATPLLVVVAAAAAAAEI"
FT   CDS_pept        join(73025..73091,73137..73193,73240..73286,73506..73567,
FT                   73714..74136,74199..74437,74492..74697)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898774"
FT                   /orf_name="An16g00370"
FT                   /product="Similarity to pneumococcal surface protein A PspA
FT                   - Streptococcus pneumoniae"
FT                   /protein_id="CAK42717.1"
FT                   /db_xref="UniParc:UPI0000EFCC3C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6K9"
FT                   /transl_table=1
FT                   /translation="MPIHHARPLQHPQSQSLSHKLQWWMDVSKYLALMNLDPIIDQPCV
FT                   FAGTPVKLVNAKRSLTHLHHLGCGSKCCYQKSNSSTASASLPDQSKSYLIISTATFLST
FT                   DCLARMEASPLSGDNGHKFVGAPEGVDVSGDYGTPSLLFIYYNKPVSDKHRKEVQELRH
FT                   DLETWNAFELGRAESQVNELMQKGNLPTDDYNESRVRRTDYRSKVIQYLRKEHESWLVE
FT                   ADKKEFTVELKTDERHMNKKVEQELRGRLESKENPPSQFGVVLRIINRIIAARKRDDMQ
FT                   QYHFTNVEVCADGRDDPVVKSTMFRVYEEGEEDDEGSVKVKIDYVNHRCQFNREHWAKA
FT                   RHNVEDFIKEGERIRRAMTLNFCVDA"
FT   CDS_pept        join(complement(77194..77357),complement(74928..77016))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898775"
FT                   /orf_name="An16g00380"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42718.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCC6C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L0"
FT                   /transl_table=1
FT                   /translation="MEKRLASRRVPDELRKRTFASCDTCRKASGDLILPGWLFSCQNYA
FT                   NHDVLAPLQMIHCLEAIVKGVFPGEPVDSISALLELGRKAGYEMPKLDLPQQNENERRV
FT                   ELRSSESAYQTLTCASNSNDQPGCIRTSQRPPQLVKDSRGHSHYIGPSASLAFFADLRS
FT                   LVSEQQPSSCFAADTLTESLEARQDSSRLSPSAVSTGMTPLARDEELSFVKAQLQEMPR
FT                   DCLLAIIHAFFHSVNSDFPLLDRGYFFNKLESYIYPIGPAEGLEDGWVACIHAVLAFGC
FT                   WILDDDARFEADELSTLRSRCWNLARGALAGLLTSCTVSNIQALLLMALFLHNNNDRNA
FT                   AWTLTGSAARIAIALGLHRSDIDESLRLTEQDSRRRVWSTLFTFEQFLCLCLGRPSVID
FT                   SREVTLGPAPEVSATALLGHPSHHQVATDLQQQVSRLRDAIAFLHRPASPVSSADTQCT
FT                   DPISLLSNLKTWEAEIPTYLIIPSDILDTCITPSTAVLKAFVPRYPPDQLRPTVLLHLT
FT                   YNNLLIQLTRPYLLTVISMSRRQNPKQQYPWTLPRDSFQNVQKSAEHLASSCVTAAMRI
FT                   VNLLVLLDYANGVNGKTGLDLFYGYSAGMVLLLRRLWVMPPDLPKSLWQLEGAAQKDVQ
FT                   CMVTKLQSIMQVNAKCPTMQRFNAVLQKFDEAVLANGQLRERGENEVAPLGLAQGGGID
FT                   HVPSQLRIPCVDSLNSDLDGTASDSPSLWQESLQTITQYSLDWSNFEQFLGSINVA"
FT   CDS_pept        join(79527..79562,79719..80067,80117..80904)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166536" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965381"
FT                   /orf_name="An16g00390"
FT                   /product="Catalytic activity: salicylate + NADH + O2  "
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42719.1"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG321923"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000EFCC6D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L1"
FT                   /transl_table=1
FT                   /translation="MCLKFEPLNILIAGAGIRIPPNSTRLLRRWGVDFDKMRKCVCQGY
FT                   HFRRWQDGSTITEINPEDMIACHGAPYYLVHRADLHATLLAVAIEAGVVIHKNRHVTYY
FT                   DFSVPIAVTADSEKWTADLIICADGIKSTARPLLTSQPDHPRDTGDIAYRILINGQDLL
FT                   ADPDLAGLITHPATTSWCGPDAHLVGYPIRDGELYNIVVCATSKGETTDEIWVVEGDNE
FT                   ELCARFSGWEPRVQKLCRLTKSFMKWRLCDLPALSTWIHPSGKACLLGDSCHPMLPYLA
FT                   QGAAQAAEDAATICRALAEDTDITSALKRYERIRSPRASLIQSKTREHQYILHVDDGEE
FT                   QCQRDELMRHDSPSSPIFWGYELRREWLFSHDAEKMEEATAEPRLRTAAL"
FT   CDS_pept        join(81423..81813,81871..81954,82012..82102,82157..82277,
FT                   82328..82747)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812217"
FT                   /orf_name="An16g00400"
FT                   /product="Catalytic activity: alcohol + NAD+  "
FT                   /EC_number="1.1.1.1"
FT                   /function="alcohol dehydrogenase (NAD) activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42720.1"
FT                   /db_xref="GO:0004022"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCC6E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L2"
FT                   /transl_table=1
FT                   /translation="MTTNVPATRKVAVCIDTQHIELEERPMPTPSGSEVVVKIQATGIC
FT                   ATDLHLVRRTIPYLQRKVDVCGHEGVGHIVAVGPDVDTSKWHMGDRVAHRWVFDVCLNC
FT                   DMCQGGNEQLCDSRKLSGKDVEGCWGEYTIVNSMYLMRIPEDISAAEAAPTLCAGTTAY
FT                   RAIRTAGLTSGQWIAIVGAGGGLGHLAVQYAKANDLQVLGIDTGPSKWELCSRLGVTSY
FT                   IDFMETRDLTADVTRVSGGGPHGVIVVSSSTRAYEQALTYVRKMGIIVCIGISKLRWYL
FT                   RATPQANIPQAPNKMHFPIGPEYFVARGVRLTGSSTGTMEDTCQALQYVRDGRVKPIIV
FT                   EARLEEIEACLQALEKGEADGRFVVSFS"
FT   CDS_pept        join(complement(83878..84115),complement(83774..83829),
FT                   complement(83638..83724),complement(82957..83586))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898776"
FT                   /orf_name="An16g00410"
FT                   /product="Similarity to human oxidoreductase protein "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42721.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCC6F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L3"
FT                   /transl_table=1
FT                   /translation="MKAIGVRNGKGNADALFIEEGVPDPVPTGNRILVRIKAFGLNRMD
FT                   IMQREDRYPYPLLPESGKIMGVEFSGIVEEKGPNCSGDFQVGDKVFGLAYGGAYAQKIS
FT                   VSEKMLMHLPPTLSFEEAAGIPETSFTAIQAVHLVGNLQPGQSVLIHAGASGVGQSAIQ
FT                   IAKAGGASKIFTTAGSDEKCELCRSLGADFAVNYRSGEDFSEVVKRETNGRGVDLIVDL
FT                   VGRDYFHQNMASAAMDSRMVLVAALSGSKVDDFDLRALLNKRIWLMATTLRTRAADYQG
FT                   QLRDLFCEKILPHIKSGEVKTTVDKVFSWTHVSDAHKRLESNVNAGKIICLVDEN"
FT   CDS_pept        join(84636..84903,84963..85582)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659444"
FT                   /orf_name="An16g00420"
FT                   /product="Similarity to unknown aldolases and adducins. "
FT                   /EC_number="1.-.-.-"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42722.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG289811"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniParc:UPI0000EFCC70"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L4"
FT                   /transl_table=1
FT                   /translation="MATTTVTETAPQNGNSVASASTSKFFDDVHFLGDKEGKVVIRSPP
FT                   TFANIEDERAYQKQHLAVAFRVFARQGFDEGVAGHISLRDPLNPHHFWINPLSMHFSMI
FT                   KVSDLVLVNENGEVLPGGAQHPINGPAFAIHSEIHKARPDLNAACHAHSVYGKAFSCFA
FT                   RPIEMLYQDALRFYNDLAVYPRYGGTVLSTEEGARIAKALGPTCRSVILQNHGMITCGR
FT                   TVDEAAFLFIALDRCCHAQMMANAAAGPGWEKVYINKEEAEMTHRKSGNSSKMWLAFQP
FT                   YYDQVVKEDPSVLE"
FT   CDS_pept        join(complement(88158..88357),complement(87805..88050),
FT                   complement(85875..87720))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235028" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965382"
FT                   /orf_name="An16g00430"
FT                   /product="Remark: nit-4"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42723.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR012531"
FT                   /db_xref="UniParc:UPI0000EFCC71"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L5"
FT                   /transl_table=1
FT                   /translation="MCCKQLVSGTSPRPKEEGTGTEWQPSVRLQHLPPAQLTARGYPIP
FT                   LFIIPSKLSISGILSLNSLPERLSWPTLPYSPLPSHLLLTVYFSEQGRPCAEMSPKRQS
FT                   SPTTPRACQFCRVRKIRCDNEKPTCGSCQRHDRQCVYVVDPPRQRPSRALINAAHRQRR
FT                   AAENVIIALKKADPVARTAILDSIHVKDGVLQLPASLASLGASINDVPVSQPTQASDNS
FT                   SNVYSTPNDELNESSSEDDDYDPTTFLSRDECGTVGIFGPSSALHARSPLGLANSANSR
FT                   PAAEPDRYQLIVEAALQRQREPDLRRLPTIGGIPSELALHLLDLHWNRQHHTFLLTYRP
FT                   AFMRDLVTGGPYCSDFLLNAVFACSSKFSTRIEVREDPQRPESAGKRFFDRCDQLLAEQ
FT                   SLLTHSSIPTIAGLIMLGSTFNARGQTSKGWLYTGFALRMVYDLGLHLDCKEVAASAED
FT                   IEVRRRVFWAAFICDKLQSLYFGRPFTIQLRDAHVSRDFMDTFEENELWTPYIDPLKPD
FT                   NTARSHVPTRIYSVTVFQQLCSLSKIMTSIIDRFYMAGATGSKTRKHLELIDRRLEIWY
FT                   RKLPAELRFEPWADDGQSPHATVAPNVIILLTTYNALIILLHRPFMGNGHLRSDDPPAD
FT                   SWERCVTAARNITSLALAYRSAYSLRRANYMLSYAVYVACTIHARNPAIRESTRRKEAS
FT                   SPLTVCLRCLDELAIPNCGVSAPSKIIRRLMEANGMSIQTGKEPTHFSANPEVTNDVQD
FT                   VTRLFRIPSR"
FT   CDS_pept        88973..89209
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898777"
FT                   /orf_name="An16g00435"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42724.1"
FT                   /db_xref="UniParc:UPI0000EFCC72"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L6"
FT                   /transl_table=1
FT                   /translation="MASVALRATLSYSCYTIHILSSAPRHVCNWPEMAGIETPFGLFCQ
FT                   VIAADELGDIYTGAGVCYTGPCSRRMCGSYLST"
FT   CDS_pept        join(complement(90439..90667),complement(90007..90373),
FT                   complement(89582..89945))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206361" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965383"
FT                   /orf_name="An16g00440"
FT                   /product="Catalytic activity: vestitone + NADP+  "
FT                   /EC_number="1.3.1.45"
FT                   /function="2'-hydroxyisoflavone reductase activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42725.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0047526"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG328547"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCC73"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L7"
FT                   /transl_table=1
FT                   /translation="MSDKSNLLMFGATGTIGKYIIEAIVNARDSFGRIAIFTSPHTVSS
FT                   KPDELNALRQKGVDILIGDVGNREDVLKAYAGVDTVISALGRGAIAAQIPLIQLANETP
FT                   NIKRFLPSEYGTDIEYSPASQHEKPHQQKLKVRAALREVRSTLEYAYVVTGPYVDFPFY
FT                   LGRSRNTKAGTFDVLAKKAVIVGDEHGKISLTACSDVGKFVVHALTHWDAARNRALKVN
FT                   SFTTTPADVLAEFERQTGVKWTVEYTPLDELRALEKEAWEKEDPVATVYTLRRIWSEGG
FT                   TLYDRRDNEDIGVRETKGLQELVTDSIRAQIEGVPPKH"
FT   CDS_pept        complement(91102..92001)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116408"
FT                   /orf_name="An16g00450"
FT                   /product="Catalytic activity: 2-pyrone-4 "
FT                   /EC_number="3.1.1.57"
FT                   /function="2-pyrone-4,6-dicarboxylate lactonase activity "
FT                   /protein_id="CAK42726.1"
FT                   /db_xref="GO:0047554"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI0000EFCC74"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L8"
FT                   /transl_table=1
FT                   /translation="MAELVPDNAWDTHIHVFDPKKFPYAVPRSYTPQAAQMAEYPTVIT
FT                   GCKNIVIVHASIQGVSPAPLVDTLSKQQEMPGYTLRGLATIDPFTVTDEQLDALHAAGV
FT                   RGARLHEMAWGHGKQSGGNDIIKKVEALAHRLARLGWAIGIFCPVSAWAAMADTIRNMD
FT                   PRIQMVADHFGGTFPGEEYSAEFATFLDLIREKRVWVKVSGFERLYHGHESGMKAIEPI
FT                   AKAVIQAGPDRIIFGTDWPHTQLGVTRKGKTDQQRLEEVEGFREVDDAGHIRTLREWIP
FT                   DEETWQNLWVNNPAKLFQ"
FT   CDS_pept        join(92894..93266,93318..93464,93515..94245,94312..94509)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898778"
FT                   /orf_name="An16g00460"
FT                   /product="Remark: alternate names are A616 "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK42727.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCC75"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L9"
FT                   /transl_table=1
FT                   /translation="MNILATLAGLPREIGSTLHMKPVQALIWLACWACWTLGSLQYYAL
FT                   PFTLSTVAEALDVAETNVSEANTTTMLSRAVGAVIFGILSDQYGRKIPMLIDLVLMCGF
FT                   TVATGFSQTFPQLIGFRFLFGVAYGGTYGLAMATVLEAVPEKSRGVVAGFTQQGFSSGY
FT                   LFASGLHLAMNGYGWRSLFWLCAGLTVPIAILHAVTPYYSVASPAPQDEEHASGPAQTS
FT                   RAAVGGNLPFHKKLAYVLRYHYKAFIYACCLTSCLATMGHGTMDLYPTFLVSQRKLNIL
FT                   EETWVTCILQIGGILGGVVGGFLSHKVSAKWVAAGAGLLIAPWLPLWTLPTRWGLLALG
FT                   AFFLQFFYGAAIGNLGNLLQQLCPHPGIRAAFTGVAYNIGNAVSSIAPTIETSLGERFP
FT                   TADGSPDYAKTQMILVGIVIFCLVLTLTLMPLNSLNKSWDREDPNATVPATHAEMEVID
FT                   KTDFKAQEADAERGGSTHVEDAKP"
FT   sig_peptide     92894..93007
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L9 "
FT   mat_peptide     join(93008..93266,93318..93464,93515..94245,94312..94506)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6L9 "
FT   CDS_pept        join(94764..94953,95117..95183,95222..95435,95858..95896,
FT                   95993..96046)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898779"
FT                   /orf_name="An16g00470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42728.1"
FT                   /db_xref="UniParc:UPI0000EFCC76"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M0"
FT                   /transl_table=1
FT                   /translation="MHKHCIMVEYFGISFAPNSRSKRCSASVHLKGSLGRKKNEPPGGE
FT                   MQQRNHGFTAASRKDRRPASLFVASRGKTLMKGIEHGSALWEDAERRTRRPQKISKDIS
FT                   MHGDIILRPIRDLYFLPSPYFFMDACDLYPPPNIDSAPRIPQWHTMLHVNAGKGYPDTT
FT                   DRLPVRLMILSQTVYDLGRDNLLW"
FT   CDS_pept        join(complement(96398..96599),complement(96173..96273))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898780"
FT                   /orf_name="An16g00480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42729.1"
FT                   /db_xref="UniParc:UPI0000EFCC77"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M1"
FT                   /transl_table=1
FT                   /translation="MTGYCQKAVDTMLPGLTNLTCSSSGRTGNCWGAPDGLGCGVFVAG
FT                   PRGCTRTTEQMKAAFNNIRAHDSWGSVYEGRRMWEAPALNILLRIGYSREIFEQR"
FT   CDS_pept        join(97095..97101,97417..97473,97662..97769,98053..98139,
FT                   98688..98776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116409"
FT                   /orf_name="An16g00490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42730.1"
FT                   /db_xref="UniParc:UPI0000EFCC78"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M2"
FT                   /transl_table=1
FT                   /translation="MITLSFEVTWAKFNSKTPAPKGWPVRMMASAGVVSRVSTSSPSSL
FT                   ASNSSLSIRLPCGSPYKNRYPPPPSANLSIYGILGVCRVSAGVQLSTPFRALRAPCGAV
FT                   TVRIMVSHLTK"
FT   CDS_pept        join(99209..100163,100230..100645)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160780" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898781"
FT                   /orf_name="An16g00500"
FT                   /product="Similarity to Membrane-bound protein PRO1006 Homo
FT                   sapiens patent WO9963088-A2."
FT                   /protein_id="CAK42731.1"
FT                   /db_xref="HOGENOM:HBG328588"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniParc:UPI0000EFCC79"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M3"
FT                   /transl_table=1
FT                   /translation="MWRHMKFSAFHIVTLALAALLGISIWSLWLGVNSDRDNIHPLLNQ
FT                   LIPAGHCACHTAAIFECDSCLRCPAQLPFHDTVSSSSAPPTRTFFDPLEYSYNETQCTT
FT                   LFPGLFEDPIRAQSFWTARHGIKRIDIDNIKMADGMARVAIYQGRLYVLRALAKGEDHR
FT                   RKILGILASIHRALVSAPQLAVILNTEIIFSVEDKLEDVAGPDHPLWVLARKATEESVW
FT                   LMPDFGFWSWGHIDTQIGPYDEVVKHVEEHEHPWDEKENKLVWRGKLSFAPKLRRALLE
FT                   IARNYAWADVKEVEWKNKANYLSMDNHCDYRFIAHVEGRSYSASLKYRQACRSVIVIHE
FT                   LQYIQHHHYLLVSSGPQQNFVQVERDWTDLPHKIQELLDNPIKARMIADNNVDVFRERY
FT                   LTPAADACYWRALLQGWTTASPQITETMSDPTNVSNKGIRYESFLLLDPSNMMRFRP"
FT   sig_peptide     99209..99310
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M3 "
FT   mat_peptide     join(99311..100163,100230..100642)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M3 "
FT   mobile_element  complement(103661..104099)
FT                   /mobile_element_type="transposon:Vader"
FT                   /locus_tag="An16e00510"
FT                   /note="Remark: Vader is flanked by 44 bp inverted repeats
FT                   (IR)"
FT                   /note="Title: transposon Vader - Aspergillus niger"
FT   CDS_pept        join(104494..104601,104660..104785,104817..104906,
FT                   104956..105141,105194..105446,105503..105694,1
FT                   05743..105966)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659445"
FT                   /orf_name="An16g00520"
FT                   /product="Remark: putative salicylate hydroxylase. "
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42732.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000EFCC7A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M4"
FT                   /transl_table=1
FT                   /translation="MTVSQESRPLQVLIVGAGIAGLTAAIALGQQGHHVVIIEKSKFSR
FT                   ETGAAIHVPPNCTALLNWLGIDPKNFGGTLLEQVLNLQIHRYDHVGNLKYLKDFSEIRQ
FT                   KWQAEWYLVHRVDLHNYLKQRAIQTATLHMGCNIVNIDLDGQRPSVTLDNGNRHEADLL
FT                   LGADGLHSVVREVIGQTPPPPFPAGKSCFRWLLPTEKLRHLPATQNIVRDPGVFIEWAG
FT                   GDRRLVAYPCSDNTMFNLCAFLPTAEAGDAAEGWQAVGNKSALVDGFSEFSPEVKELVH
FT                   GADENLKVWELFDMKSLPSWVRGCSALLGDAAHPFQPYMGQGGAMAIEDAVSLAVLLPA
FT                   GTPVKDIPARLALYEKARRSRVDLVLEYTRINGVDEIDTTAKRITGEVIAAC"
FT   sig_peptide     104494..104580
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M4 "
FT   mat_peptide     join(104581..104601,104660..104785,104817..104906,
FT                   104956..105141,105194..105446,105503..105694,1
FT                   05743..105963)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M4 "
FT   CDS_pept        join(106745..106780,106832..>107422)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898782"
FT                   /orf_name="An16g00530"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="CAK42733.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG629833"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012278"
FT                   /db_xref="InterPro:IPR015992"
FT                   /db_xref="UniParc:UPI0000EFCC7B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M5"
FT                   /transl_table=1
FT                   /translation="MATDSEPLRFADVAVTYTADQFQGIYRGKQYHAPDFGEVIQRAKA
FT                   YNCEKMMLTTMNLEGFHRNLQLVREHPETCTLTLGVHPYHAGEIYASTNEPSYLSQIRE
FT                   IGQSLLREENSPLVAFGEIGLDYEYLDRADKETQIRAFKDQLELAVEFQLPLFLHVRES
FT                   CADFIEIIRPYLPRLPKGGLVHSFTGSVSEMRQLTDELGLDVSVNG"
FT   gap             107469..107568
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(108685..109157),complement(108414..108637),
FT                   complement(<107571..108364))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161832" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965384"
FT                   /orf_name="An16g00540"
FT                   /product="Remark: C-terminal truncated ORF due to end of
FT                   contig."
FT                   /function="catalytic activity"
FT                   /protein_id="CAK46741.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG695124"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI0000EFCC7C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M6"
FT                   /transl_table=1
FT                   /translation="MRRLLYNALVAAIPLALANFDASHVSWYTTPANNFTSTLPIGNGR
FT                   LGAAIWGTATENVTLNENSIWSGPFINRVNPRSYDALWPVRSLLAEGNMTEGNDATLAN
FT                   MVGIPDSPQSYSALGSLVLDFGHDEAGISNYTRYLDLRSGMAVVEYTYRAVRYRREYLA
FT                   SHPDNVVAVRLSSSEPGGLNVASSLVRDRYVVSNNATLSHDGGLLTLRAYSNNVSNPIQ
FT                   FTAEARVVSDGRATSNGTSLVVRNASTIDIFIDTETSYRYSAQENWEAEIKSKLDTACS
FT                   SGFVAVKKNAIADYSALAQRVDLNLGSSGSAGNLPTDSRLVNYRIDPDSDPELVVLMFH
FT                   FGRHSLIASSRATESPALPANLQGLWNQDFDPAWGGRFTIDINLEMNYWPAEVTNLADT
FT                   FSPFIDLLDVVHDRGLDVAESMYHCSNGGYVLHHNTDLWGDAAPVDNGTTWTMWPMGGA
FT                   WLSANLIEHYRFSRDESILRNRIWPLLQSAARFYYCYLF"
FT   sig_peptide     complement(109104..109157)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M6 "
FT   CDS_pept        join(complement(110608..110780),complement(110111..110550),
FT                   complement(109653..110053))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256364" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898783"
FT                   /orf_name="An16g00550"
FT                   /product="Catalytic activity: R-CN + H2O  "
FT                   /EC_number="3.5.5.1"
FT                   /EC_number="3.5.5.7"
FT                   /function="aliphatic nitrilase activity"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="CAK46742.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0018762"
FT                   /db_xref="HOGENOM:HBG747812"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI0000EFCC7D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M7"
FT                   /transl_table=1
FT                   /translation="MTASTKVRVAVTQHEPVWLDLHATVDKTCRLIAEAAGNGAQLITF
FT                   PECWLPGYPAWIWCRPVDMGLFTTYLKNSLSYDSEHMRRICNAAAQHKITVVLGLSERD
FT                   GNSLYIGQCTIDSTGKIVMRRRKMKPTHMERTVFGESSGRSLLNVVDLPIGKVGALACW
FT                   EHIQPLLKYHTMIQGEEIHVSAWPVLHPHMGGESLWGMSQEGGTGASQVYALESASFVL
FT                   LTTAVLGPTCVKKMNLSPPWDTLGGGASAVIAPDGRRLTEPLPANEEGFVYADLDLDMI
FT                   LTCRHFVDACGHYSRPDLLWLGVDTREKTQHRPEGQADNAAYGLDVPSGLVEEEGA"
FT   CDS_pept        join(111002..111177,111255..111402)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898784"
FT                   /orf_name="An16g00560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46743.1"
FT                   /db_xref="UniParc:UPI0000EFCCA8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M8"
FT                   /transl_table=1
FT                   /translation="MLVRKLRLAIGPGKERLLLLLAIYMVVEMKIGGGLFTYLVFGWKP
FT                   PHPRDSDWPDREEQSGSSESDTLSTSLIAPPGNETLCPITLLSPDRDRTSTVGGTCHGR
FT                   GLQ"
FT   sig_peptide     111002..111097
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M8 "
FT   mat_peptide     join(111098..111177,111255..111399)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M8 "
FT   CDS_pept        join(complement(112217..112274),complement(111941..112030),
FT                   complement(111715..111764))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898785"
FT                   /orf_name="An16g00570"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK46744.1"
FT                   /db_xref="UniParc:UPI0000EFCCA9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6M9"
FT                   /transl_table=1
FT                   /translation="MARSRPLDHCFRSRDKKPACTVQSPGLLIKFNPFAQYPATSHPPR
FT                   AFHASSIRYTGSSVFSHRKF"
FT   CDS_pept        join(complement(113146..113324),complement(112789..112876),
FT                   complement(112641..112697))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116410"
FT                   /orf_name="An16g00580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46745.1"
FT                   /db_xref="UniParc:UPI0000EFCCAA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N0"
FT                   /transl_table=1
FT                   /translation="MAQDSRIRLIKVWVQSAKTHANLPWSSGERLSAPAHAAAVTDAML
FT                   EVGFTSRDNPEEPGWTAVVDKQWVLHAAVAVSATAFLRTAYVSLWPFVKSNHDPVSWAR
FT                   GLQ"
FT   CDS_pept        join(complement(113881..113912),complement(113697..113794),
FT                   complement(113361..113602))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116411"
FT                   /orf_name="An16g00590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46746.1"
FT                   /db_xref="UniParc:UPI0000EFCCAB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N1"
FT                   /transl_table=1
FT                   /translation="MSVGWNLWFSRINWVPTHVEAVIQAHTIGFSLCRSHDCSVIRAGY
FT                   EVEGKISPHCRYQFWGISTPARVSEPPVLLARVRRLECPRPRPDTKVRLRGVYMKSAYP
FT                   FKTLYVGWVPKLSVYMGQV"
FT   CDS_pept        113951..117046
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659446"
FT                   /orf_name="An16g00600"
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /protein_id="CAK46747.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0004043"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG325544"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000EFCCAC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N2"
FT                   /transl_table=1
FT                   /translation="MSPSLLIQEAPGNGWYTGLGLAELLERQAIVRGTAIAIEEGPREV
FT                   TYGELHEKALFVADQVNSILHDDPSPVGIIVPRSLNHVLSQVAVIYSGRACVPLDPKLP
FT                   DEMLKNMLENLGSTLVITDILQQHRLPGVKHLVVDHRVVPETFDVNIAPSQNGPQTCSH
FT                   VFHTSGTTGKPKAVEAFAEGMINLCLDPADLIRKGQRVGHGSNVIFDTSLVEIWGPLLR
FT                   GATMVIIPQETVLDPPALSDFVKQKELNVLQLTTSLLTVTAYACPDAFSTLDTLITGGE
FT                   AINCQTIQSIFDAGAPGRIINGYGPTEASVYVLYHEVSEEEARRGEIPVGKPFGDVEVF
FT                   LVDDNLNTVKPGEVGELLVSGVGVAGGYIGDPEKTAKSFVVLPQLQRKVERGPNHIYRT
FT                   GDLMRVDEKGVYYYLGRKDNQIKIRGQRVELEALESALVGTGLVSAAVVVKITPEEVGR
FT                   GQFLLAYCIPSSPDVANGAIMKAYMEQAPHLMVPRLELIDILPLRSTGKVDRRALEEQY
FT                   YQKLKRSRANGANGNFNTGSNAAKLEYIWIDVFGLTVEHLRPTDDFVAMGGTSLIAATM
FT                   IARINQTFGISLRAQMLYENTSFESLTRLVTNIQVHGDDSSIQAEQEVWLQDSRLGENL
FT                   RPIGGVIPHWQDKHEGRIFLTGATGFVGVFLLATLVKRPDVKKVACLVRAHDEPSARAR
FT                   LEKTMEKYSLYANMDKVIALPGNFGQPRLGLSPEQYDYFATWSSVIFHLGAKVSYVAPY
FT                   SSHRQENTIGTLNMLEFATHRRTKAMHYSSTIAAYGPTGYVTGAKLLPEDERPAPHLAA
FT                   LPSDTGYAQSQYVAEAIVWNAIDNGFPVAVYRPGFVLGHSKSGICNPDDFISRLFTSCM
FT                   DMGLYPILPNQRKEFIPVDFVVDSIIHISQTHDNLGHAYNLVQPDLNNAIDINTSFDLL
FT                   NQLSPYKMEGVPYEQWVNSLSERLDDPLHPLTPMLKEKVFGNMTRWEVYENMAEFGREN
FT                   IRRALQDAPHILNRDDIEVLFHRSLKSWLPCCVWHKPVRMQA"
FT   CDS_pept        join(complement(118349..118395),complement(118270..118314),
FT                   complement(118016..118053),complement(117807..117943))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659447"
FT                   /orf_name="An16g00610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46748.1"
FT                   /db_xref="UniParc:UPI0000EFCCAD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N3"
FT                   /transl_table=1
FT                   /translation="MAAACIPSCVQAPLLSCISSYFSMPVSHETKTIAYCSPGMIQESL
FT                   SEVDKGAHFRLYCALAAVAKAPLATGEEGTEGRAAELLTWPSS"
FT   mat_peptide     join(complement(118270..118301),complement(118016..118053),
FT                   complement(117810..117943))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N3 "
FT   sig_peptide     join(complement(118349..118395),complement(118302..118314))
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N3 "
FT   CDS_pept        118912..119307
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15898786"
FT                   /orf_name="An16g00620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46749.1"
FT                   /db_xref="UniParc:UPI0000EFCCAE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N4"
FT                   /transl_table=1
FT                   /translation="MAYPDFHRIDPELEELDASANHGPVFHDTERSPVYEDHSQGLIYP
FT                   IVAQDDVAALRRYHANPGARVFWEAYENPSCHPFFVAQANSSCETLQDLLQIYLADYLL
FT                   TAGTGGHAPHGGFPLLSKYLTAQYFIN"
FT   CDS_pept        120604..121248
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161103" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812218"
FT                   /orf_name="An16g00630"
FT                   /product="Catalytic activity: 2 RH + 2 chloride + H(2)O(2) "
FT                   /EC_number="1.11.1.10"
FT                   /function="chloride peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46750.1"
FT                   /db_xref="GO:0016691"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG328677"
FT                   /db_xref="InterPro:IPR000028"
FT                   /db_xref="UniParc:UPI0000EFCCAF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N5"
FT                   /transl_table=1
FT                   /translation="MALSSHLAKKYEYHPTNTGDLRSPYPMLNALANHGIISRDGRNIT
FT                   ASQLKNALKHIGVDIDIRLGLVNSAYVVHDEHSHRGLRNPEQVNDSGVPVLDLDQTGRP
FT                   HTIKHDVFLSREDRALGDCISPHPGLVQGLLGYPQQDFFTASQLGRFRRKRYTEQNAKN
FT                   KILDFGYRAHIVACAEAALFQGVFGEGVFYQLPVKYMKAVFQEERLPFNEN"
FT   CDS_pept        122114..122407
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965385"
FT                   /orf_name="An16g00640"
FT                   /product="Similarity is too weak to assign a function to
FT                   the predicted protein"
FT                   /protein_id="CAK46751.1"
FT                   /db_xref="UniParc:UPI0000EFCCB0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N6"
FT                   /transl_table=1
FT                   /translation="MADYVGNTPLHEVMKGTMLKRYDNNGNLDPTYPWDAPLRGRQQWI
FT                   QVLVEAGGLMQQPNASGQTPAQLLSEVTRRHQCRRQVRASESPRGAANLRSR"
FT   CDS_pept        join(complement(124136..124324),complement(124011..124079),
FT                   complement(122683..123948))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812219"
FT                   /orf_name="An16g00650"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46752.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCCB1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N7"
FT                   /transl_table=1
FT                   /translation="MDTVAATSAEAHDAPEESPVIASRVLRKVDSRLLPLLFVTYLLNF
FT                   MDKTILSSASVFGLIEDTHLVGQQYSWVSSIFYFGYFFWEWPTNVLIPRVPVAKYLSIN
FT                   TWFWGAVVALTAACTNYGGLLTVRFLLGVAEATITPAFMFLTSTWYTRDEIPFRTGIWF
FT                   SGNSVGGLVASLLAYGIGHIDHPLHPWMWMFIILGVATFLWGFVLFAFLPDSISTATFL
FT                   TPEEREFMAHRAVIAGTGRTEKTTWKWAQFVECLCDPKTWHLFALAVLTQIPNGGTQNF
FT                   GNLVIKSFGFTSLQSTLIVIPASVISAGTIALTGWLAGRSHHWNCLLIVCIVALSITGS
FT                   AIIYARAHHVPLGAQLFGYFLLSTGPGALPLIMSLLQANYRGVTKKMTITSMMFIAYCA
FT                   GNIAGPQFFKSSEAPLYQTSFRAILICYIISAVLAVSLRCYLQWFNRKRDREEGVQGTA
FT                   TLAGAVGGKVVNERQDGNDVSVLVQSVELQAEDYEDATDWNTVGFRYRL"
FT   CDS_pept        join(complement(126141..126367),complement(124642..126007))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812220"
FT                   /orf_name="An16g00660"
FT                   /product="Similarity: whereas the patented protein is a
FT                   linoleate isomerase"
FT                   /function="electron carrier activity"
FT                   /function="isomerase activity"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAK46753.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG328703"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="UniParc:UPI0000EFCCB2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N8"
FT                   /transl_table=1
FT                   /translation="MFHRKSSHPISVVNGAVDHRVLPAVSLSNSRSGRIQAYLHLFNDT
FT                   PLQAGLPSFFRHWVAASFGVTEDLISQPVGGIGRSNAINSSSCNDCEVIRRDVCIIGGG
FT                   AAGTYAAINLLQEGHSVVVIEKTGRLGGHTITYIEPTTDTPLDFGVTLFEDSPETIDFF
FT                   SHLEVPFAKVSNGGGQMERVDFETGEIVDPYPGNVSKALERYGDILRQYPYLLEGWNLP
FT                   EDVPEDLLMPFGDFVEKYDLGAAVELISIYSQGVRNWLNYPTVYLMKFVSLDMLRALET
FT                   GFLSTARHDNSELYEAALAELGNDALLGSVVVQACREDDELHRLRVESSGGKSWIIEAN
FT                   TTILAAPPTGQVLDGLDLDDFESSLFSQFIYGHYYAGLVRVDGCPEGVQIVNRGSDTPY
FT                   SLPLLPCILMMYPTAVPGVMAVGYGSEEPMTEEQVKAAIVEDILGLRRAGYDVDDPEFL
FT                   AFADHSPFEMSVGRKAIEDGFYQELKKLQGHRNTYYVGATFEYPGSSAIWRAVDRLLPS
FT                   IMESIDRPPKSKL"
FT   CDS_pept        join(complement(127618..127783),complement(127239..127565),
FT                   complement(126902..127182))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659674"
FT                   /orf_name="An16g00670"
FT                   /product="Similarity to hypothetical protein AAO51454.1 -
FT                   Dictyostelium discoideum"
FT                   /protein_id="CAK46754.1"
FT                   /db_xref="HOGENOM:HBG328709"
FT                   /db_xref="UniParc:UPI0000EFCCB3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N9"
FT                   /transl_table=1
FT                   /translation="MSSKVLKLLALAGLLGASVACSTESDVEITFYGYPDNDPPSADIA
FT                   YDCGRGYTAGGTGTYDDPLTFATAPGEFKKCEIVYLPYLRKYLRFEDTCAQCSKYPHAR
FT                   SVPPLTETATDYDNGKLHIDIWTGSTTSSGGDTQIHCEDSLTPDDSQTVIINPGTSYTV
FT                   NSDELFASGKCYTSNVYSNADASSYCSSGSSGSSSSSGSGSSSSSSCSWSGHCAGKTPS
FT                   LVCASCYTDPWCSGASCSTENDCSDNLTCQSGKCA"
FT   mat_peptide     join(complement(127618..127723),complement(127239..127565),
FT                   complement(126905..127182))
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N9 "
FT   sig_peptide     complement(127724..127783)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6N9 "
FT   CDS_pept        join(complement(130221..130368),complement(129914..130162),
FT                   complement(129396..129859))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179260" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965644"
FT                   /orf_name="An16g00680"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK46755.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG447992"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI0000EFCCB4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6P0"
FT                   /transl_table=1
FT                   /translation="MAFTLYYYTPSAAAAGIFVVLFGISTVLHFLQLVRTRTWFMIPFF
FT                   IGGILETIGYVGRLLSSLESPNYSTGSYAMQSALILIAPAFLAASIYMTLGRIIRMVQA
FT                   EQYSVFRLNWVTKIFVAGDVLSFLMQASGAGLMVSNSSDPSTGEHIIIGGLFVQIIFFG
FT                   FFIITALIFQMRLAKAPTGTSVDLSHIWRRHMNALYISSVLIFVRSIVRVVEYLQGYDG
FT                   YLMKHEVFIYVFDALLMFLAMEILQFIHPSQVNCYLGRGDRYSDKVIKTQKFMSVPVEM
FT                   EVSSV"
FT   CDS_pept        complement(130812..132431)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812476"
FT                   /orf_name="An16g00700"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46756.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG648043"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI0000EFCCB5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6P1"
FT                   /transl_table=1
FT                   /translation="MSSPTHWMNTSGETDPVWVHSMPYSKYPKFPSLNENVETEVCIVG
FT                   AGIAGISIAYELVNRGKRVTMIEARNVLSGESGRTSGHLSNALDDGYVEIQKKHGTQGA
FT                   KAAAESHTWALKRVGEISRSLGIECEYRTLPGYEISQYPRGDANHEKEVASLKKEAELA
FT                   KQLGLPASYRDGLTVKGWDGSIDQRDGAIFADQATFHPTKYFVGVLDWLQKQPNFQCYA
FT                   HTRMMSSSESGLVQVTTADGYTITAKDMVEATCVPLQKLSVIAEMEFMRTYCIAIRVPK
FT                   GSIEDCLLYDEAEAYKYVRFTECDEKDDYLVVGGCDHKVGQEHTSGRFEELETWVRERF
FT                   TKAGTVDYKWSGQIFEPVDYMAFIGKNQGLNHTYIVTGDSGNGLTHGVLAGRLIADEIT
FT                   GIDNPWASLYNPHRLSSIVKSLPSMLQHDVQINAQYKRWMKSDIKDIEDLAVGSGGVIK
FT                   EGLTNPVAVYKDEQGKAHKFSAVCPHMKGVLNWNDTEKSWDCPVHGSRFSCDGVCVEGP
FT                   SKANLKPMDSFAQKEQRAQQAI"
FT   CDS_pept        join(133445..133687,133757..133981,134057..134218,
FT                   134281..134373,134436..134561)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812477"
FT                   /orf_name="An16g00710"
FT                   /product="Function: RD20 of A. thaliana is involved in seed
FT                   dehydration"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAK46757.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG598266"
FT                   /db_xref="InterPro:IPR007736"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0000EFCCB6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6P2"
FT                   /transl_table=1
FT                   /translation="MPRKVSFSETQLPNFDKPIRPPSISVDFSTTAPECPVTAAREPAR
FT                   YTNDYIEKPGVPRANTTASIDRPDGDESYTKQFSDFTPLQQHVLFWDRDRDGQIYPWDT
FT                   YIGFRELGFNMLFSFLAVLIINLNFSYPTRLAHSFLPDPWFRVYVDAVHKAKHGSDSNT
FT                   YDPEGRFVPQSFENMFAKYDRDGDGALTLRELFDMMHGNRCAADPFGWGAAICEWGTTW
FT                   LLIEKDGKVWKEDVRGVYDGSLFWKVREANYSGRGWSQGFRPGLWIKRTVKGVLNAYLD
FT                   G"
FT   CDS_pept        join(complement(136181..136411),complement(136004..136129),
FT                   complement(135741..135953),complement(135188..135685),
FT                   complement(135044..135136),complement(134722..134991))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157494" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899749"
FT                   /orf_name="An16g00720"
FT                   /product="Function: TNA1 of S. cerevisiae is necessary for
FT                   nicotinic acid uptake"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46758.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328832"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCCB7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6P3"
FT                   /transl_table=1
FT                   /translation="MADDDTVKGLAVEAESSRTDDTELTPQEQRRVIRRVDARLIVMLG
FT                   FLHTVSLIDRGNLSTAAVAGMEKELHLQGNQYNVIAVVFFPPYICLQMLGPVFIRKLGP
FT                   KLFLAGICFIWGVSMMCGGFVHNWAQLAGIRIIIGALEAGFFPAAVYLIATWYTRYQMQ
FT                   KRFAIFYLLGCVASAFTGILSYGITFMNGLGGLTAWRWIFVIQGLITCTLAAISYFVLI
FT                   NFPDRMRSSKSRFLSHREYDFITDQINADRGDVRLEPFDLKKYLVAALDINIWGFGLVY
FT                   FCTTTTAYSIAYFLPLIYREGMGFSMGASLCLFAPPYVAAGITMFATSWIGDKYRIRGP
FT                   IIVFNAMLALIGLPLMTFTKGNGPRLVGCFLTTMGANSNVPAAMAYQANNVRGQWKRAA
FT                   CSAIFVGLGASGGMVGSLVFRSQDAPEYRPGMLTCIGMQAAAIVLVGLLTIRLYLRNCR
FT                   VDRGELVIGDLPGFRYTY"
FT   CDS_pept        join(complement(138922..139023),complement(138789..138866),
FT                   complement(138660..138739),complement(138535..138616),
FT                   complement(138432..138485),complement(138313..138383),
FT                   complement(138096..138255),complement(137981..138034),
FT                   complement(137882..137933),complement(137725..137838),
FT                   complement(137584..137674),complement(137413..137536),
FT                   complement(137274..137365),complement(136892..137219))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116653"
FT                   /orf_name="An16g00730"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46759.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328747"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCCB8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6P4"
FT                   /transl_table=1
FT                   /translation="METPEDSNKGPIDRISSVNEHLSVEIRPEDETALVWRLDCFFLVV
FT                   GFLGYAFKYLDQTNISNAYVSGMETDLELYGNEYNYFTTFFNIGYMIMLYPSCIIISHI
FT                   GPSIWLPACEVLWGILTCCLSTVTSAKQVYGLRFLIGFFEGATWPGYFTIISQWYLPHE
FT                   MALRMSLYNMAQPVGAMLSGAMQGAMSTNLEGVMGRSGWRWAFIINGVCTIFIALLAFI
FT                   ILPGFPERQNPLSKIYLRPQHINTETAIARTRRVGRKPQIGIQVKSFLRCFRFWHLWLF
FT                   AIAWAIGTGTTPTSYFNLWLKSLKNPDGTAKYSVAMLDYLPIAGQAIQLVAEILFSGFS
FT                   DYFGVRLPFLLLHAVINIVSLIILTIQPSNEHTYMAGWYMDYVGAVSTMLLCAWASAHL
FT                   ETEPQVRTVLFATGTLFSYLLSAFLPIAAYPASEAPHWRIGAKLYLGLSCLAAVLFVCI
FT                   HFAFKWEERRKAKTRRVDDWNVTADEDRFSEGTVA"
FT   CDS_pept        join(complement(140452..140610),complement(139964..140384),
FT                   complement(139568..139905))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000035269" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812478"
FT                   /orf_name="An16g00740"
FT                   /product="Similarity: also shows smilarity to nitrogen
FT                   metabolic repression proteins"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK46760.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG325285"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCCB9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6P5"
FT                   /transl_table=1
FT                   /translation="MSKIITVFGATGQQGGSVIRTILNDPELSKQFKIRGITRDASKPE
FT                   AQALAKQGADLNSKESIRSALEGSHSVFLVTIPAWGVPGSDAELVHGKNVADVARELDV
FT                   QHLIYSSLLNVTKTTAGRLKNVHHFDHKAQVEQYIRSLGVPATFVLPGYFMTNYTAVGL
FT                   LRKGENGVWTVAYPVGKEAKFPLIDIAADMGKYVAASLKNRSETLGAQILVAEDYYTPT
FT                   RILEEFEQVTGQKTQFVQVDSETYMSFMPGPIGQEMLENHLFIGNPGYFNGRSLNESKD
FT                   LVAKAGYKLTSWKEFLQQNKASFA"
FT   CDS_pept        join(complement(142813..143226),complement(141165..142733))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116654"
FT                   /orf_name="An16g00750"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46761.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329822"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCCBA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6P6"
FT                   /transl_table=1
FT                   /translation="MDDLSHPAQATASSQTTYPRSCIPCNRRKLRCDRKFPCGRCVKGG
FT                   EQCVFPGPKRAPRQLKRPPIAEVLAQLRQLEQEVQLLRAQAQQPAEAGASPLGHPLEEA
FT                   AGPLEPGEREGRLVVKEGKSRYVGDAPSAVLGDKIRELQDICDASSSEDELETPETSGL
FT                   HFASSLGGNWRNHSLRDTYLQPDQMQRLWQVYQDNVAPLLAVLHVPSVEIMVREESENI
FT                   NPDPAREALILAVCFAAIVTIPPDQCMTLVGMDCEKAIQSYQLAVDQALVRANFIKSQN
FT                   ICVLQAAVIFLLCLRWRGDARLVWAASAVVVRVAQGQGIHRDGQSLGLSPFDSEMRRRL
FT                   WWHICLLDMVCSEEQGTDTQIQPGMFDTRLPHNIDGADLDPSMTELPPEKTGATDITLL
FT                   IIQCDIISELNWPNRRNGGARDAQSTADQEPLVTTVANRLEGRFLQHLDMNIPIQWVYA
FT                   MIIRLTLSKLWLYAHYNKMASHESRSGWSQAACDDAFQAAVETIKFTILLHTNESTSQW
FT                   AWLCKTYKQWHTVAFILAELCNRPITAETDHAWQVVTEIQRQWEQDGSPQSVMLRKPLK
FT                   RLMQRTASTRAAKMGISPGSSLGTEVKDDDSIGSGLMSFNTNPLPGMDFSQVSLGQGSL
FT                   PPDAYSLGMAGFGVSGMEWLWEPLL"
FT   CDS_pept        join(complement(144938..144995),complement(144738..144841),
FT                   complement(143881..144675))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116655"
FT                   /orf_name="An16g00760"
FT                   /protein_id="CAK46762.1"
FT                   /db_xref="HOGENOM:HBG326024"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniParc:UPI0000EFC947"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6P7"
FT                   /transl_table=1
FT                   /translation="MPPFEKLRKMHSPFPGSFRSECNKAARILDAFTNPLNPDGRDSLI
FT                   PPKVLGAAKGFAIFSVSKLGIVGSVRMGSGILIARLEDGDWSAPSAILTAGVGVGSQLG
FT                   VEVTNFVFVLNTTSAVRTFAQLGSLSLGKTASFAMGPSGRFGEVNGVVSAGGMAGIFVY
FT                   GHNQGFFGGFSTEGSMIFERRGANQKLYGKKIKARDLIEGQFPPPEEADELMNVLRSEL
FT                   FAPRPELCATSSASTKGSISSGRPSQSSAGTDIQKKPIEMPADEIVQLPAELPAEFIAE
FT                   LPAEVVPDIYYDKSVGSSETLLPELPSETASVRPAKS"
FT   CDS_pept        join(147763..147962,148111..148488,148557..148634,
FT                   148705..149056,149232..149740)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899750"
FT                   /orf_name="An16g00770"
FT                   /product="Putative frameshift"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46763.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC948"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6P8"
FT                   /transl_table=1
FT                   /translation="MARCDLADPAARPLSTSPKTVASNSAAVANPTEVDWDGDADPSNP
FT                   MNWSFWYRWCHIVVISLLTFVTSLGSSMLAPAVPDVMRSLGSDNAELESFVVSIYVIGY
FT                   ALGPLIAAPMSEIYGRSIDYNVSNVLFLGATIGCALSTNVGMFLVFRLISGCAGVTPLA
FT                   LGGGSIGDLMAPEKMGTAMAIWGLGSLVAPVFAPIAGGYLSENVGWRWIFWVITIPMAV
FT                   LTILSIVTLRETYAPILLERKARRLRRETGDRDLRSRSATPKSQHEVFFYALVRPLKML
FT                   LTSPVVMMLAFDVAVVYGYQYLVFTTLSYIFQDVYHLSTGLSGLVYLGDGIGTILGIFS
FT                   IGYASDKVAERKKGRLSAPDETLPPESWLWPMIPASLLTPIGLLWYGWSLQAGLFPVVP
FT                   LVGLGVFGFGMMGIFQPVQIYLVNAFPIHSASALAASNLLRSLVGALLPLGGHRMYDTM
FT                   GLGWGNSLLAFIALAMAPVPIILMKFGERMRLSDRNIENGRTQGFTS"
FT   CDS_pept        join(complement(150818..151401),complement(149846..150761))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169486" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659675"
FT                   /orf_name="An16g00780"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46764.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328272"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC949"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6P9"
FT                   /transl_table=1
FT                   /translation="MAPQLSELPPECEPLLPPSGPSDCDQPTARVPRLRADPQRFLLPL
FT                   IFASVVAADFGNYLSYAPQIAIFESIICRRFGADSHALEVGAGCKSPEVQAELALVNGW
FT                   KDMFDQLPGILLALPYGFLADRVGRKPILLLSLTGLLMEELAIRVVCWCNTVLPLRTVW
FT                   VTPIFQLVGGGPQLSTAMAYAMITDLVPVSKRASVFFLMAAAVLLGEILATPLSAFLMS
FT                   WSPWVPSLLGVAIQSLGLLGTTFLPETHPQKTFHAEEGEGEGNQDDAIAHSAPTRLLTT
FT                   TLRSLWDQARSFTVNARCLNLICIVCSFLLASIGRQALQLIIQYASRRFSWSIAGASYL
FT                   ITVKGLINLLTLLVLLPKLSDWLRRHLSFSPVLTDLRVVQWSAWILTLGMALMAIASQP
FT                   PLFVFGVCLLAFGWGFYSALRSLATALVLPSQVGVLNTAIGLSQSIGSMVSGPILAAAF
FT                   QRGVHQDGFWMGLPYLLAAVLFFFASCLTSVVRIMDEEPIP"
FT   CDS_pept        join(151578..151709,151841..152152)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899751"
FT                   /orf_name="An16g00790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46765.1"
FT                   /db_xref="UniParc:UPI0000EFC94A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q0"
FT                   /transl_table=1
FT                   /translation="MAPTLSDRGAVAIPRTPYIVTISTSVEKPTQRVRDRSRLGASKAV
FT                   GKGEFDGELARIPPPEQAWPGEKPLFPTAGPMWYCREPRRAALKIHPHRCSSYMVEELI
FT                   QVQEGPEKQCSMASKFWRRTLTHLESTPHPTLLATSEIPKELS"
FT   CDS_pept        join(complement(154366..154419),complement(154210..154269),
FT                   complement(153861..154177),complement(152808..153794),
FT                   complement(152624..152755),complement(152325..152568))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116656"
FT                   /orf_name="An16g00800"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46766.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC94B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q1"
FT                   /transl_table=1
FT                   /translation="MGMVPWPEGDGTGMKTLMSLILISGGCHVSPEDDCEKRCYRQTME
FT                   HVTEHAKEISPIHTSDSEDYSDEHPDHPDSLELARINTYRLQQRATVGSTRGPEPRQEW
FT                   LPMGAGKEYPPSLPDPEKYVVEFDGADDPLHPWNWSIIRRTVLVTILCYCTFATAFTSA
FT                   VFSAAVSAVSEEFHVGREVSTLGVTLYVLGFAAGPTIWAPASELIGRRWPLSIGLFGCG
FT                   IFTIASATGKDIQTIMISRFFAGLFAASPVSLVPAVFADLFSAAHRGVVMSIFCMAVFI
FT                   GPFAAPFVGGFIAASPLGWRWTMYISSIMVFLAFVLVFFFLDESYAPVILVRKAAVLRR
FT                   QTRNWGIHAKQDEVEVDIKELVRNNFTRPLSMLITEPILLLISLYISFVYGLIYALLGA
FT                   YPVVFDDVYGMSAGVGGLAFIGLILGELIGGVFILCLQGSYKRKLAANGGKPIPEWRLP
FT                   AAIVGAVAFAIGMFWFGWTGYTNKIHWIAPTAAGILIGFGILCIFLQCFNYIVDCYPTL
FT                   AASTIAANTILRSAVGCVFPLFSRQMMVNLGVQWAGTLLGCIAAIMIPMPVAFMIFGPW
FT                   IRQRSKLAASPARDMEKTSNA"
FT   mat_peptide     join(complement(154210..154236),complement(153861..154177),
FT                   complement(152808..153794),complement(152624..152755),
FT                   complement(152328..152568))
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q1 "
FT   sig_peptide     join(complement(154366..154419),complement(154237..154269))
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q1 "
FT   CDS_pept        join(complement(158008..158200),complement(157892..157948),
FT                   complement(157756..157832),complement(157548..157706),
FT                   complement(157363..157493),complement(157029..157311),
FT                   complement(156805..156980),complement(156145..156751),
FT                   complement(156025..156097),complement(155796..155977),
FT                   complement(155629..155746),complement(155486..155572),
FT                   complement(155240..155433))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899752"
FT                   /orf_name="An16g00810"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46767.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG590918"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI0000EFC94C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q2"
FT                   /transl_table=1
FT                   /translation="MTSVYHPENEGKDAIETKQAGVADLDAELLEENDDLKRQNIVAEQ
FT                   KELTPLEAFKWNVEGDQSPFPEVAACVPNTDDPTLPCNTFRAWFLTTIFVMVFAAVNQF
FT                   FSLRYPSLTVQYVVAQLLVFPIGRGWERLPRWRVPLGRLSFDLNPGPFSIKEHAFITIC
FT                   VNISASIAYASSSLVAIVMPQYWGKDYGAGFSFLYLLTSQMMGFGLAGMCRRWLVYPAA
FT                   LIWPQSLSSTVLFRALHEPQNRAPANGWTLSRYSFFGYATLFAFAIYWFPDYIWTTLSA
FT                   FAFVTWIAPHNQKVNTIFGMNSGLGLLPLSLDWTQINYAGYPLMTPFYITCNAFAVVVF
FT                   FYLFLSPILYYKDVWFSAYLPLLSSSTFDNTGSEYNVTRVVDSNGDFVLSKYKEYSPMY
FT                   LSMSYTLTYGLSFAAVTAIVVHTYLYNGSEIWAKFKNARHGGEDIHRRLMRAYPEVPDW
FT                   WYGALFVVMAGLGILTTKYWETGLPVWGFIVVCCGMGVVLIVPEGILEGTTNQRIFLNI
FT                   ITELIAGYAWPGKPIANMMVKCYGYNAVKHGMDFAQDLKMGQYMKIPPRVLFFGQIYAS
FT                   ILATMTQTGVLRWMMGHISGLCDTDNAQRFTCAGAKVMYNASLIWGTIGPQRMFQSGQV
FT                   YHSLMYFFLIGPVVTVIVYLIYRRYPQSWVKYVNVPIFFNAAGNIPPANTTQYSLWFIF
FT                   GFLFNYLIRKRAMDWWKKYNYLFQAAMDTGTAIATIVIFFALGYTNTTFNWWGNTVGSN
FT                   TDDENSVPWLTVPAGGHFGKGPGEF"
FT   CDS_pept        join(159374..159474,159591..159699,159805..160038)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899753"
FT                   /orf_name="An16g00820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46768.1"
FT                   /db_xref="UniParc:UPI0000EFC94D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q3"
FT                   /transl_table=1
FT                   /translation="MTNTISAWVVLPRHAELYPKREGLASGRGRQPYRQEIHLAPDWVA
FT                   LSQKASERAIAEPSAAVNADHPGVPSAARVLPIALRRNQLKKATLPHSQSGMSDCNTTP
FT                   GECEPRLHHYHAHKSHSLFVRYCIPCTDLVYHLILSAARVRFL"
FT   CDS_pept        join(160537..160690,160743..161506)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217470" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812479"
FT                   /orf_name="An16g00830"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An14g02830 - Aspergillus niger"
FT                   /protein_id="CAK46769.1"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI0000EFC94E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q4"
FT                   /transl_table=1
FT                   /translation="MREAVGGHAAAHRDSTSLPQQIELGLEDVWIGVTDPKERRRLQNR
FT                   LNQRARRRRQHLAKELPRRSERYDSQAWSTTVSAPYQLDLQCLDELRIFGPLAAKSRST
FT                   LQQLEAMVHVEFALGSPQADLRLGVTRLNILRALYTNVDILGYDAKDMAADEVLSMFAM
FT                   IGPRCLATAGREAVLPPALQPTEIQRTVPHHPWLDLIPIPGMRDNLILMEDLMDDRQLC
FT                   RDMCGYRSQVPRSGHRRPTGMGETGVIVWKDPWDPAGWEITETFFQLWGWSVKDCWGLF
FT                   SSTNAWRMRRGERPLFAIRSTDSY"
FT   CDS_pept        join(complement(162662..162708),complement(162415..162598))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659676"
FT                   /orf_name="An16g00840"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An18g01250 - Aspergillus niger"
FT                   /protein_id="CAK46770.1"
FT                   /db_xref="UniParc:UPI0000EFC94F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q5"
FT                   /transl_table=1
FT                   /translation="MPAAGGLTGGHPPSVRSRNIAIFSVIGMIAGGWMFFRAQSPSKEE
FT                   KLYSQKDIHTMVGGQTGENRVGRAPSHQKKD"
FT   CDS_pept        join(163574..163629,163684..164139,164194..164386)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161687" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899754"
FT                   /orf_name="An16g00850"
FT                   /product="Similarity to hypothetical protein SPAC9E9.15 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK46771.1"
FT                   /db_xref="HOGENOM:HBG328836"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="UniParc:UPI0000EFC950"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q6"
FT                   /transl_table=1
FT                   /translation="MEVLYTKPQSSPYFFGGPQPWSSFSWASSDDRVRGGSSHSYLTIN
FT                   KDTNTAIFHGNLDIKTLGGAGFASQHTASTTELWDLSSYAGLELSIPKSDGHTYTLNLR
FT                   DELQDPRPDGRQRSGLVWEAKFKVEKGQTKVRLGWKEFRPTYRGREVHMGRPLILAGVK
FT                   RFEIMIRSFFGEQEGDFELEIESIKGIEQEKGRYRDDPNDSGDDDKYYDEKQQPYSEDE
FT                   DTGLGWLCCGIC"
FT   CDS_pept        complement(164439..165902)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116657"
FT                   /orf_name="An16g00860"
FT                   /product="Similarity to hypothetical protein aos20 -
FT                   Aspergillus oryzae"
FT                   /function="ATP binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK46772.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI0000EFC951"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q7"
FT                   /transl_table=1
FT                   /translation="MTAVTLIQPLPLVPPEPYPSTKAPITKVPITLDCTLHDLYSLDND
FT                   TPQNIVLAYDHPCKFPRDQINLPSGARFVYAANFPGAHTKGEAPNLQKRSIAQRYSFIA
FT                   GRTPVAMIDLSGNGGEDLPNILRTSQDEVVRLYDQLSTDQRPEVRFIRGMHDCQLAPDS
FT                   RAVFIVPQDHTCTRFDHAVDPEMLYEVLSKRWLAVSGLPTPKSKIIDPLPIKSWKAGVD
FT                   AEVERMLQAVQQQGLPFVVKVSIATSGYGTYVIRSESERETAVVELRSILKDVLEKINE
FT                   EHERLYPASFVIQELIPGEAHGVTFFVTKKGRPVYLATSQQRFDQEGVWNGGCVSYPLQ
FT                   PMFQDRYKSTIEALAKALHSKGYYGPAGADIMTDANGELLIVDVNPRVTGSYHLGLLKN
FT                   HFMQRGLYEAAVLSRLLIPCSRSLFEEQFAVEIAQGKLIISAWVIDSKKEISYAALTVG
FT                   AEDAVKLGRLIRVIETFVKTGEYAESAEL"
FT   CDS_pept        join(complement(166761..166943),complement(166581..166628),
FT                   complement(166118..166312))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899755"
FT                   /orf_name="An16g00870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46773.1"
FT                   /db_xref="UniParc:UPI0000EFC952"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q8"
FT                   /transl_table=1
FT                   /translation="MCAIKPWFNISPSKGTGHAREHPDISLSIVEPLAIIGYGEEGYHR
FT                   HQATLDACGSCRPFPEATSHCTGGAKRWASPMDPSQAWGNRPPTCCTGKRINDSKRNLP
FT                   ASLLVLSLVIYLSGRLHDGSVRGEFDLNFRGNFDRER"
FT   CDS_pept        join(complement(168215..168623),complement(167812..167953),
FT                   complement(167544..167758),complement(167424..167491))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899756"
FT                   /orf_name="An16g00880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46774.1"
FT                   /db_xref="UniParc:UPI0000EFC953"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Q9"
FT                   /transl_table=1
FT                   /translation="MFQFHHSIRHQPCPGDITLPGVFDYRLSHIARGSGHSASIYQLII
FT                   RLAVNKIYSLHGVACGIRGSGFRDDIPSRIRNVRHNKSPGESKTIRFADEDVGEVSYIE
FT                   SAISDLGTANVVGVGLRCSSQGKTQEGHRCKQESCSLGGCTGSVPFGGYPEHPSDAWDQ
FT                   VYYRCSCNNPSLAQELPMPRCHPPQIQGLCNKRRLRQSTLCAILRKPGGEGLSRCISSP
FT                   LGSYIFHGYVVQRQMEHPGGTNCGIPISAPDVHGALNVYVQSGCHTGWLSSDSES"
FT   CDS_pept        join(169209..170391,170443..170909)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000064644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659677"
FT                   /orf_name="An16g00890"
FT                   /product="Similarity to hypothetical protein PA2448 -
FT                   Pseudomonas aeruginosa"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="CAK46775.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG670532"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniParc:UPI0000EFC954"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6R0"
FT                   /transl_table=1
FT                   /translation="MRVYSSIDSSNALAFHNGRVYTINSDQPWAEAFIVSPTGIIEHIG
FT                   SNADILEIASARGLIQYDLRQRFVMPGIHDAHTHLLVAGLQALNEARIGFDSTPDNLTS
FT                   RLARGSCACAYANVTGDWLIGNFYQASHFPNGVPDRKYLDGQYPDQPVLIREVSCHRIL
FT                   LNTAGLIRAGIDPNGAPDPDGGYYVRRQDGITLTGEVVENAMTAVFDCLPIPPLAHVKR
FT                   AIHHAVSICHKFGITSCQEASANTLYLHAVRELELENRLDLDIHTHIVSAPVYFAMEPQ
FT                   DSLAGLIDVAEGFRSRHVHTQFVKFWLDGAPLPPEFTQADLDANGQPIPTHLAVDKDFL
FT                   YKAVKKYDGRGMTCKLHVAGEGSARLALDVIAKVREGNPVGPRHELAHCNAVHKDDIAR
FT                   FAPLNVTAEMSPAIFHHDVVEEYPELNKWAFNGVLASGALMTIGSDWMLPETPSLFDAL
FT                   AAIVERVRYKPGGRCRRLALGETAMQRGGEILCRVLTLSGAEAVGVHHRTGSLEVGKVA
FT                   NFIVVDRDLSQGNFKGANVLETWFEGRKVYQA"
FT   CDS_pept        join(171141..171391,171444..171646,171700..172352)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196503" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899757"
FT                   /orf_name="An16g00900"
FT                   /protein_id="CAK46776.1"
FT                   /db_xref="HOGENOM:HBG328876"
FT                   /db_xref="UniParc:UPI0000EFC955"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6R1"
FT                   /transl_table=1
FT                   /translation="MPDNTQLLEFIAQKRFHQRIVLPATTEHGRLAVTYADIGPQTKKD
FT                   GSPTPTMLLIQGMAGSRLWCCQKDHLANKLGVRMLSIDRPGIGGSTPVPPEKRVKVWLE
FT                   TVSAVLEHLSIKHVVPISHSAGTIYLLNLLSRRRDLLWPKMPLAVLMAPWVEPKYSDIL
FT                   SLQMAKMLPTGVLKQWNKVMKFVVTKAAPSLSSSVDILSSMGGSIPRGSTEDINHREPN
FT                   LTADEIGPRTAKQLENLCIEYIFLEDTTGMNDEAVVCLKKTAGLWGACEDLPIYIRWLV
FT                   QAEEWYKQGHPEEQEPLQVKAIFAEKDGMIGPQGQKYFENCFAPINLNNVVSFQSVMEK
FT                   GTGHDTLWASETGAFLKVMEDIKEATSQ"
FT   CDS_pept        172631..173962
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965645"
FT                   /orf_name="An16g00910"
FT                   /EC_number="1.-.-.-"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46777.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG583461"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000EFC956"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6R2"
FT                   /transl_table=1
FT                   /translation="MGSVNQAPRVIPSTETPYFTPANNGGEALNPADPNTPTLFRPLKI
FT                   RNVTLKNRVVVSPMCMYSAESDPSSPFVGALTDYHIAHLGQFALKGAGLVFVEAQAVQP
FT                   NGRISPNDAGLWEHSPESEQFKSLQRVVRFCHSQGAKVAVQLAHAGRKASVLPPWIGVQ
FT                   AKKPCVKADESTGGFPSDVVGPSGGADQAWDGTGEGYWAPRALTVEEIKEIVQAFAKSA
FT                   ETAIRAGVDVIEVHAAHGYLINQFLSPVTNKRTDEYGGSFENRTRILREVMTAIRAAVP
FT                   SGTPLFLRISATEWLDGQDVAAESGSWNVDSSLKLLPLLPELGVDLLDVSSGGNHHSQK
FT                   INIHTNYHIDLAAQLRKAIHATGAKTLVGAVGFITEADQARGLVEGADEAHAANATVSG
FT                   PEPVADLVLMARQFMREPEWVMNAAKKLGAKVEVPVQFWRAGLV"
FT   CDS_pept        join(174371..174417,174470..174582,174646..174809,
FT                   174884..175024,175088..175123)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000255884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899758"
FT                   /orf_name="An16g00920"
FT                   /EC_number="1.11.-.-"
FT                   /function="peroxidase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46778.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI0000EFC957"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6R3"
FT                   /transl_table=1
FT                   /translation="MALKPGDSFPSDVVFQYIPWSEDKGEITACGIPINYNASKEWADK
FT                   KVVLFSVPGAFTPTCSINHVPGYIQNLPQLKEKGVQVVAVIASNDPFVMSAWGKANNVK
FT                   GDDILFLTDPDARFSNNLGWASGGRTGRFAIVIDHGKVTYAQIETEKGAVKVSGADAIL
FT                   ANL"
FT   CDS_pept        join(176397..176474,176544..176781,176858..177246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116658"
FT                   /orf_name="An16g00930"
FT                   /EC_number="3.4.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK46779.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG646910"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0000EFC958"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6R4"
FT                   /transl_table=1
FT                   /translation="MAPKVLVVLSSHDHHNANNEPTGWFLPEFAHPWDVLHSKTELVIA
FT                   SPAGGKAPLDPGSIEMFKEDPVSQKFLKEQESLWTNTVKLSDVVSRVSEFDAIFYVGGH
FT                   GPMYDLYSDKTSLALIQAFAVAKKPVAAVCHGPAVLVNATTPSGTALLKGAEVTAFSNT
FT                   EEDQVQLSSIMPFMLEDELKRVGATFVKAEQPWAEKVVVSQVAELGGAVITGQNPASAT
FT                   GVGKAILTALGL"
FT   CDS_pept        join(complement(178995..179260),complement(178928..178949),
FT                   complement(178811..178884),complement(178437..178766),
FT                   complement(177497..178391))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899759"
FT                   /orf_name="An16g00940"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46780.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG324656"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC980"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6R5"
FT                   /transl_table=1
FT                   /translation="MAPIENELHIVPCDYKSANGGGTTAGSSKANHVNRTQDMDEYLLK
FT                   NDLEFTPDGQYVRWAKGNKNHPRNWSATRKVYDIGLIFLLDLFVTATSTAGTSAASEAQ
FT                   SEYNIGNTLCTFCFVTLFLMGQVVGAIVFPPWSECFGRKKLYFISSTGSAVCCLIIGLV
FT                   HSLVAVVICRIVGGFLSAIPYTVGSGSNEDMFNSRSRIWTTFLWTIASNVGLLIGPIIS
FT                   ILVVEILHWRWVFYIYTIILAVMSAFFLLIRESRPALLLAKEVSRIRHETGHDSLQPLN
FT                   HDHSPDLRTFVKVSLFRPLQLFFGELLIFTMAMMIAFSFALVYIFTEALQPIYESMGFT
FT                   PSAAALPFLAVGVGVCFSTLTRILDFRIIDAKHAASEPVKPEDKLTGLAIGAPAFAIGL
FT                   WWFAWTIPPQAENIHWIVPTLSLVFIGYALNEFDTVLYGYLADSYLSYSASGTAAVQLV
FT                   RAGMSGAFPLFTRQMFDGLGANVAASLLAALATVFCSVPLLFVFYGERIRAKSQFAKHS
FT                   LEVQEQFVKQG"
FT   CDS_pept        join(179729..179761,179844..179968,180063..180223,
FT                   180349..180569)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659678"
FT                   /orf_name="An16g00950"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46781.1"
FT                   /db_xref="UniParc:UPI0000EFC981"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6R6"
FT                   /transl_table=1
FT                   /translation="MDRSIFYVASATATVLYVLEVVPRSFPILHRLPYVPGASACFRVW
FT                   QDRISISCSPAACRKDGFVTDVPRRQLKWSRRIILVNQLLKLGYRKRIVSKCSIARKKS
FT                   QGLGIDIGGPSSMGKEHWLNRNSGRMNERPRERYPVQGSPHIKKRPCGMLMTSQRGNWL
FT                   GLVQHPTSGKHKGDPP"
FT   CDS_pept        180699..181871
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899760"
FT                   /orf_name="An16g00960"
FT                   /product="Function: severin of D. discoideum binds to the
FT                   plus"
FT                   /function="actin binding"
FT                   /protein_id="CAK46782.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="HOGENOM:HBG328893"
FT                   /db_xref="InterPro:IPR007122"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="UniParc:UPI0000EFC982"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6R7"
FT                   /transl_table=1
FT                   /translation="MPPHEGLVHPKEYDIKDSNVELIGSDLDHRVKYNSAATEPAWNNG
FT                   SIGQEPGLFVWRIENFEVIPWPKERTGEFYNGDSYIVLHSYKVGDKLGHDIFFWLGSKT
FT                   TQDEAGTAAYKTVELDEFLHGTATQHREIEQEPSEEFLGLFRHISIRSGGVRSGFHHVE
FT                   PEAPKEILTLLRVFKHPTVGRSIIVHEVEPTWQSLDENDVFVLDKGDKIWVWQGKNCSP
FT                   MEKAKAAQVVNDMTLAKHIDVEVLSQLESRSRVIVDLLGGKEADPATFQAPRPGRFAKR
FT                   TDEGSDVRSRKLFRLSDSSGTLTFDLVKDGQRVSKSDLVGNDVFLYDVGNRLWVWQGSE
FT                   ASQREKALWLKVAQHYVRQLQNQLPEAHYIPIAKVVEGYESPAFMRAIEA"
FT   CDS_pept        join(complement(182385..182550),complement(182295..182344),
FT                   complement(182148..182219))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659679"
FT                   /orf_name="An16g00970"
FT                   /protein_id="CAK46783.1"
FT                   /db_xref="UniParc:UPI0000EFC983"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6R8"
FT                   /transl_table=1
FT                   /translation="MGLCMSLMGRNRRTYPSMGMGGGYGYPPPRPHYGGGGGMPMHSYG
FT                   RPHGPPGGGFEGDLAGDEEGDGRFEDKGIRGCINGGSGLLVYNAEFGVTR"
FT   gap             182727..182826
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(185028..>185066),
FT                   complement(183867..184631),complement(183390..183812),
FT                   complement(<182827..183356))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116659"
FT                   /orf_name="An16g00980"
FT                   /product="Function: the acr-2 gene of Neurospora crassa
FT                   controls acriflavine sensitivity. "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK97347.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EFC984"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6R9"
FT                   /transl_table=1
FT                   /translation="MHKDIMYQSQAYTRIKCDETKPSCVACSRRGYDCPGYRRDVKWSA
FT                   KHEAKGLNSESLSPSKKEPPMSWFTEPAEKLRLALLSDLRPPLDRSQPSTKRVEQCRTS
FT                   SRCDGRTDTPDHSTTNSDSALTLQTSDAETTPERQHNAKLTSSPTDSSTNLRAYYFSHT
FT                   CRLLSGYDSPTNPLREWVARLSNEHPVIESCIFSISAAHLSQQQREMTMLAASHHTAAL
FT                   ASLSAGIEALDKRRLSHPHDNAGFVLKNSESMTALLLGIIMIGKTSSWNNPSSLGLQHL
FT                   EAARTIFQSLYCESHSQSPSISGAPASDPRLARDFFVGALVYWEALTSFVVDNRTDAAD
FT                   YLLRFCDDENCVASVHPWSGVSPRLFISMSKIGSLARQAHHLRRASASPQRIQKDRREL
FT                   LSQGKHLEELFLSTGDPSTPVDDFQFLGYAYALSIMLELCRTFPELLRPDQRTPDYDTQ
FT                   RKHLNTLAITILTLIAKIPETSGTRAIQMPVLVIAGSTLQFQRIEDMDVDMEVFSDGAS
FT                   DPTHAPERVDIQFWRLFVDSRLDKMASYMGLDTVHRACRIVRETWARADQLLTNSSFHG
FT                   QAPIVHWIDV"
FT   CDS_pept        join(185503..185538,185598..186008,186113..186568)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899761"
FT                   /orf_name="An16g00990"
FT                   /EC_number="1.3.1.45"
FT                   /function="2'-hydroxyisoflavone reductase activity "
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK97348.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0047526"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG329511"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC985"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S0"
FT                   /transl_table=1
FT                   /translation="MTSPLKNVVIVGAAGNLGSRVLKAFLSSNAFNITVLSRDSSTSIF
FT                   PDGLKVIKSDYSHDSLVSAFKGQDAVISIVGNGGFSNQQKLIDAALAAGVKRFILSEFG
FT                   NNTADERVRALAPLLDGKKAIVDYLNERQDRLSWTALITGPFFDWGLQTGFLGFNLQSH
FT                   EATVYDNGTIPASVSTLAQIGRALVAVLQNPEATENQYVYVESFTVTQKQILGALEKAT
FT                   GKEWKVTDVDFEPLIQESTERFKGGDFSAVRVLLLASALARLPDGPYGSWEQVSGGSWN
FT                   KRLGIEYEDLDEVVGSLVN"
FT   CDS_pept        join(complement(188114..188327),complement(187628..188051),
FT                   complement(187163..187565),complement(186656..187087))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899762"
FT                   /orf_name="An16g01000"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK97349.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328895"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC986"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S1"
FT                   /transl_table=1
FT                   /translation="MTIDQMDPVVERKSLEKPIEQASPEETAIGDIDDVVLDPAKEKKL
FT                   LMKLDMAFVPIIMLTYLSCFLDRSNIGNVKVAGMPEDIHASDSEYSTAVSIFYATYVLL
FT                   EAPWAVAMKKLTPRNILTGLCIIWSITTVFTGFIHNVASLYATRLILGGCEAGLFPCLN
FT                   LYLTMVYRREEQAKRVSYLMSCAAISGAVGGLLAYALLHMDGVGGKAGWRWVYIIEGLF
FT                   SLVCAILIWFGLPNDPSNAYFLTAEEKYMMRVRNEQRRKYMGSEHFSWEEMRIALRDPK
FT                   LMFSALTQFCQDILLYGFSTFLPTILGSLGYNSLMSNVLTVPVYIWAAIVFIAVAFCAD
FT                   RFGRFSIFILVTNIFGIVGYILLLTVSNDAVKYFATYLCGVAVYTGVGLNVAWLNVNVA
FT                   PQYRRALAIGLQQTVGNCAGIVAGQVYRTSPYVLGNAFSLGALVVSQVIVALHAVYLRR
FT                   ENKVKEEILAGEKEDTRRVKTGDGEVEFRYHT"
FT   CDS_pept        join(188878..189609,189685..>189823)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000136024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899763"
FT                   /orf_name="An16g01010"
FT                   /protein_id="CAK97350.1"
FT                   /db_xref="HOGENOM:HBG289473"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="UniParc:UPI0000EFC987"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S2"
FT                   /transl_table=1
FT                   /translation="MAITQTPETLSSQETRLLARQNTITNTAGYSGNNLQANLLILPEK
FT                   HSQDFHNLCLRNPVSCPLLGISSIPGNPHKITPTPCIQNRDFDIRTDCPSYRVYKHGKC
FT                   IAANKSDLLDLWSTDDPNAENYTAFLLGCSFSFEAALCNATPPLTPRHQLSNTIVSMYR
FT                   TSLPLLPAGIFTNATCIVSMRPYHESEVERVRDITRPYLATHGEPVDWGWDAVKRLGIR
FT                   NIHDPDFGEKIEFKDGEVPVFWACGVTPQMAIEAAGDKIDGLVFAHEPGNMLVTDWVVE
FT                   DLERLKEGI"
FT   gap             189824..189923
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(192104..192213),complement(191911..192033),
FT                   complement(191102..191858),complement(<189925..191049))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965646"
FT                   /orf_name="An16g01020"
FT                   /product="Similarity: the ORF is shorter than the
FT                   hypothetical nuclear protein of S. pombe "
FT                   /function="DNA binding"
FT                   /function="protein kinase regulator activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="CAK97697.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG324365"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFC988"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S6"
FT                   /transl_table=1
FT                   /translation="MDGHSIEPWERLPTDDPGDRDETRPRKRRRKYIAKACNECKRRKI
FT                   KCNGQSPCQRCGRQRIDCVYESPPRPESSTQNHETLDRLLIQMTAMQEQITTLTTAVHA
FT                   LTQNTLVSPATALPRSDVASQRPFRRHSSIKEKESVFQGPTTSAYSLDLAKSSLQRRGI
FT                   VEEHPDVADAEDGDVDGDEGGLTQADRSAMIAMPVPASPPRTRHHPAGDPLWTIGKTEA
FT                   LRLCRVYEEEMGVMYPVLELSQLLHQVELLYGAESWPRVPVVQGPDGPEQLDRTDVHIL
FT                   RLVFACALTAEAAGSSALAMSLFESVREVADNFVWGAAGIKNIIFLTLVAIFYFQIDEE
FT                   TLAWRTIGIVERMCLERGLHRRETLSQPSIIKAGKDRVLRLFWSIYILDIRWSFGTGMP
FT                   FSLEDSDIDPWLPEPEEKTPYLCVMIRYSRIAAKVWKFISAFNNTNEIKKEEMNYLDWQ
FT                   VQRWAGDIPPVLRIESHQGHKDEEEPRSLRRLRSLLYLRANQLRMLIHRPVLHSAAHIA
FT                   KYPAESQTVVELAKESIRFITNLNETTDIYRLQQVTFNWFLVSAVAVVFLAVTQAPTQF
FT                   STTCKDEFYTALELIKGFSTRSYISLRLWKSIRSLRKLGPQLMHRPVQSQPEPEWRGVA
FT                   VPAERGDLGNVVEVAPSQSTGTQEQSPLDGAQMTRELMEWFEAVGNLETQIMGMAPEGF
FT                   DAGWQRYDYGE"
FT   CDS_pept        join(complement(194184..194402),complement(193473..194106),
FT                   complement(193100..193422),complement(192675..193049))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161565" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899764"
FT                   /orf_name="An16g01030"
FT                   /EC_number="1.14.14.1"
FT                   /function="aromatase activity"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK97698.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="GO:0070330"
FT                   /db_xref="HOGENOM:HBG396996"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0000EFC989"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S7"
FT                   /transl_table=1
FT                   /translation="MAVQTILIAAAAVIYFLVRYMNRTDVPKIKGIPEIPGVPLFGNLL
FT                   QLGTQHAVVARKWAKSFGPVFQVRMGNKRVVFANSFDSVRQLWIKDQSALISRPTFHTF
FT                   HSVVSSSQGFTIGTSPWDESCKRRRKAAATALNRPAVQSYMPIIDLECTASIKELFKDS
FT                   QNGARDINPKAYFQRFALNTSLTLNYGFRIEGNVNDELLHEIVNVERGVANFRSTSNNW
FT                   QDYIPLLRIFPKQNREAQEFRERRDKYLSYLLEILKDRIAKGTDKPCITGNILKDPEAK
FT                   LNEAEIKSICVTMVSAGLDTVPGNLVMGIAYLASEDGQRIQQKAYDEIMTVYPNGDAWE
FT                   KCLVEEKVPYVSALVRETLRFWTVIPICLPRESTKDIEYNGATIPAGTTFFMNAWAADY
FT                   DEDHFKMPEKFIPERYLDVGEGSGTPHYGYGAGSRMCAGSHLANRELFTAYVRLITAFT
FT                   MHPSRDLADRPILDALECNEIPTGLTTEPKPFKVGFTPRDPTKLQQWIAESDERTKDL"
FT   mat_peptide     join(complement(194184..194333),complement(193473..194106),
FT                   complement(193100..193422),complement(192678..193049))
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S7 "
FT   sig_peptide     complement(194334..194402)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S7 "
FT   CDS_pept        complement(195976..197604)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965647"
FT                   /orf_name="An16g01040"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK97699.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325037"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC98A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T3"
FT                   /transl_table=1
FT                   /translation="MDTKELLEKPSGKEGALSPDRQPENMHAEHATQPDDDSEIQGKFH
FT                   GPVKRELTEDDCYEKLGFCFPWHKKWTILTVIFVVQMSMNFNSSTYSNAVPQLSEHFHI
FT                   SEQAARVGQMIFLVAYAFGCELWAPWSEEYGRWPIMQLSLLFVNIWQIPCALAPNFATM
FT                   VVCRGLGGISSAGGSVTLGMTADMWEPDDQGFAVAYVVLSSVGGTTIGPIFGGMMQQWL
FT                   SWRWNFWIQLIFGGITQLLHFFLVCETRSTILLDREAKRRRQTGEDPNVYGPNEFKPSR
FT                   LDIKEVLHIWRRPFEMFLCEPIVLFLSLLSGFSDALIFTCIESFSLVFAQWGFNAVQIG
FT                   LCFVAIVIGYLFAYGIFLPDIYRQQVVRRREGNASRYTERRLLLLLFIAPLETIGLFGF
FT                   AWTSMGPEYTHWIVPLVFVFLIAIANYGIYMATIDYMVAAYGEYSASATGGNGFARDLL
FT                   AGLSAMYATPMYTNIGGRFHLQWASTILGCLSVLVTVPIYIFYWKGPEIRARSKFAQTL
FT                   EADRQRHAAVRRSSQVTISRKASMA"
FT   CDS_pept        join(complement(198632..198828),complement(198300..198504))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965648"
FT                   /orf_name="An16g01050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97700.1"
FT                   /db_xref="UniParc:UPI0000EFC98B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T4"
FT                   /transl_table=1
FT                   /translation="MRRDQCPFLKARDRRHQLGCTLHNVHGKELFDVDCLEAAPRNVAV
FT                   LGFSRRCNVLEPAMPFGRPMRVTCSKNVDIIPLQTGFVKRFASGMASWVISEGGWTKQC
FT                   SRFWMRSLLGLPLWAPRQALEPLIGATPQ"
FT   CDS_pept        join(199065..199197,199393..199706)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899765"
FT                   /orf_name="An16g01060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97701.1"
FT                   /db_xref="UniParc:UPI0000EFC98C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T5"
FT                   /transl_table=1
FT                   /translation="MLTEPKTSRVGIGRAGETLFVRNVTLLNWPYWSSNQSPIEDNRMV
FT                   PDWSLVAIRGTCAIDAIPLAVLAWVRQDVTFLACNPGGASRHEGRNGEKWARNEEGKEK
FT                   KGSLPCALGKCCPPYPGAPKHSSSGRQNSSPPSAISHHIYLHSA"
FT   CDS_pept        join(complement(202765..202833),complement(202631..202713),
FT                   complement(201923..202587),complement(201746..201875),
FT                   complement(201492..201695),complement(201267..201422),
FT                   complement(201036..201210),complement(200498..200929),
FT                   complement(200320..200406),complement(200151..200240),
FT                   complement(200017..200076),complement(199752..199898))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899766"
FT                   /orf_name="An16g01070"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK97702.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFC98D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T2"
FT                   /transl_table=1
FT                   /translation="MPATERRKRVSIACIPCRKKKCRCDGQKPICQVCEREDRDCGYTY
FT                   HLEKRNPRPPTKCYIHALHSRIAFLEHQLATARNVTDNSTFSTFGSDKPEEALNPPSVE
FT                   HTSQALSGFRLDFRLSGAYGLFCSGELDEQMRNSSPVSTSKDDKSLSEDPILVPYDLQA
FT                   HLLEEFWTWRNTWPVLVHEPLFQQDLTNGGVGSYATPTLFAAILAYSAHYAGETQLHAW
FT                   GISSEALAMHAKGKILAQLEYPSLSLVLAAALMALRELALDRLSSASQYIGIAFRQSLT
FT                   LGLHVLSTMNELTQGSKEVQEAKSLAWWGVWLLEKHIAQILGQPSAVREGDMYPGPVPI
FT                   IPSIEYRLWPSSDSSAPELMYSSMSNFQYACNLLRMVSPVLDEIYAFTYSVSIQEREEK
FT                   ATKIHVAMSEFYNNLPSTLRLPATATKQPSPPVYQFNLLYHTLKIMLHRPFIKAVPSMH
FT                   DLEEMKCPDMVHIQSATFSAIRITSIVNAYRNLYPLEALSPLAVHSLAISSLMHLLNAK
FT                   STDTTLSQRTTHLYRLNLRFLGQLSSTNNSSHRAIKALTFLEREGNVSVHPNTMKSSVW
FT                   RRGAECDGSVSAGQTGTPTTTLESMNISGHLDPMENAFDWLQLPLNGQLIFDDVIEGSL
FT                   WEEIFCDNPRQAEMGQKTRPGVFFSGPGKQKPGALDLANLFCHVCRVPLLYHAPVFASL
FT                   GQPITGSIGQVGSGLVMGCPYRAARLRVRHTLTDLPSAGALWIRDFWLLFLTMGKNWAS
FT                   SSCRGDGLNDAA"
FT   CDS_pept        join(complement(204164..204199),complement(204015..204101),
FT                   complement(203807..203962),complement(203208..203750))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15899767"
FT                   /orf_name="An16g01080"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK97703.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFC98E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T6"
FT                   /transl_table=1
FT                   /translation="MESYLKGRTAVITGASMGIGEAIAMTLAEKGMDVALLARSGDKLE
FT                   AVKARIESKCPDVNVRAYSVDIQSHAEVNAVVKLIVSALGDIEVLINNAGLALGAPGRF
FT                   WELPIEMVEQMNGTNITGVMYMTHSVLNQSMWPRKRGTIINVSSVTGLECPPFEGEAVY
FT                   HANKACLEAFTNSLRMETAGSNIRVSVLRPGCVVSHFHLQRVKYDQNAMDEFFYGYEPL
FT                   VPEDLAEAVWYMVSCPERITIKALDCVPTAQRALTRFDREWNARKDGENKA"
FT   CDS_pept        join(204559..204582,204625..204935,204993..205200,
FT                   205257..205460,205521..205811,205871..206047)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000132894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899768"
FT                   /orf_name="An16g01090"
FT                   /product="Catalytic activity: An epoxide + H(2)O [ "
FT                   /EC_number="3.3.2.3"
FT                   /function="epoxide hydrolase activity"
FT                   /biological_process="response to toxin"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK97704.1"
FT                   /db_xref="GO:0004301"
FT                   /db_xref="GO:0009636"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG714190"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="UniParc:UPI0000EFC98F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T7"
FT                   /transl_table=1
FT                   /translation="MANVRPFTEYLKVHISEALLEEVKAKLKLARLDERMGEVEWNDLE
FT                   IGHTNIKQLVEFWRDEYDWRMFEVFLNTFHHFKTLIQVPGFDVLDIHFLHHRSSRTNAI
FT                   PLLFVHGWPGSFLESLKIIPLLTEPPEGRQAFHVVAPSLPGYGFSDFPRKSGFGLEQYA
FT                   DCFARLMTTLKYDKFVCQGGDWGSSIVRYMALGHPDKVLGIHINMFLALPPSPESSPEK
FT                   FRRYQDMAYDTQELKNLERTRWFGHNERGYQRVQETKNVTLGYALHDSPVGMLAWLVGK
FT                   LKAWTDDYPWTKEELIHWTFIHYQGSPSAAMQIYKEAEAVLNEDRNSMLGKYISQPVGC
FT                   SIFPKELWLYPRDWMSETCNIQFWRQHRSGGHFIAWERPEALVEDVAEFFDKEGPVIKN
FT                   VVSHG"
FT   CDS_pept        join(206439..206556,206713..206762,206866..206899,
FT                   206985..207130)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899769"
FT                   /orf_name="An16g01100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97705.1"
FT                   /db_xref="UniParc:UPI0000EFC990"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S3"
FT                   /transl_table=1
FT                   /translation="MSVSLTIPTWNPGKLSFRQGELHGMGTYYKGLLGGHCWCAMNRTK
FT                   VSEAHSTTGLRGSPNGSVCPVQGLLLEGKPGTAGDGDCLLARSSDLFLAFIALSLSWGE
FT                   FASGPIGRRQR"
FT   CDS_pept        join(207426..207485,207557..207782,207896..208155,
FT                   208212..209219)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965649"
FT                   /orf_name="An16g01110"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK97706.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EFC9B8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S4"
FT                   /transl_table=1
FT                   /translation="MVFPGRLSTGCYVCRRRKVKCDGARPACRRCVTQGRQCTGYPDAF
FT                   AFREYKATKGPQTGKAVARKRGKKTADGEQPSSGSASPSAAVSDQDGTDTQKSPCEGHL
FT                   AFLPELYQEKGNDPSLRHAILSVSYLSLFNTARVNELYVNARKHYGVALKSLTASLSNK
FT                   ETSTQDETFAAALFLSMFMDLSGERQGAVNPHIPGICSLMHLRGRPQRSSKYARKLFGW
FT                   AFTQIVSRPTVITVPIVDRDPALQQIQAVANNQFAYACLPASINMAYNPDYVLRSGIIT
FT                   SMISGFCQGASEFRRTEHNYPPTARARLLHSLLGRAYFIMEQISIWDEAVPQHWKRQFA
FT                   TPAMGHLNHAEQAASRDPWTPCFLAVVQAAQILYFIHVFECWEKFVPLASAIKDEHLEN
FT                   FPVETFSGIDDRIRGLIDVICNTVTCTLGHITPKHEFQLHPNSKLANGYTLLWPMWVVV
FT                   NSGLATPDQLDLCRLALECVGSTMGYRLASVLCADGRPEEPRSSILEQSPMTRSLTVVQ
FT                   "
FT   CDS_pept        complement(210134..211522)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812480"
FT                   /orf_name="An16g01120"
FT                   /product="Similarity to hypothetical membrane protein
FT                   YPL277c - Saccharomyces cerevisiae "
FT                   /protein_id="CAK97707.1"
FT                   /db_xref="HOGENOM:HBG328316"
FT                   /db_xref="UniParc:UPI0000EFC9B9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S5"
FT                   /transl_table=1
FT                   /translation="MTTATTALAIGEPQPMHNANHIFNAIHSSMRQWGSSLHHNGMSFF
FT                   LASVPKGVKLYHGDARSDPISRIGWMAFDPEHAMVFARPPSKLPSHGMDSESQQVMITP
FT                   AETGWLHTYATTGDLRLVYIDGTSAGKSQIGTLDLQDRVLFEDKLEPGGVSQESARAQA
FT                   ICEIAQEEWNGRIDGVIRMAAGFEIILCNPEQNLETVTIARVTLPSRDPGKKSGKPSDL
FT                   LRTVTSRYHGIGGDRVIVNYDAFVTAYDYGLDLFPGGSKHPRLAHLPASSLAPIRDDLT
FT                   ALVMTHNPTIRVINWQAVADMVVEKYGRILRGLVSAQHDDQAAHLEFVVEAAERILSPF
FT                   VDRDNRDYYAEIDRCASQFIPVHAPKNSLGYRSVYTVSSRICSSLMAVMEAEEYSTATN
FT                   ILQELMHYLDWSVWKECSGCQDDEFCAVPIWPQGSQEDYDHPRCQKFDSAFQGDNDYWG
FT                   PVWH"
FT   CDS_pept        join(complement(213425..213452),complement(213226..213395),
FT                   complement(212724..213169),complement(212155..212659))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159782" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899770"
FT                   /orf_name="An16g01130"
FT                   /product="Similarity to hypothetical plasma membrane iron
FT                   permease - Schizosaccharomyces pombe "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK97708.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325002"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniParc:UPI0000EFC9BA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S8"
FT                   /transl_table=1
FT                   /translation="MANKVFAVTVLQGIRSPIQCSHSTVFFICFRECLESVIIVSVLLS
FT                   FLKQTLGGEGDVKTLKRLNRHVWCGVALGLFICLCVGGGMIGAFYGLNKDVFTGSEDIW
FT                   EGIFGFIASIIISIMGAGLLRVSKLQDKWRDKLAQALEEKEKTKIGIYQRFKDWSKKYV
FT                   MFLLPFVTVLREGLEAVVYVGGVGLGLPATSFPLAVVCGLAAGIAVGYLLYRCGNTASL
FT                   QYFLIISTCFLYLVSAGLFSRAIWYLQNNAWNNIIGGDASETGSGAGSYDIRQSVWHVN
FT                   CCNPELGSGGGWGIFNALFGWTNSATYGSVLGYNLYWICIITGYVCMWYNERYGYIPFF
FT                   SACMRRIRPKKAASRSSSEGVIEKSKEVDMMPSQIVTREVNA"
FT   CDS_pept        join(213847..213890,213960..214211,214495..214600,
FT                   214739..214841,214973..215217,215318..215444,
FT                   215624..215765,215840..216071)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899771"
FT                   /orf_name="An16g01140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97709.1"
FT                   /db_xref="UniParc:UPI0000EFC9BB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6S9"
FT                   /transl_table=1
FT                   /translation="MAIAACKGSQEAWPCDWFTGVMGMDQINPTQPKKWCPIGGWLKFG
FT                   LIVGCNDTVTVFRILRRLAKRCAKTWHFHGFTMDSAPSTTTTTYTEACAAVVSRDARVP
FT                   KAEIFSIEATHTNQQYTHLTSALSPSLEAPAPECPRITVMCIEQRRFFGGSSGTIDVKL
FT                   PPFHTKLSLGISAADQWDRHTGNSLLTCIPFLLWVMGPSMNRRRGGIDCLTRTWVDTGC
FT                   QGHRAKFGLPPDMVVTPSDLHCKTAYSQRTAYALSHNVMTDQSEPHTSNIQSNHEDNVV
FT                   PRSKDHHNHTMRPEADTPSTISKSHLPSHELKPGDDRRPVLRSTIAKHDLPAGGILQVG
FT                   SFGDIGLGSPHGWWAPSSVATDTGSCERHRAAFRTIRHTYTWLDRYFRLINLFPLGKST
FT                   IWVNGSWAKFNGPVDGV"
FT   CDS_pept        join(216323..216928,216981..217366,217425..217657,
FT                   217724..217776,217834..217955,218013..219033)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899772"
FT                   /orf_name="An16g01150"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK97710.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327228"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI0000EFC9BC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T0"
FT                   /transl_table=1
FT                   /translation="MRSQAAILLGLSWAVSPVLAGQGLTMSAPNLADYCFYAIYSSIGS
FT                   YTFEGATSTSSSSSSGQGSSSSQSSSSNSSSASSHGSSSSSSAHRRRALREKRGHHGAS
FT                   STGGCTSTVGVMSLYASAKAWCNEEQFNSAIPTYWESLCEQSSVSLISLTEIEANATDE
FT                   YIASLPVIDPETNSTTTTGTIESPVLLSHSYYKRAYKSYVTHDYALIKDKRYGWGLMGY
FT                   WGGVLALGMIVKAWKFVRSSMRLSHSGDAEKNSAGPRSKAFAPVAAVAHFMRTYFVIPA
FT                   SFAPYLSNHQQLFLFHTIPKRLDMLIVFGFWAVSIILSCVNYQSFTGNISTPSLFQQNW
FT                   QYSSDRTGVLSYACLPFLWLFAGRNNIFLWATDFNVQSFNIFHRHTAWVCTLLAIVHSI
FT                   AYTVVFQVYDGRYHSALEQNYFYMGIVATVVMAVMLFQSTTWLRQKFYETFLIIHVLLA
FT                   ILTIYALFRHTSFDGTVYNGYLWPMVAIWGFDRTVRYVRMLYCNLHVKFGKGFISTTSS
FT                   TVTYSPESDLIRIEMYPASQTLKPGPGQHYYLYQPVTLRGWENHPFTLGCYENANSKED
FT                   SSKLIFYIRPYDGWTRRLRDQCQKAGTEIRPKLLLEGPYGHQAPLHTFDTVLMIMGGTG
FT                   IACAVPYILDHISRVEAGKTNTTRIQLIWTGRQKKIFDEVCCRDLSAALEHSDITTTLF
FT                   CTDKSAAGNVIDSGATTPTKEKEAVADAMALQDRSSGSIRSVEDLNVELRYGRPAIRAS
FT                   VMTAVREAEASSARLAVITCGPAVMADECRSSVYEVMKGGFQDIEYFEEAFGW"
FT   sig_peptide     216323..216382
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T0 "
FT   mat_peptide     join(216383..216928,216981..217366,217425..217657,
FT                   217724..217776,217834..217955,218013..219030)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T0 "
FT   CDS_pept        join(219604..219640,219684..219757,219862..219945,
FT                   220042..220082,220171..220255)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899773"
FT                   /orf_name="An16g01160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97711.1"
FT                   /db_xref="UniParc:UPI0000EFC9BD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T1"
FT                   /transl_table=1
FT                   /translation="MEWGCRASEPRLGNSFAPGLGWTKDLGEGLARSSLAVRDKNIVIT
FT                   VPQKVAATSSPAQDSPKRLLTLPRRSSFHRGTRLKECSLDVPATCPEDPCLLQSATCKV
FT                   LV"
FT   gap             221024..221123
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(223080..223196),complement(222796..222996),
FT                   complement(222521..222625),complement(222239..222463),
FT                   complement(221982..222136),complement(221427..221927),
FT                   complement(221242..221352),complement(<221124..221176))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965650"
FT                   /orf_name="An16g01170"
FT                   /protein_id="CAK42734.1"
FT                   /db_xref="UniParc:UPI0000EFC9BE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T8"
FT                   /transl_table=1
FT                   /translation="MDYYDGGPFARDYTAQLINASNRGSFSRCWAIIYRVALLFTPLPY
FT                   PLLGFHASARAPVSAMELFRRLPHIHYALNLREIGIRAIYPATQHAPEHVDEIAIATIY
FT                   LMIFAVAQCAVILVGTEHGLGKRKLSLNDTEVQILEKVLYSSNILYVLALNLAKISVLL
FT                   LLNRLAVNRWHKKILFWTSVLVGIWTVPVFFTLAFQCGVPEPWDASNGHCIDIILTQFA
FT                   FWAGISPIDIITELVICILPIYIVKPVQVIFGKKVTVVVAFFIRIFVVITTIIRLIFMR
FT                   YSKPYPSTDMNDAAFATTITTECVLCVSIMTACIPCLKPFLDAFDSGMLNVSLHKRIGG
FT                   GSNSNSYGNTYALTSMTKGVKESATRSRYLEDEIEGLGTSAAAFAVTSPGQPLGRRDST
FT                   LVIQRTDQWSVRCEYVDPKDGSVGDETEQSERNVARISADRSMGLPRRILYPEWRSCLC
FT                   NYVRIPYNLLFSHSQGTLAESLAARRRRRRY"
FT   CDS_pept        join(223691..223783,224058..224121,224197..224300)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116660"
FT                   /orf_name="An16g01180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42735.1"
FT                   /db_xref="UniParc:UPI0000EFC9BF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6T9"
FT                   /transl_table=1
FT                   /translation="MTVCQPKSSSPPHSTGAHGRPHPGAETIPKEVAPMEVERKSQPFA
FT                   HSERHYYRFIPRHVSGFEGFPSLASSATGAATGPYPKARAK"
FT   CDS_pept        join(complement(225136..225533),complement(224478..225027))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000191043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659680"
FT                   /orf_name="An16g01190"
FT                   /product="Catalytic activity: acetyl-CoA + an arylamine  "
FT                   /EC_number="2.3.1.5"
FT                   /function="arylamine N-acetyltransferase activity "
FT                   /protein_id="CAK42736.1"
FT                   /db_xref="GO:0004060"
FT                   /db_xref="HOGENOM:HBG324716"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="UniParc:UPI0000EFC9C0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U0"
FT                   /transl_table=1
FT                   /translation="MGSKIDWAARPTYSLEQLGRYFDRIGLPDKYREALLLMQDEAELN
FT                   AQSALALLKALQRYQLAAVPFENLNLHYAVHRSISIDPHKLFEKIVDSNSRRGGYCMEN
FT                   SVLFGTVLRSLGYEVTAVGGRVNEAAQPMNHMVNIVTIDEQKYLVDVGFGSNGPHQPLP
FT                   LVQNYEFHNVGEQSGRLVYGPIVQHTSRGQSLWQYEIRNGDSQWIPAYCFTEMEFLPED
FT                   FTIINYYMSTSRESWFTFHVVCVRMLLDEDGDKIVGDLTLFNDTLKERREATSKVLEKF
FT                   TSDEQRVLALERVFNIHISAADRETIRHTISEIL"
FT   CDS_pept        join(226609..226716,226762..226832,227056..227516,
FT                   227572..227595,227654..227979,228040..228528)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812481"
FT                   /orf_name="An16g01200"
FT                   /product="Function: CTR is the sole choline transporter in
FT                   yeast"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK42737.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG325555"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EFC9C1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U1"
FT                   /transl_table=1
FT                   /translation="MSFKHGEMAIQELGSRQYKDRDDEDMAKFGRKQRFERNFGFLSML
FT                   GFTTTMMCTWEAVLTAPTSAGQYHWVSILAPKGQAVFLSWVTGWLDMIGWWANTASGVY
FT                   FAATVLQGLLVLNYDGYDFQRWHGTLLMFAALVICLLVNSFGARLLPKIEGLILILHTA
FT                   GFLAILIPLVYLAPHKNAEFVFANFTNTSGWKNSGLTWLIGLMGTNLPFIGYDGPCHMS
FT                   EEVVNASVIVPWCMIATIMLNGTLGFAMVLAFLFCVGDLDAALDSATGYDFIEVFFNAT
FT                   KSHAGTSVMSAIVIALTICASFGFLASSSRLTWALAKDKGIPFADFLSHISTRTSGSAL
FT                   PLRAIAFCAIITAITCLINIGSSAAFNAMISLTTAGLFSSYEIAIVLILIKKLKNEPLQ
FT                   YGPWKMGRLWGILINIGSICFLTITIFFSFFPEELPVTPTNMNWSVVVFMGEFLLGLGW
FT                   YLVRGRKIYHGPVMDVPVAVGEGGVVGGDGGDDE"
FT   CDS_pept        join(complement(229860..229934),complement(229440..229812),
FT                   complement(229265..229382),complement(228804..229212))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899774"
FT                   /orf_name="An16g01210"
FT                   /protein_id="CAK42738.1"
FT                   /db_xref="HOGENOM:HBG326047"
FT                   /db_xref="UniParc:UPI0000EFC9C2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U2"
FT                   /transl_table=1
FT                   /translation="MLLRLIAKHRIRNLSWDDAIMILAYTLAIASSVLITIAISHGYGR
FT                   HAYELDRSDRVLTAKLYTIFQCVSILSTGTGRLAFVLYLLPIFRHKYLMGHILWLIFAL
FT                   QLIANYVSPVTILVRCADIRAIWDITVKSKCWDPKILITYSYVQCTINTATDLYLAIFP
FT                   AYTLWSLNLKRRTKTILIILMGLGLVAMVGSIMRIISLPSLSIIDDQSAATNRLTIWAL
FT                   LECYLVITTASIPCIRTLVMDSVRLLVNSSRSRSGREADSRRTRQNTWGDYPISRSYRV
FT                   AVGDDVEDRRHMLGDVELGRYGHNGISKLVEVTVAEEAIPKWI"
FT   CDS_pept        join(complement(233579..234139),complement(232641..233507),
FT                   complement(231330..232571),complement(230909..231028),
FT                   complement(230548..230637))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116661"
FT                   /orf_name="An16g01220"
FT                   /product="Similarity to hypothetical protein CAD21096.1 -
FT                   Neurospora crassa"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAK42739.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniParc:UPI0000EFC9C3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U3"
FT                   /transl_table=1
FT                   /translation="MDGFGAPSHRRYFDVAIICALQVEADAAENLFDHFWDRNGDQYGK
FT                   ADGDQNSYRTGVIGNHNVVLAYMPGMGKGNAASVAASFRSSFQGIRLAIILGICGGVPN
FT                   GTKDGIFLGDIIIGSDLVIHDLGRKLPGCFRRKEGITDPAMNLEVRAFLHKLSSQRGRG
FT                   TLKERTHFHLGTLQGRANGYCRPKDDHCKKAHDAPCEALGCDPAKLIHRFRPSPNQISI
FT                   HFGRIASGDTVMKSGVDRDRIASRDTIIAFEMEGAGICNNLPCIVVKSVCDYADSHKDK
FT                   AWQEYAAGAAAACMKSLLEQWAAVDHLDKRHEIHKVPVQVAELCSFNNSPQTPSSNGDE
FT                   ANNSQRYHEETSTDILKGNTAFPSWSFGLYLTLAVLSTTKSNFKSAIDCLKKYRKFLPR
FT                   DTDLKRILKNQRLIMTDILEYLETDISVSVDEHLGSSKETCLQLAAEIKRKLEEIEIIT
FT                   NGLLATTKAKVQSESPLKNAVEDLGSIVGVLRSEISREQTPRSSDEARMTRTVIEHYEF
FT                   QQFRIVQQAACNLYDAFRTACHAHSVHDVHLSLKPDLKGTLTQVRFNLALIQDPSVTTT
FT                   GKAVWISVESSIKPSDDSFQSSFSTFSTPSTSQKRSRVCEEGPCPPRIKRVQFQQLEAI
FT                   SGPVQASSQEKTPITIPKLFLQRNLCTLVQRSLCQGGSGGCIGLLRDDETCKHLAYIDT
FT                   QTNSSTTSASSLAQLLSRSASKPTRDMGPYECVQLAKYLATAVLYYHATPWLQKAWRSN
FT                   DVHFLGDHESLLQQTRQALPYITTSIQASASVDSTNTESFVYRQLIRNPVLFGLGIMFI
FT                   ELTHQVPITALEEHVDQVKGGTRDFVEYFTADRLVTHSNQIVSNGFREIIRKCLHCDFG
FT                   HNSDFSSPALQEAFHRDVILLLAGKQVITTKALAVNPAKSLSMYMGPGIRERRYAFAPP
FT                   TGEELGPALWSHGYRQKLVLGPESRTLDG"
FT   CDS_pept        join(234387..235069,235124..235459,235515..236554,
FT                   236656..236948)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812482"
FT                   /orf_name="An16g01230"
FT                   /product="Function: brlA has a direct role in the
FT                   regulation of cell cycle genes"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK42740.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EFC9C4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U4"
FT                   /transl_table=1
FT                   /translation="MAEAFEDSTKLAEDWLTYRTDQSTLDPNLGFVELFYQTCSAALVH
FT                   LWRSHFRSTIRGSHRNTLKKDVANIDLWEENFPIGHLDTILGRSQPLKLNVIENLKGIG
FT                   NVLRPYFAIYDSSTHAGNGRDVAQDLGQELVTQLEKAVIILDEAASDSSSDDDSSDNLS
FT                   ESSESEYNRFGRLHCYVNCLMELVPVIERNISRLKKEEQSQHVPLQSEFRLSQDAQPFA
FT                   MRIRDRFISASTLLVERLAEANLERSIRIRENEVDDEVLDALTLFKPDSQFCDSAIGTS
FT                   LAPTSRYAATTASHTSFLSVTGDEGKGRPRVPPLPVVGGTFRCYYCGDYVSMPNRIYWK
FT                   MHVYSDLESYLCTHEDCRDSFKTFRSRKSWMDHEYIAHFSQCLWRCCTCNYTAYAEREF
FT                   IDHLVKVHSLDIAGSLLKTTVSRAEERVLKPQFKDHKCALCLESGWKSKKEYATHVGRH
FT                   LEEVSLACLPIEEEEVSDVDSNADRWTNATNGSGHEAEIIDETSEDDYALAYPKLGREI
FT                   FGVSHPSKRTPSKGSKSLSLENLPSSIQQFQFKCKEPGCKARFKRQEHLRRHMKSHSKE
FT                   KPQVCWVPGCHRAFPRSDSLNAHYTKTHSKRGGRNRYVATLDENSSDYNPEYRGPLTPD
FT                   GRPIWGSKLEDPNPDCGNLSVEGQLPVAEPETYEIPVGKNLLNTAKPPVSPVYAPSHDT
FT                   ATQNIGQEHGKCVVSAHDSEGLTSCRPAGRLTQARLRKPTASEVAVFIVTFTTEEIQKM
FT                   LGHISLRRLASQERFIVFSLAISASTKDIL"
FT   CDS_pept        join(238049..238165,238231..238319,238398..239268)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965651"
FT                   /orf_name="An16g01240"
FT                   /protein_id="CAK42741.1"
FT                   /db_xref="UniParc:UPI0000EFC9C5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U5"
FT                   /transl_table=1
FT                   /translation="MHLRRIFVLTVLSYVTALPSDINLGVALRGCDVEACDMECRMAGS
FT                   IGGNCGGNPALNLLGLPLLSTNTPNSSSAGPVTLAATETLTDVESTTTTKTTTDRESVT
FT                   ATETTTDIESTTATQTVTDTHLLTVTKSITEKQPTTATQTATDTKFLRTTQTINNTLTA
FT                   TQTTTDIESLRVTKTKNNTITATQTTTDIEPTTATQTINNTLTATQTTTDTESYTAMEI
FT                   TTATASFTTTQTTTDTESITATQNITDTQTIHHTESLTATRTITDTDSVTATATPTTVT
FT                   DTQTSISTTTATQTATPTPEVGACFCCTEQVRLPYELNGNCDNIPVSNSTDGCPSGDDP
FT                   KRNHLLCCDSSGYCTQLS"
FT   sig_peptide     238049..238099
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U5 "
FT   mat_peptide     join(238100..238165,238231..238319,238398..239265)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U5 "
FT   CDS_pept        join(240317..240487,240564..240693,240787..240913,
FT                   240988..241768)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899775"
FT                   /orf_name="An16g01250"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="CAK42742.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="HOGENOM:HBG326641"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="UniParc:UPI0000EFC9EE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U6"
FT                   /transl_table=1
FT                   /translation="MAQTIADVTATVKAALTKLSPTDDIPDSARFELLDVLDQLRAAIE
FT                   PPIQTVLNICWAHHPLVAIRTAIGMGVFDAFVASGGAELSLDQLDEKTIGDKDLLVRIM
FT                   RLLVANRLFTETGVDKYQPQPLALAFATGAPPSEVIKNFHVNFRASAFTHDFLEARGYR
FT                   SPDDAYDTPFQLAYGTKLHHFEWLAQDPAEQHAFNTVMETSNRAVEGAQWYDFYPWQER
FT                   LSLATGDKAQESRVLLVDIGGGKGHDLQAFKQKKSPAGRLVLQDLPEVIRDIKEPLAEG
FT                   VEAVSYSMFDVQPVRGAKAYYMRTVLHDWPDKQALQALHRVREAMADDSVLLINENTIP
FT                   ETGAPKFNASVDLIMMNMFSSLERTDKQWLSLLERAGFEVVKVWRSDDQGTGSNALFEA
FT                   VRV"
FT   CDS_pept        join(complement(244975..245325),complement(244399..244945),
FT                   complement(244071..244156),complement(243469..243998),
FT                   complement(243180..243333),complement(243005..243060),
FT                   complement(242844..242860),complement(242448..242581))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812483"
FT                   /orf_name="An16g01260"
FT                   /product="Function: TPO1 is involved in the resistance of
FT                   yeast to polyamine toxicity"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK42743.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000EFC9EF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U7"
FT                   /transl_table=1
FT                   /translation="MKTPFFPQDLAYSELTTPLSMCCPNFCFSQTLARTRSQSLSPIKT
FT                   YSQAPAQGISTMEKPTDDLPTPLDTKDHAAFKSFDLSSDGLRTKDGVVLVPQPSQDPED
FT                   PLACCFFPYIIHPNWARGRKLRNLTILCMAGFAGTALDLANQLAMKDQAKNWDKELIEI
FT                   TYTISASIAGIAYGPLLINPVAQAFGRTAIIFWCLVFAMACAIWSACMTSKGDYERFVA
FT                   SRLFDGIFGSIPSIVGVGAVYDMFFLHERGKAYAIFHVSFLFGTVAGPTFGGFIVQHTN
FT                   WPWVFWWIVIAQGLVLILGSHRSATLPGWFLARWSAYWHLPTSIFWLSSTERLLYAFTP
FT                   LPLPKFLMPMANHHEVIFSLWVGLLTAELWGYLCNDRIALWICRTREKGVWKPECRLHA
FT                   LWVPSLIILPIGLGIVGSALQYHLHYMVLALGAYLITFASMSSVPIAVTYMIECVASQP
FT                   TEMGAFMGAYRLTLGLVVPFFIDQWVARVGFGWVYGMMAFFSIFAFGFVVQMPKTRLHT
FT                   GYSKFSGVLNLRAIPFEADIIGFLAIKTFLKIYGYNLTTTDMPGLPIASSRSNQIIGDL
FT                   ITTEKLDLDVMCQYAPTCFVGVDAIQRDNVKRGKHNEYEPCEAIGSCP"
FT   CDS_pept        join(245565..245732,245870..245947,246035..246393,
FT                   246430..246574,246679..246830,246899..247081,
FT                   247185..247262,247348..247480)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899776"
FT                   /orf_name="An16g01270"
FT                   /protein_id="CAK42744.1"
FT                   /db_xref="UniParc:UPI0000EFC9F0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U8"
FT                   /transl_table=1
FT                   /translation="MGLTLTGAYNTRQLQIVIINSILVVLSILAVVLRIWARRLQGLSL
FT                   FIEDYLSIIALSNEGLHAGVGEHVDTLSAATVQEYSLLFWNTCLPVIKLSIVLFYQRIF
FT                   PVPSMIFACRSIMLFLAVWYIAFQTTAIFQCIPIHHEWQKKTTKGHCIDFVPFVTTLAA
FT                   TNLCTDVLLLVLPTREIWKLQIPWARKIGLSIIFTLGVIELTICNGSVCAISIVRLENL
FT                   IAISDSDITCTISIACQLLCAILIQFGLGQKSAAQRKILQSPTGWVIFLPQLRATAIRA
FT                   VKAVKSGYLGSEPDKTSVRKWSRPVSVASRLSLSVHLVARPAVRSLPGLVMRGSNFEHA
FT                   NYFALNFYVGKLPVEDKRRWEMPLMQSPARMALSGVAISYPRSRNESGNFPLPTSVVAL
FT                   TRTYHRSSQQALGSPWQAWGTAAERGSPTRCA"
FT   sig_peptide     245565..245675
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U8 "
FT   mat_peptide     join(245676..245732,245870..245947,246035..246393,
FT                   246430..246574,246679..246830,246899..247081,
FT                   247185..247262,247348..247477)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U8 "
FT   CDS_pept        247683..248996
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899777"
FT                   /orf_name="An16g01280"
FT                   /product="Catalytic activity: salicylate + NADH + O(2)  "
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42745.1"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326141"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000EFC9F1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6U9"
FT                   /transl_table=1
FT                   /translation="MTVSNNDKPLRIAIVGGGIAGVTLLLALLKHTSRQNIAPHLYEAT
FT                   PEFSEIGAGIAFGSNSIRAMELIDSGLAAAYNQHATFQPDTGALDKKLWSSYRMGMDGR
FT                   GPPSNSLKAGDYLHEVHAPVARSSVHRARFLEAMTALLPPEGGFVSFGKRLVSIEEGAD
FT                   GATVHFADGTSVVADAVLGCDGIKSRVRQILLEGEEAANAVFTGKYAYRGLIPMDEAVA
FT                   ALGEYTARNNHFHWGYGGHLLTFPIEHGRTMNVVAFRTKDNGVWEHGSQWVLPGNKKQM
FT                   LQDFEGWGPDVRAILSLMRNADIWAMFEHAPASTYHRGGRICLVGDAAHASTPHQGAGA
FT                   GMAVEDVFVLSRLLGAVREKNDLVRAFVAYDAIRRPRTQELVRTSRDAGMLYECQKEGV
FT                   WDNVDKIRENLDMRMRWIWDLDVEQHLQDALDIFHASS"
FT   CDS_pept        join(249561..249749,249804..250673)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899778"
FT                   /orf_name="An16g01290"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An02g05930 - Aspergillus niger"
FT                   /protein_id="CAK42746.1"
FT                   /db_xref="HOGENOM:HBG328325"
FT                   /db_xref="UniParc:UPI0000EFC9F2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V0"
FT                   /transl_table=1
FT                   /translation="MAYAPSPHFWVTLFRTLLNTFVHSAGGDPLLAQAHAIWQNEPART
FT                   DNLFLLVPIAFGIILDFLIRYILGHVLMSILILESLDKQATSYDSELRHKRPGPSSRHL
FT                   IQTIATLYHKGNLRLLLNGIGPACSYWIKHLCARSMLKTALFLPSPVAYILASVLLAEN
FT                   RFLWTARTILPCDQQPFVPTSRDRQRWKALVPATALHAVIESFMMHLPALFDSDLSLPT
FT                   ETEITKAYLSGIVGSDILVSGVMLAAQLLLLFPSFIALILVQASLLPSACETLISAPVN
FT                   QGWQQQQQQQHRARRLGEIFSVFKRGPLQIQDAVRIIGARHVLWCLELHGKMCLCLVEV
FT                   SAVVHLAVYTIR"
FT   sig_peptide     249561..249641
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V0 "
FT   mat_peptide     join(249642..249749,249804..250670)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V0 "
FT   gap             251081..251180
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(<251182..251451)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899779"
FT                   /orf_name="An16g01300"
FT                   /product="Remark: the ORF is C-terminally truncated due to
FT                   end of contig."
FT                   /protein_id="CAK42747.1"
FT                   /db_xref="InterPro:IPR019240"
FT                   /db_xref="UniParc:UPI0000EFC9F3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V1"
FT                   /transl_table=1
FT                   /translation="MPPTTQQVRPGAGVHIVLKKDQPTGRTVSGIVGEVLTRGNHPRGI
FT                   KVRLTDGRVGRVQAMNTNTNSNDNPVGTDGVGSVDLGGPEQESSW"
FT   CDS_pept        join(complement(253720..253791),complement(253551..253673),
FT                   complement(251877..253502))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000071928" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965652"
FT                   /orf_name="An16g01310"
FT                   /EC_number="2.2.1.6"
FT                   /function="acetolactate synthase activity"
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /protein_id="CAK42748.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG511075"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="UniParc:UPI0000EFC9F4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V2"
FT                   /transl_table=1
FT                   /translation="MSQDTTIETAPHTVADAFLEALAEAGVDYLFTVLGSDHPSIIEAY
FT                   VRRQNDPARQYPKMVLFQHEFVAISAADGYARMSHKPACVIAHVDVGTAALGQGLHNAS
FT                   SGRAPVVIFAGVAPSTLLGEAPGSRSEHVQWYQDIRDQAALVAPYSRFSAEIKSPHNVG
FT                   SLVHRAVLMATTGSPGPVYLTATREILATPLPSPQARLKPIPSCQLGSLSPQAVELIGS
FT                   ALLNAKSPLVVTGYLGRNHSAVQELIKLADTIHGLRVFDSELREVCFPATHPACVTRGT
FT                   GAAPAVQSADVILVLDADVPWIPRRIHPSPDAVIYHIDLDPRKERMNMFDIGAAATFHA
FT                   DTGPALTQINAHITSSARLADLQTNWTDRHEALRAAHAEGRARIDARATKLLETPDAPC
FT                   SVDFLCSRIRELVPDDTIFVTDSVTNQVAMTEQLQLTRPGSHLTKGGSGLGWAGGASIG
FT                   VKLATTRYDTSDRPDVRVKADTNSPFICNITGDGSFIFSVPSAVYWASHRYGCPFLTVI
FT                   LNNGGWNATRQCLVDVHPGGEAARLSSKDLGISLVEDGPDYGGIAKAAANGNLWATRVR
FT                   SVKELDEALREGVRVVLEEGRGAVVDVVIQ"
FT   CDS_pept        join(complement(255317..255481),complement(255109..255267),
FT                   complement(254279..255058))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235031" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659681"
FT                   /orf_name="An16g01320"
FT                   /protein_id="CAK42749.1"
FT                   /db_xref="UniParc:UPI0000EFC9F5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V3"
FT                   /transl_table=1
FT                   /translation="MAVSPLDVPNRGPEFVKVTAVLTCIAFVLVVCRLTWKGYVQGRFA
FT                   VDDGIIAFSMGMQIVNTVMGDLGMIFQNVDAINTKLCPACHYAFGRHKADIVRTGGNVV
FT                   LALKYFWLFQIFYKLVLCLNKLSFLTFYLRVFPNRIFRIICWITIALVLASTFGFVIAT
FT                   IFQCLPVRASWYKHIPKKCVQNAPFRWSWAGYNTAMDIWVCLMPLPVLAQLQLDRIRKI
FT                   GVILVFCMGLFVCVTSIIRMWAMEKSTTTTDPTWGSFDALLWSAIEASTGIICACLPFL
FT                   KHPIQKVLPGLFGSLSTGSRKSRSRTRPSYRMSRLGSRSGNGTRDVDADIGGDGDDTES
FT                   IGSQGPIAKNQIIVKTGISMHSEAAYP"
FT   CDS_pept        join(complement(258421..258587),complement(258193..258359),
FT                   complement(258040..258135),complement(257880..257980),
FT                   complement(257773..257828),complement(257514..257726),
FT                   complement(256819..257458))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899780"
FT                   /orf_name="An16g01330"
FT                   /product="Function: TNA1 of S. cerevisiae encodes the high
FT                   affinity nicotinic acid permease"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK42750.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328895"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFC9F6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V4"
FT                   /transl_table=1
FT                   /translation="MEMEKSEIEPRVLEASSGDNIDPALEKKLLRKLDWRVIPALWFLF
FT                   LVSFMDRSNIGNAKIAGMSKELHLVGNDYNLAVTMFTVAYVIFGMPANLLVKKFGPKML
FT                   VLYMFTWGLFVMGQGLVKTASGLIACRFFMGMCEAGFVPGCAYLIGSYYKRDEFLRRYA
FT                   IFFSANMAAGAFNGLFSSLLTPLNLDGYKGWRWLFLIESIITMGVSLICYWIVVPFPED
FT                   ATFLTAEEKTLLLARLKADGGSVRDDPISFKRVISMAADWKIWICVLAYLGAEESASSL
FT                   VNFQPTILKDLGWTSRSAQEHTIPVYAVAFVLTLSCAWLSDHLRHRYLFTVVGSILTII
FT                   GWSVELSQVHSAGVRYMGIFFVASGAFIMMSTIVVWLCVNLGKGVKRSVGMGLLPAFGN
FT                   CGAFVSGNVFISSESPKYPTGFGVGLAFAVVAGLACTVYFFALQAENRRRDSQPAKEGT
FT                   PEMAPEEDDLGDAHPDFRFQL"
FT   CDS_pept        join(260338..260480,260542..260796,260851..260869)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000232026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116662"
FT                   /orf_name="An16g01340"
FT                   /product="Catalytic activity: biphenyl-2 "
FT                   /EC_number="1.13.11.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42751.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG704761"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="UniParc:UPI0000EFC9F7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V5"
FT                   /transl_table=1
FT                   /translation="MAAKFAVKSLDHLVLTVRSIPASVAFYTNHLGMKHEVFTSPSNPD
FT                   IQRHALRFGSQKINLHQSGKEFEPKAQNVMPGSADLCFLTDMKVENVLKAFEEAEIDVL
FT                   EGNKVVERTGAVGKIRSVYVRDPDGNLIEISNYS"
FT   CDS_pept        join(complement(261650..261658),complement(261469..261543),
FT                   complement(261163..261315))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899781"
FT                   /orf_name="An16g01350"
FT                   /product="Similarity to hypothetical protein CAA10129.1 -
FT                   Cicer arietinum"
FT                   /protein_id="CAK42752.1"
FT                   /db_xref="HOGENOM:HBG627799"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="UniParc:UPI0000EFC9F8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V6"
FT                   /transl_table=1
FT                   /translation="MGNGAKAASKRERNAKDTKAGGKSQLKTNEAAKDIICQTCRTTFL
FT                   KTTRAPALTEHAANKHNKTLQDCFPNFVEAPKK"
FT   CDS_pept        join(262913..262996,263069..263281,263459..264629,
FT                   264682..265210,265464..265821)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812484"
FT                   /orf_name="An16g01360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42753.1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniParc:UPI0000EFC9F9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V7"
FT                   /transl_table=1
FT                   /translation="MLPSRDDIAKFISIAPEATEGKALIFLQMRQSISSTRIPTDTPIT
FT                   RLLEGPIRGSKAMLLTRKHYPRHMIRTSAPCTELNMLPHKNIVTEAGDVRARDEAEESW
FT                   TRRCAGDVVQSSDVSRFVPSLSGLDVLQPLMFRISWRVGEKAYHDCYQTSVFSNNPYIR
FT                   IPSAYGIAYSALQRPDATRYTNSVQQTISLNVALNKKAQATIDAMEPQCDIWALDEPNN
FT                   ASATSRPVEDRTAPTASSIGPMKSSKLSNFRRALSISSLQKSGSKAGDMFTRARELRRA
FT                   ILEEENGRWPDLEWRKIVVAYQEKVGMKREIAELRAKRPIQYLHLLRAGYFEPIPIAWA
FT                   TRASNPLKFRIDGLSGWRGITPAWRGYENTAEERLYWVLNHREGSTGPRMKPDVISALE
FT                   MARARMASAVEPPPAYYSMDDTFRLQRLPESYSLQVMPPPFTPFDQPETAMDNTMILLD
FT                   VSGSMDFDPLRPLYTQYLVTGFARSNQPKNKDVAKAIVRRFTDAMSIHDQNLHGYQLVT
FT                   FANKADYIGFINHSNFNDMWRNVKLGGGTRVMTGWQKIKDLHFQRHSESATYHPVYGWQ
FT                   AGPQTPMLRLLLLLDGEATDMDEFELDLLGLSWVHVTIFLIGVDGCPHHHRHANELQRI
FT                   SEVNPHVSFVDAQGNAPERYVTHELLKRHLGKHDPPNSTVEPSIATQGADDPAAAARTA
FT                   VPARAPRSGPDDADIADRGWHNGVRCSHTEGHHEEGTSVGCCIRTHGVGLVGREGTVEG
FT                   REVAGGDGSRSIDDPGCHAWIAFSLEIHWQP"
FT   CDS_pept        266632..267774
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965653"
FT                   /orf_name="An16g01370"
FT                   /product="Function: UPC2 of S. cerevisiae is involved in
FT                   the control of sterol uptake"
FT                   /protein_id="CAK42754.1"
FT                   /db_xref="UniParc:UPI0000EFC9FA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V8"
FT                   /transl_table=1
FT                   /translation="MYTYRDDSSNRSTSTASTTTALLSSPTSTSTSLSIPSTSLYTNNL
FT                   QPPHLTPLNTTSLRLLHLYITSTSHTMGTAQIPSVREMWALSVPEMAFEYQPLLSTLLA
FT                   VAAAHRARLVPSEAEELRRVQGGLIAQAVGEHRTETAKLAVSSSLGAGGRAGGVTETLC
FT                   MNAILISLYTLACRMDGGGVGEYEPPNLWLNMARGVRTVVSMVYFRLVEERARIAPLLV
FT                   AKPVVHRKDVEVQDGGPKGSSGVEGALRFLVDMFPGSEEGGEEVMGIYAQCVGYLEGLL
FT                   MAVRMGESEYDIRKRFSSFPSMVPGEFLRLVSERRPRALVILAYLFALVKCAEGVWWLR
FT                   GIPEMEVRGIDSILPEEWREVMGWPVGVVMGVVDVNESVL"
FT   CDS_pept        join(complement(268428..268693),complement(268149..268380),
FT                   complement(267857..268099))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812485"
FT                   /orf_name="An16g01380"
FT                   /protein_id="CAK42755.1"
FT                   /db_xref="UniParc:UPI0000EFC9FB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V9"
FT                   /transl_table=1
FT                   /translation="MSATEHLDVANLAVYALFSLPAIYCLVVHGKHGLLGWAYVLVMCG
FT                   LRIAGSAMSLNAIHRNEINTTAAILNGIGLSPLLMAAMGLLHEANHSIHRFLPPFLNLW
FT                   GFLITHMVVAGGIGLAAASSGNETLLRVGMIVFATGWTLVAVLIWFSYGANAHSRRLGE
FT                   ERQLLFAITVAMPLIGVRIVYAIVTAFTSSNLEGGSLAVRVIFGTIPEYLVMLIYVGVG
FT                   IVTRNLVRSRVEYIQPMNQSQVPI"
FT   mat_peptide     join(complement(268428..268618),complement(268149..268380),
FT                   complement(267860..268099))
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V9 "
FT   sig_peptide     complement(268619..268693)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6V9 "
FT   CDS_pept        join(269570..269650,269715..271670)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965654"
FT                   /orf_name="An16g01390"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42756.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFC9FC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W0"
FT                   /transl_table=1
FT                   /translation="MQKASRRSTPRSRISKACDRCRRQKLKCDSVRPCVLCTRAGHICE
FT                   TTTVSRRRVSEYQTPATPVASAGSDTPQVLPRRASEDHQQYATGTSAIGFARQVYNEEE
FT                   TGRTLTEAAVPGDVGMAGTDNSLWGLKETSMPPRTVMLALINAYFDRMQWFILVLHEPS
FT                   FREMAQPIISQHQWQRQDLGAVMTVLAVAVISLQSVLPDADWPGHILLARHSIDAQDLL
FT                   NKFLAEIRSRVLDMLEDRRIEGVQVCLLLCCYYMFHSSPNMAWTTCGMAFRAAYALNLQ
FT                   ETSTLSQTSVANETRSRCWNQIIISDTFCSILYGRPASLPSANVRHLQLVDDLAIDHSL
FT                   LNDLSVDNSDGLTSRAPFHVLKTDVYAIAREILIRFRRLDLTSGIDEQDLEAIIRITEE
FT                   SNVLLTDWWKSVPKLYDFDYWKADGRWEMIEGQLQRLPSEARQQVETIYLQAAVLQLTY
FT                   DGMVIQANRPLLERRINRLTSSRAIVDAMHRALDRATAAALRISRVPVHKLKNHFAIAV
FT                   VSMQEFTAGVILCIPPTVKPLTATAHEAKDGVVRIIRASRSLKSHDRIARQTEQLLTEL
FT                   LKVTTQREITHALADNLDTNFPSDTRLTGSVVAGASSDSLGAGRSRPVPGSAAQAVVDP
FT                   IQGAWDSEFNALPAVTGPYDFLPAQAFQQLDDTFGAFGECNIP"
FT   CDS_pept        join(272760..272818,272914..273083,273134..273627,
FT                   273680..274735)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899782"
FT                   /orf_name="An16g01400"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42757.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCA22"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W1"
FT                   /transl_table=1
FT                   /translation="MRNLECVYTKSRRYPSSIFPTLRRSSTSPNTASSPDTNASSSPCS
FT                   DSSGTHAGISIPHSDSPASVDECGNNGLFDGESLTQLLVSGSKAISGQPHIAIKPHVLS
FT                   TYPLDNLLSDIEGLLEQPVSHLAQSKEDLTKPDRMFRTRLPAVSGEDNEYLLRKGALLL
FT                   LPPALRNELLAAYVNYVHPLLPILDLGDFLSQIIVGDDAQFKSPLLYQAVMFAGSIFAQ
FT                   RDGTDEPEQLTRALFERTKVLYEFESESCAYTQIQALLLMTLWHGDMSRHKGPSYWLDV
FT                   AFSTAERIGLLHDEDWPCDSRSFRSAMWCCLYVRDRTISLGSRRPPRMPVNKYPDSILH
FT                   LMSDAPREYDEIILESLGSASLMLTSTYQEQSTMLFKELVKLSYCVGAILDYLYEGAWV
FT                   RIPTRRSSFYSLAPKCSISPSIRPSCEKLLYSWIQFLPLNAVYHPPQLPADAEGESAET
FT                   VFLVHKAFLYLLYLASMAVIYRTGTHSQQTSTATPNMEGLRASTSQIKKVLAELQGMGL
FT                   LQFLPGASVTILMFAVEASLLDLQGSDTMVRRQAMSNLYACEEAALHLMQAYPTAEMAV
FT                   LKTRTARANLLGLVET"
FT   CDS_pept        join(275108..275262,275388..275679,275868..276090,
FT                   276143..276174,276225..277529)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899783"
FT                   /orf_name="An16g01410"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42758.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCA23"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W2"
FT                   /transl_table=1
FT                   /translation="MDLTNFILFHPLNTVTMGSNGVTKPTGIAKGSNQSRRRHRIPLSC
FT                   DPCRARKFRGPSNGSASIARRDGGDEMMNRIDQLENLVKRLIAERQDGSGNAPNTPESS
FT                   TLDDNKAVQGAHLNASEVACAGTTMIDGTRSVYRGGDEWYDVLEEINALKQTWAENHDE
FT                   TADEVVQYPPSHIADGSSLLFGQVKPLERIEIISTLPPKHQVDKLVAKFFDTENFRIAV
FT                   PPILHKPTFMREYNEHWKDPSRTNFIWLGLLFSILGLTMLSFHQFGEPPEYEGVSESLF
FT                   QLYRIRTAQCLLNGDIAKCFPYTIETLRFNATAELNRKDDNRRGLWIMTGVIVRAAINM
FT                   GYHRDPSHSPSISPFHAEYRRRVWLSVLIMDDMASFLGGFPRMGSAVFSDTMEPRNIHD
FT                   WELSEHSTSLPPSRPMEESTATTYLIAKTRLFRAIGRIADFNNTPNFVSYDTVREIDQA
FT                   LYNSYDSFPSHLKVHKEGSTIPVKTAADVSRFSLCSMYHRAMCALHRKFMAKGRLNGRF
FT                   KLSHDRCLSSAMTILDYQVALEPSWYKSSLTRQVLTLAAMILLLDLELARRFNNTDTSS
FT                   SIDVLQILERSCDLWRRAKESYEEAGRVHEILAPMISSFRPVTATTSAQTEVRTAFDLQ
FT                   KFSPSFTSFDGVEHSLEKEMSDMDIDWVRISYY"
FT   CDS_pept        join(278129..278828,278875..279369,279420..279653,
FT                   279701..280365,280418..280558,280670..280868,
FT                   280917..281004,281168..281412,281498..281655,
FT                   281722..282180,282233..282916)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812486"
FT                   /orf_name="An16g01420"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK42759.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0000EFCA24"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W3"
FT                   /transl_table=1
FT                   /translation="MASQAINSEWGSIVLSLAFLFALARRVRTICNSPKKIASAPRGYK
FT                   HIVSSSNCSKLRLSQYASQIFFATVICIVHLTSGTGFGSHAHFYNGLAALNACLSAAIS
FT                   MVEHTQDVQSSHLVPAYLAVALARDMHKTWNMTCPTVFDCGGIKLGLCLEALWLVSFIR
FT                   SWVWGGYLHFQVSASEDAAGLFSFVSFFWISPMLREGYISTLHTAGLPGIHHMLSSRTL
FT                   RTGAIKAWTSRTGSHKRSLPLTLARCIKSAFLFPIIPRLFVIVFRYAQPLIMDAVIRFV
FT                   KDTTTYSNSGLWLIFFAGIIYLGMTISAAIYQRCIDRLRIMVRGALIGMIHDQAMKLPG
FT                   KEAESEAVTLMSSDVDSVESVGEILHDTWAYLLEVAIGTMLLAARLQWFAFLPLGIIFA
FT                   CSRMSAYVAKHLEGRQKDWNVATQARISAITSVLGGIKSLKMMGMEDVGQSRISQLREK
FT                   ELRLSERLRWILVAYNASANSLGIFAPVLTLVFYALSPRTDGLHANEVFTSIALLSLVT
FT                   HPANMVMTLVPRAVGIMANFARIEAYISRSSVVDTRQIAGKEKAQHLASLDHVSIRNSS
FT                   ITDAPILRDVSFSIAKGELIVCTGAVGSGKTTLAMALLGESASGGSMFLASKKIAYCDQ
FT                   APWLPSVTIRDAILGGSDFDEEWYKLVIDACCLALDLEALPDSDSTVIENNGMNLSGGQ
FT                   RQRIALARAVYSRYDMLILDDPFSALDKTVVEHIVDRLLGPKGLFKATKAGGSEARLED
FT                   PSSVQKGEQLDSIVASTAGVVQNTQPSELHDKKMPGQNNRLSEAAIDLSRKTGDVAVYG
FT                   YYINAVGHGNALLMTACTATYSFCLTFSQFTQLKVAIRSGMVLHSQLLERVLRSVLAHL
FT                   RHSTLLTELNLSRAPLSYFAETHIGVTLNRFSQDIALIDKQLPSALANLSTPLIVYVQP
FT                   VMLVTIPPCYILVYLIQKVYLRTSRQLRFLDLDSRSQLYTNFLDTTRGVTTIRAFGWQE
FT                   KFATDNIQALDMSQKPYYLLLCLQCWLKVVLDCIMAIIAIGLITLTVVYRNSTGADIGL
FT                   ALNLMIGANTTLLRLIQNWTSLETSLGAVSRLKDVQERVRSEDDARGAIEPGPRWPSGG
FT                   ELRMQHVTVSYSKKSEPALRDEGRQYPVNRAFHARADMFIGYSGKSTLMLSLLRLLETM
FT                   HGDIYIDDINIAHVPLQVLRQRGIIAVPQDGFNMPTASIRFNLDPYNKCTDDDIVQALK
FT                   RTHLWDKISASSSGFDDTLDLPMSTILPLSAGQMQLFALCRMLIRVEINRSSKPIIILD
FT                   EASSSLDLQTEAILGGILREELKYHTVIMIAHRAEGIMGALRAGVDAIATMKDGRLRVS
FT                   VIGTSMDRVDEK"
FT   sig_peptide     278129..278215
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W3 "
FT   mat_peptide     join(278216..278828,278875..279369,279420..279653,
FT                   279701..280365,280418..280558,280670..280868,
FT                   280917..281004,281168..281412,281498..281655,
FT                   281722..282180,282233..282913)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W3 "
FT   CDS_pept        join(complement(284773..284884),complement(283136..284721))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899784"
FT                   /orf_name="An16g01430"
FT                   /product="Similarity only to an internal part of beta
FT                   transducin-like protein of P. anserina "
FT                   /protein_id="CAK42760.1"
FT                   /db_xref="UniParc:UPI0000EFCA25"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W4"
FT                   /transl_table=1
FT                   /translation="MGGEAIVGPALSGQFYAGTGKQYNFGSVSGEKIYMGTGDVQVFST
FT                   LPFAKSACFNSREREHDSFCLEGTRVDLLKDIAEWIDADHDEGIFWLSGMAGTGKTTVA
FT                   RTVARNYDQQSRLAASFFFTDENGDANSADIFASAVACQLASFDTSMKNAIQDVLERCP
FT                   LLPYQGLSEQWTRLVKEPLAAFTKKPNQNPLLIVVDGLDLCPEKNDQRLILRLLSSITH
FT                   DCENKVIVFLASRPESAIRSELSGIRHKTLRLQDINRRIVDSDIKLLLNHEIGKIMAPF
FT                   EPFETKSLWGSGIIPTFVIFARGLFLWAATACQYIRNAKTPQIVLQRLRNIDAERPEKG
FT                   TPIEVLYKIYTSILDDSVNDAWDEHEKATYWNSTRRILCAITYNRGMLSKPALANLIQM
FT                   DDIDSMLEDLHSIIRIPEDNNKQIGFLHISLHKFVTTMEHPSLYLTPQQSHSMLADTCL
FT                   DLLNEACGQDSGKLQNGAEPKTQKVSQALQYACTKWVDHLCDGEESLPRNSKAFVFLKT
FT                   HGKSWTKLLILSGQGFLVERLGDRLVEMIVSDISSAEPKPPGYLANPG"
FT   CDS_pept        285336..286163
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116663"
FT                   /orf_name="An16g01440"
FT                   /product="Similarity to hypothetical protein CAD21096.1 -
FT                   Neurospora crassa"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAK42761.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG323871"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniParc:UPI0000EFCA26"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W5"
FT                   /transl_table=1
FT                   /translation="MPYTFRGKISTATAVSQLKRDFPNVSYLLLVGIGGGIPTQGIDVR
FT                   LGDVVISTPTGTNPGVVQYDLGTAYHDKFVRAEQHLLPPPLEWLHAISRMKVTHRVEGD
FT                   NVDQFIEELHTRCARQAFVRPSPDTDTLFEPTYDHVEGEATCNQCSRDRVAQRPPRSDP
FT                   TKPVIHFGLILSGDSVIKDAATRDQIARDEGGAICFEMEAAAMMNDFPCLVIRGICDYA
FT                   DSHKNDVWHEYAAAAAAAVAKEILRFIEPSKWIFFGVYFATGNLFNSIQLFLE"
FT   CDS_pept        join(286544..287126,287220..287635,287711..287909,
FT                   287973..288188,288243..288532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000245622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812487"
FT                   /orf_name="An16g01450"
FT                   /product="Cofactor: FAD."
FT                   /EC_number="4.1.99.3"
FT                   /function="deoxyribodipyrimidine photo-lyase activity "
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAK42762.1"
FT                   /db_xref="GO:0003904"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG693486"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0000EFCA27"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W6"
FT                   /transl_table=1
FT                   /translation="MPPQSAPTVIFWHRTDLRLHDNPALQAALSLNPSTFIPIFTWDPH
FT                   YAYQVRVGPNRWRFLLECQNDLSQSYRKLNPKQKLWVVREAPQTVFPKLFKAWGATHLV
FT                   FESDTDGYARERDETIRKLANEAGVEVIVKSGRTLFDSDEVVKQNKGEPTMSIHQVEKA
FT                   IEQINNGVPDRPVDAPERIPDPLGEEKMRDISPKGDFSIPTLDELSIDPSQATSPHHGG
FT                   ESIALEMLTTYLQQNEDYIATFEKPKTSPAAFHPQATTLLSPHLHFGSLSVRKFWHDVQ
FT                   DTLQQRESAHKPTSDLPTNLPGQLLFREMFFAAQAALGPVYAQTRGNKIVRFQAEVWFR
FT                   RWKEGRTGFPWIDALMRQLKNEGWIHHLGRHSVACFLTRGGCYVHWERGAEVFEEWLID
FT                   HETASNVGNWMWLSCTAFFTQYNRCYSPVAFGKKWDPEGRFIRHYIPELEHYDKKYIYE
FT                   PWKAPLEDQKRWKSYPEPMFDFDERRQTCIAQMKEAYEVHLMGNDEKVMDGSWKEIFEY
FT                   EVKDGRVVDETNVKVDGDGGHRKGGEKRGRQAGDQDGEDEDGGHGLKKKK"
FT   CDS_pept        join(289610..289907,289959..290080,290137..290733)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234849" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899785"
FT                   /orf_name="An16g01460"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An11g04970 - Aspergillus niger"
FT                   /protein_id="CAK42763.1"
FT                   /db_xref="HOGENOM:HBG326128"
FT                   /db_xref="UniParc:UPI0000EFCA28"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W7"
FT                   /transl_table=1
FT                   /translation="MSTSTPTSQSTCPSPNQPLSTMGPADELLDPWRRDLIARLSRFME
FT                   YPETDSIGWACLWFADLSTMEDLIKACEQNPPTVSRHISAALKKNDQRAQAIRAWASAR
FT                   SSEDSGEPSADEESDTEEPPTKKRRLTSDPCRAKELCEERDDEKCVLTGCTVPVEVVHI
FT                   IPRSFGKGEEGLSDFWEALECYWSPENVSAWKEQVLDPDGVDTCSNLMCLVNVARRLWE
FT                   LAVFALKPLSLSEDKRQLEVQFYWLPMNRYRQTMPVTAIPSPFPHNLSSTNAGYTTVLC
FT                   NIVTRSRISSGDIFTFKTDDPVGHPLPSMQLLNMQWILTRVLALSGAAWVTEEEEDQ"
FT   CDS_pept        join(complement(295221..299405),complement(292991..295168))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161554" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899786"
FT                   /orf_name="An16g01470"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42764.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG328335"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI0000EFCA29"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W8"
FT                   /transl_table=1
FT                   /translation="MSSRYPPLSGFNSRDRSPQRFGDRRPPVGPRGADDANLPPLGREP
FT                   PRGPKALIDPPRGAPFGGRGRGYPGRGDFRDRDRDVRDRDRDRDRDFRDIRDGPPPFRR
FT                   DLDRDRDWGRRDRDFDPRESRIGFGRGRSRSPPPPRDFRDMREPLGRDADMIRMRRGSR
FT                   DSMISVSSAVPDVPSGGGHHPRSGPPMRGRGRGEWDSGRGRGRMPYLDDRDSFRRRSRS
FT                   RDARWDRERERERDRERERDRERERDRILDRERERDRDRDRDRVILDRDRDPDRRERDR
FT                   ERELERRERFERREEVDRRVERDERERPGDHWKRDRPPSRTENRLPSSSTVSSVTGPAV
FT                   LPVPGLPERPPDHPPAEPPRKPSAGEARRDSQRMDRIERIERIERTEPPTPLPEQPPKD
FT                   LAPPPVKRSPPPAAPQVPAFGSVTAPLPEIPAEKPEKSEKPDKLEKPDKVEKSEKSEKP
FT                   PVESTSTAAATAKQEKERHELPPKAPMHPPTAPKAERGPPQQPLEQRVRRDDTRREETP
FT                   DIPPKPELATRPPKPHAPAAAGGPKPTDISPPTAPAAMVHKDAPGAHETPSPRKLGPTM
FT                   TSPELGRRPSATGSATSPGPHTSPRMPTSSIPTGPRALQQRPSISRGSTKAMKQWVRPG
FT                   FTGPPSGPSAASPPKRDSIDGKERSLSLSEDHKLESQSQADESSNGLEAGEIVGEDEPV
FT                   ETKPQEPAVSFEPAMDVDVPEIDAKKPVAEEKPAEKEVPREAPTEAPKEALKEIPKEAP
FT                   KDQSTVVIPDFGRSSDEDEDENVVFTQDYLEERKQIFEKDMNALRAELPPSPLEDPNIV
FT                   ALLMRIQYLGMIAHDQVPEKAPTPPVLAEDTKMAKEEPSAPEMETEPNGKAEEHEPPAK
FT                   VVLDSVPAADALTLESLPFLNSGPPTPLSDLEVYQENAATHERLKDTFRDIIMKRRKDV
FT                   ARKNAELRLDYLSFYKPWRLNVWELDHAKEKASGSPGPTTPPAAPATATPTPTVESGRR
FT                   YKGNSELDFQNALRASEISAQEELEKRRGNKATAQPDLAREAVIPEMLEPPEVKAGIYK
FT                   DTNNIIDPAQAMDVFGFLPPRNDFSQEEHEIFTDAFMAHPKKWGKIAESLPGRDFQQCI
FT                   IHYYLTKEEIKYKAKLNKRWSRRGRARRSARPKSNALMADLGVVKPDYEGEEEPAPVTD
FT                   TGRPRRAAAPTFGDSSADTDNNGRRGNASKDGEQSEKPSRRGPRSGTGTRGGRRGKAAQ
FT                   QQQAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTPQPTPSEQSLQTTPVPVAAAAVTPA
FT                   PKVESTEPSLDGATEAPAVRPKEPQEREATDVPPRARSGRGRPKEGVYVFESTEQETPA
FT                   PARQPEVGGYGSLQPTSYWSVPEQRDFPLLLAHFGRDFEGISNFMKTKTTVMVKNYFQR
FT                   RIDSGQKDFEDIVADAETKKARGEPTGPLPVPNFASKRRYEATPSSIIMPRPLAPHTDS
FT                   APDTDDSRLGSKGKTASSTPQQAPLHSRAAQEKERNVSRYPPLAQATSAPMTGGPMLSE
FT                   DPARVMSSQAPLPSRLQGPRMGYFAEERREVPATVLSHAAATRPQEAPMSVRQTPVSAS
FT                   EMSRLEPLHAQGFRPASVDVHRSPLLPAQTALPGSQQAYLQPQPQPSLMPAGSHSRQHS
FT                   LTKTPSSPAQPLQRPEPEISPIRRDSMSQRPYFALPGHVGVSQSTSILSPPKELSRPGP
FT                   PPAEPPEAPRVPAKRSNIMNILNDEPEEPQPRKRFAGDPSSSAPAGHTGSPSRPVYNGM
FT                   QSIPQQPPPRQEETVLSSQQRAPAYGPPSQYLPPSRAYADYQSYSSVPGGSAAPANNDW
FT                   MARFDPRGQPPPQPPQAPSQSSSRPTTTLASQPPYSPYTSTQSLSNPPLPNLTAPSPVP
FT                   TPASVTAQRPAYHGSAYAPSPVSHAQATASSRELAAQSQMYRQSIGSPTQRTSSLAYGT
FT                   RQGPPTPIQSPANLLGMGSRQPPATVSYASPAPATPGSSHLSAQQHAAHQSYQQHVQTM
FT                   VNGAHQQAAHRQTLGLASGPYGHNTPPPQASVSRAAGLPGPGPQSMSMGRSYTPPAILQ
FT                   PSPGGGLSYAPSGPAAVGSMHPLQARPGAPGALVETVPGGHPNSGHHRVYSQGSNAGPL
FT                   PGPMSQHPPR"
FT   CDS_pept        join(301281..301508,301587..302486)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899787"
FT                   /orf_name="An16g01480"
FT                   /product="Catalytic activity: Spermidine + "
FT                   /EC_number="2.5.1.46"
FT                   /function="deoxyhypusine synthase activity"
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /biological_process="spermidine catabolic process to
FT                   deoxyhypusine, using deoxyhypusine synthase"
FT                   /protein_id="CAK42765.1"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="GO:0034038"
FT                   /db_xref="GO:0050983"
FT                   /db_xref="HOGENOM:HBG716221"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="UniParc:UPI0000EFCA2A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6W9"
FT                   /transl_table=1
FT                   /translation="MSAQDSATGNAPPSAVTNAVLVASEPVPEGTHQVSGVDFDRFQGR
FT                   DITVAEMVDNMKYTGFQGSAVAEAARIINEMQAYRHPESGEKTTIFLGYTSNLISSGLR
FT                   DTIRYLVRNRHVSAIVTTAGGVEEDLIKCLAPTYMGSFTAPGAGLRAKGLNRIGNLIVP
FT                   NSNYCAFEDWLIPILDKMLEEQEAAKKKALETGDEEDELHWTPSKIIERLGREINHEDS
FT                   VLYWAARNNIPIFCPALTDGSLGDMLYFHTYRSSPQRLRVDIVDDVRRINTMAVRAARA
FT                   GMIILGGGVIKHHIANACLMRNGAEHAVYINTGQEFDGSDAGARPDEAVSWGKIKADAK
FT                   AVKVYAEATVVFPLIVAASFARASQATPDSEPSQN"
FT   CDS_pept        join(304612..305020,305081..307174,307227..307971,
FT                   308027..308603)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899788"
FT                   /orf_name="An16g01490"
FT                   /product="Catalytic activity: Ubiquitin C-terminal
FT                   thiolester + H2O "
FT                   /EC_number="3.1.2.15"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAK42766.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG328336"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0000EFCDE0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6X0"
FT                   /transl_table=1
FT                   /translation="MDASPDSGSSVEQQQQPPITLSTQPPAPESVRETTVTIEAASDDL
FT                   AVHTTNPITTTTSIPLETPSSESPPVEIQDEAPREDIPPPVQAVPVPVIQPPQPELEHA
FT                   YWADIEEDLSVPDEAEMKEIESAADGDYSAYEYDYWEKNFHPDLDDPEYRPVEKARMTW
FT                   KIKGVRGTPDAPNRVKIMRSPPAYLGGYWWTIKFFPRGNNVNALSIYIECSPTMPPPDK
FT                   ILPETEFKVLHGPADAALDVNAPDLDMKFAQTDDSASWLEAFRSQYPAAANHAESTGTK
FT                   SWRVSAQIGVILYNPEEPRTGWMQSSCHQFNPHNLDWGWTNFHGPWAQIHRRQRGQRQA
FT                   LLRNDTLAFDAYIRIVDDPTRSLWWHASDTEPTWDSLSLTGYRPLGDSVINHSAEVAGL
FT                   ATWVHLAPFCKIIQNANVLDHLTSCDVKPKPLCDALQKFLWQLRSRGQSLQYVDTDMIT
FT                   STLRNLHEYSGDVCEFWERLRRTLEIELAGTDAVQELAKLFDSPSVESLPGEAQARDVI
FT                   NTVPKDFNSRICVPADQAKTTSEAFSWYLSAKPGRWVLPPVLHLELGRQKLDKAARQWR
FT                   LLYNRVDLDEELDLTPWLLDGQEGKYVLYGYIVHRGRRTSGKFFSILRPGGPGTRWLAF
FT                   DDGSDNRVECLTRKTALGPHLGLDASQKVDHKTGHDVAIAVMYIRSDVVQEFLPGPQGP
FT                   WDVPASLKEYYETGIPPVQLDDKGHKDEINVEIYSLPKYDQLGSLFDTYDLMSQAKLEN
FT                   GVMYLTVPRSSNYVDLRKKIALWASAKSSENTCAEHVRLWQIGHTRDQFGPTLAFARIS
FT                   DLTSTLDFPLKTVRFWMQVVSDENAKFFAIADPPQAIAIHAKPEEAVVERAGSESSEDR
FT                   LPLPEGEARASSSGTLPENSMSATGGVTIANAVNVSHIEIVPQDPVPTDLGGTGAPTTG
FT                   DSENDAVIAAIIAEDIQQMDTDRVPDAAPPATQEPSQAVPDEPEPQASTAADIPAPSIE
FT                   PEVPQPVDHVYYFIQKFDVEAQALRTVGSFFSKKEENIKTAVRRHLKIPPMKDFQIWQR
FT                   VDGTTVTTMASGETFEVYVPDGTCFIVGDKLNKDRRLQLNVAGLFGNPDQLVRYLWAES
FT                   RNHPTRAFTGFKTIDASFTNDYYSGEFNKGHFHGKGKHISDLAATYVGDFVLGKRHGSG
FT                   FMEYPTGDTYDGDWFDGICHGQGTYVERKTGNKYVGGYKDGKRHGKGISYWEVADEEMD
FT                   LCQICYGEEQDALFYDCGHVCACVTCARQVDLCPICRKNIISVVKIYRT"
FT   CDS_pept        complement(309570..311858)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224258" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659682"
FT                   /orf_name="An16g01500"
FT                   /function="RNA binding"
FT                   /function="S-adenosylmethionine-dependent methyltransferase
FT                   activity"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="CAK42767.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008757"
FT                   /db_xref="HOGENOM:HBG726909"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="UniParc:UPI0000EFCDE1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6X1"
FT                   /transl_table=1
FT                   /translation="MGVGRRMKKQGPPAPLDESKITIFKKRKAGEPESKPETGKKRRRA
FT                   DADEENVAKPVVKKKANGAANGKATKAAAKPKAETKPKAKAVEKKPQFMDSDDEDEDED
FT                   MSGIEEMDADEFDDLDGVSDGSMDSQEEDNDSFVDSDEDDHPREAMFSDDEDLSDAEER
FT                   LTAANIEGLSRKLDLQRQEEEEEAEREMKESAMQTNIAGDRPDVFGDAEGTQPGLAPDL
FT                   QLLRTRITDTIRILGDLKTLGAPGKSRTDYTELLIADICTYYGYTPYLAEKLFNLFTPM
FT                   EAFAFFEANETPRPVVIRTNTLRTNRRSLAQALINRGVVLEPVGKWSKVGLQVFESAVP
FT                   LGATPEYLAGHYIIQAASSFLPVMALAPQPNERVLDMASAPGGKTTYISALMRNTGCVI
FT                   ANDASKPRAKGLIGNIHRLGCKNTIVTNMDARTAFPKAMGGFDRVLLDAPCTGTGVISK
FT                   DPGVKTSKNERDFLAIPHMQRQLLLAAIDSVDHASKTGGYVVYSTCSVTVEENEAVVQY
FT                   VLRKRPNVKLVDTGLGDFGSPGMTSYMGKHFDPKMTLTRRYFPHRENVDGFFVCKLKKT
FT                   AATPTPKPGDAAAAAPTDGNSAKKSKTLSVASTTTDDDEPIDKTPITDEDGMVIETEGG
FT                   SFGPFEEDEEDAARIARAERNRLRRKGLNPKAILNKPAKSKSKDESSAPTEKTEEKEKK
FT                   KEESPKRETPAKKESKESPKPKADSKPTKTKTETAEPSTTKKQQQKPTTAQEPTEKKKK
FT                   TTAKKASKK"
FT   CDS_pept        join(312191..312301,312364..312886,312999..313006,
FT                   313127..313181,313232..313431)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161532" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812488"
FT                   /orf_name="An16g01510"
FT                   /product="Similarity to hypothetical protein B13N20.140 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK42768.1"
FT                   /db_xref="HOGENOM:HBG328338"
FT                   /db_xref="UniParc:UPI0000EFCDE2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6X2"
FT                   /transl_table=1
FT                   /translation="MSEVAFIKSFLSSLDSRPIKLRADYVLDEERVGPRVPENEQYLLP
FT                   RLSAPHPEMPKKVQRTQAPGSSKSITVHLKSARNPAFEFSLPNAPITTTSVQDLKDAVQ
FT                   ERVVDAQDGKVSVEKIKILYKRKPVTGKTIAELLADEPEMLAGGKEVEFGVMIMGGAKV
FT                   VEGGSSGEGDVSAAAAPKAAVGPSGEEVLRMEAFWDDLQGFLEQRLKDSVYVKGRPMLA
FT                   GFEYIYTSSLEIKQCTGWCKGSKGQGKEIIIQHSSIAPPMYWGPGISRHSSRPHGPQIL
FT                   FIWKRTKKFTGIEKVVL"
FT   CDS_pept        join(complement(317478..317574),complement(317160..317170),
FT                   complement(316374..316613),complement(316029..316287),
FT                   complement(314088..315967))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899789"
FT                   /orf_name="An16g01520"
FT                   /product="Localization: Zinedin is mainly expressed in the
FT                   central nervous system"
FT                   /protein_id="CAK42769.1"
FT                   /db_xref="HOGENOM:HBG328339"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013258"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0000EFCDE3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6X3"
FT                   /transl_table=1
FT                   /translation="MDPSGIKSNLEMRAHQQRLHEDHTPKEAKEGFAEVEVTTSRFSIG
FT                   NSALHRSSFRRLRELRCSVATNSTPFTVSIVDFAWLGSLPRPWLGAEGTSALGAMGLPT
FT                   AGIPRGQSTHCKTEWHRHERDRNAWEIERAEMKSRIGKLEGDVRTSKRLHESLGKHVRL
FT                   LEAALKKEREKVKKLSNNEKVEDTRDPKEIAKESINSLKAQRPKPHTGPSEADVNLENE
FT                   HEYRQENEREKSRLYLSKCSQEVAYHVIPSSHPPPELGEQDLPNHIYGNQQLSQQSLEE
FT                   AYLQQQRQKQHQQQQAQANDMMAREVALQNHQPVITHYADNSAMSRAQNQFGFPPATRE
FT                   AMERRPLEPQQTPLTAIDNRKQTLGNSLMDERAGQGDQAYDGYGSQSAAKDTKQQRMEE
FT                   QGDDADGWNFDEPAEPAPQAEQVPPHRPDVDAFPNANFVSSKSPQRSGSLSHRRKSSGA
FT                   RRKSDGAVDLAAAGPKPDPTFKVRFALRGHLDVVRSVIFTGGGSPSEPEICTCSDDGTI
FT                   KRWIIPATYGTFGASSSDLDITSYFTHRGHVGAVTALAACSPQNFSNGGRALGDGWVFS
FT                   GGQDTSVRVWERGRVDPKATLDGHTDAVWGLCVLPGTAGSVLGDSSSHYGGPDRILLAS
FT                   GGADGRIIIWAVSAPPQLSSPQAGSRRAGGSRRANSISSGSNFPSSPQPSTATTTPFHY
FT                   SMVRQIVRTESPSPTCISPLSLAGINFVVSYTDASILVYDTRTGEEIVGMASLETYDGT
FT                   PSTGVNSVVATTVGFDGSAGLDPSRTMGEEEVVHGATGSSGVEGVIISGYEDRYIRFFD
FT                   ANSGMFHKASFDVCVC"
FT   CDS_pept        join(complement(318296..318926),complement(317790..318235))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161499" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116664"
FT                   /orf_name="An16g01530"
FT                   /product="Remark: product: human downs syndrome critical
FT                   region-like"
FT                   /protein_id="CAK42770.1"
FT                   /db_xref="HOGENOM:HBG328340"
FT                   /db_xref="InterPro:IPR013717"
FT                   /db_xref="UniParc:UPI0000EFCDE4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6X4"
FT                   /transl_table=1
FT                   /translation="MTLLDNEEDENSRYLRNNSEPPSVITSIEPKQPFPPLPADDLATT
FT                   TLSSQNDGYVEEDDHDPTSPSHADIDAEDDADFQSQYSLDDQAFSDASTDSEEQSPEDG
FT                   LSMHHPFRQSTSSLHGPNAFAPPFYNRPPTPLPPSPSLTSLLRPPFSTTTSRPTTPDSS
FT                   DVETPNDTEAAVAKSARRATTVPRASPKVPTYEYYGFVLYLASSLAFLIYILWSYLPSP
FT                   FLHQLGIYYYPNRWWSLAFPSWLVMSIIYIYVALASYNTGYLTLPMNSMENIVDEVANV
FT                   AVIDGKGRRRPGGAAKMRPGATSYQIMGPQNRKVNWKEIWSEGTDAVLDVPVGGVCEVL
FT                   YGQERDDDELFEEASTIS"
FT   CDS_pept        join(323726..323856,323955..324192,324233..325229,
FT                   325280..325678,325734..326449)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161488" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812489"
FT                   /orf_name="An16g01540"
FT                   /product="Similarity: strong similarity to S. pombe
FT                   hypothetical protein SPAC24H6. 13 "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK42771.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG327532"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR022257"
FT                   /db_xref="UniParc:UPI0000EFCDE5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6X5"
FT                   /transl_table=1
FT                   /translation="MSDLGLGGDSTSLSAFLTTLIPALVIAAFWFGLFLICRRTQLRCE
FT                   RAPRLPSGFINWFGQFLKISDAQVLRHSSMDGYLFLRFLRVLSATCFTGCVITWPILLP
FT                   INATGGAGNTQLDALSFSNRLSISVRDPSSITDERHGLMFCVEAFVFFVVTRESIFYAN
FT                   LRQAYFNSPAYAERISSRTVLFMSVPEEYKNEKTLRQVFGNNINRIWITSECKTLDKKV
FT                   MERAKLAYKLEHAETKLIRAANSARLKAIKKGVALSKPCLDSDSCEECQSNTSTTYHGI
FT                   KRPTHRVKMFGKKVDTIRWLRAELTKVIEEISILQKKHRNGEMKNLSAVFIEFATQKDA
FT                   QVALQTVSHHQPLHMTPRFIGISPNEVVWSALNLSWWQRIARRFAVQGGLAALVIFWSI
FT                   PSAMVGTISNITYLTSMIPFLGFINKLPSVILGLISGLLPSAALALLMSLVPIICRACA
FT                   RVSGVPSTSRVELFTQSAHFCFQVVQVFLVTTLTSAASAATAQIIKDPLSAKDLLAENL
FT                   PKATNFYISYFLLQGLTMSSMAVVQVAGAVVFKFITTFFDRTPRRLYQRWAALSGVGWG
FT                   NVFPVFTNMGVIAITYSCIAPLILGFAFVGLYLVYQAYRYNFLFVYELRIDTRGLVYPR
FT                   ALQHLLTGIYLADICLIGLFAIKGAIGPLIIMALFLIVTILAHISLNDALEPLYSFLPA
FT                   NLDVEEESQLSKAEADALNPRSVGKWEAAWKWFHPNLYRDYAALRGKVPRDHVEIRYTE
FT                   EERNKAYYEPCITARTPTLWIPRDKWGFSQQEVLDTDPCIPITDEGAHLNEKNRIVWDK
FT                   YDPKLPLWELKILY"
FT   CDS_pept        join(complement(329589..330231),complement(328638..329536),
FT                   complement(327449..328588))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965655"
FT                   /orf_name="An16g01550"
FT                   /product="Similarity to hypothetical protein B23I11.160 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK42772.1"
FT                   /db_xref="HOGENOM:HBG328341"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="UniParc:UPI0000EFCDE6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6X6"
FT                   /transl_table=1
FT                   /translation="MVLRKRAPPRLNSLPQGNDRTGSRFTNSKLSPTSKSLSSSSPKRL
FT                   TRPRRAQSSPQPHRVVSQESVFSPDLNTSPAFDLMPLEQAQRSPIRNSAGDGSNPWADE
FT                   LTARFGLDHQDSVASPRQIASSPSQGMGMVNGNASDQVPSTSFPGVQERGAAEWRPDRE
FT                   YTGQSPVQLQSNNPFLKPRSPEPNPWQDRNSHTSYGESSQFHDGASGHLGQDEGYIPMT
FT                   ARLSLFDQPEEETPWVGEESTAMQPPASSQPYGYHDQSQLYAGQETGIHYGTTNVPGAP
FT                   YTSQQTYLQPTPQLHDEGRESPARSMSTPATISSNTTGSSHVLIELDEAPIPPPKTDAP
FT                   TKAPQGYNLNSPEGPQEEILREKPGDAPPLPDGSKGPGAVYTHSAFSGPMSEAEAKRQQ
FT                   EQRSETYSIRHVNWADSTGKLRESPILVQNKNGPCPLLALVNALVLRSTIHDSQPPIVR
FT                   ALQTREQISLGLLIEALFDELTTRLGPDDEFPDIEALSRFLTMLHTGMNVNPQLTLESN
FT                   DALGTFLETEDIRFYGTFGVPLVHGWLAAPSTEADAALARVGQYHEDIQLLPFRKQDLE
FT                   DRVMRGNALTPEEELVMSDIQTIQKFTEFENATQLSTFGLNHLATTLQPGSFSILFRND
FT                   HFSTLYKHPRLDQLFTLVTDAGYSSHAEVVWESLVDVNGSEAGFFSGDFRPVSHDAPPP
FT                   SDPSGPRTSSNTGLAPEPHEQRSSTMTPQEQADADYAYALALQYQEEEQRANATTNRDS
FT                   TNRNPSQRASVSHPPSSGLAPGAAYTRNRSSSAVNPSSASYATVASGNRSSRQSQRPAR
FT                   YSQSNIPTIRPTDDDDVPPPSYEQAARSPVYPSPQRSPNFTDSSNASPYQRTQQGRRPP
FT                   GVPLTTGPSERTRDRPKDCIVM"
FT   CDS_pept        join(331125..331210,331270..331929,332155..332579,
FT                   332706..332941)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161466" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899790"
FT                   /orf_name="An16g01560"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAK42773.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG397982"
FT                   /db_xref="InterPro:IPR007316"
FT                   /db_xref="UniParc:UPI0000EFCDE7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6X7"
FT                   /transl_table=1
FT                   /translation="MHSYVRPNQFVAFKLPSEATRIQKVVPNTQISLGKYGAFPANQII
FT                   GRPFYLTFEIHETPGQADSTYLRIVSAAELHAESLITEGEGDGDDVEVNEDGTPVRSNR
FT                   ETIDDRSTQKLTLEEILALKKESTGAGREIIAKLLESHQALDQKTAFSLAKYKLRKEKK
FT                   YMKRFTVIPLDVSLLTNYMLEDKDAARTMELRDELIGLIGCWGNVHHGGSTSFDETVTS
FT                   KPNGRYLVVDDTGGLVVAALAERMGILLLKYFGYEQDSPSDTHPLYTNLKTVSFMQLLD
FT                   PMADNIYSEEPSVVPEEELATYKASKRSAYHRKRGRWMRVRKVVDEARAGGFDGLIIAS
FT                   LMSPTSILKYTVPLVGGSAPITIYSPTVEPLTEVMDLYSTARKNAYIARKLRVWQVLPG
FT                   RTHPLMSGRGGAEGYIFHGIRVIPTQEIIEAAGNPGRKRRKVTKETETPTQTQTPTETQ
FT                   TGSGDVEMTS"
FT   CDS_pept        join(complement(334280..334285),complement(334167..334212),
FT                   complement(333773..334047),complement(333553..333665),
FT                   complement(333404..333482),complement(333298..333345))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659683"
FT                   /orf_name="An16g01570"
FT                   /product="Complex: protein belongs to a complex composed of
FT                   arp2"
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="CAK42774.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="HOGENOM:HBG320336"
FT                   /db_xref="InterPro:IPR007204"
FT                   /db_xref="UniParc:UPI0000EFCDE8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6X8"
FT                   /transl_table=1
FT                   /translation="MPAYHSIFLEDRDVPVIGNFPILPLRTRTRGPAYTLPPLPPTADT
FT                   TDVPADSESYDCVDEILSLFRANVLFRNFEINGPADRMLIYGTLFISECLGKVKPGMAM
FT                   REAEKALINVALDHFAIPGDVSFPLNQAFEAPRDRQDAETLRQYLSQVRQEIAVRLHAR
FT                   LYPGGEGPSKWWLSFAKRKFMGKSF"
FT   CDS_pept        join(334588..334724,334780..334867,334932..335670,
FT                   335742..335806)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224152" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899791"
FT                   /orf_name="An16g01580"
FT                   /product="Remark: the yeast Arxula adeninivorans
FT                   replication factor C"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAK42775.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI0000EFCDE9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6X9"
FT                   /transl_table=1
FT                   /translation="MSDYEDSMDVDVPSKSAIQFSSDNTSGKAKRVAADLPVEAQDNLP
FT                   WVEKYRPNTLEDVSGHQDILATINKFVEANRLPHLLLYGPPGTGKTSTILALARRIYGA
FT                   KNMRQMVLELNASDDRGIDVVREQIKTFASTKQIFSMAPSSTSTSSSTLASYKLIILDE
FT                   ADAMTATAQMALRRIMEKYTANTRFCIIANYTHKLSPALLSRCTRFRFSPLKEADIRVL
FT                   VDIVIEKEQVNIQPEAVDSLVRLSKGDMRRALNVLQACFASSIPLPMKNAPKDQEAKEK
FT                   PEAEVITNETIYDCIAAPHPSDIEEIMTTLLATSDVTSCLIAEAGGAGADESDVVGRVG
FT                   GD"
FT   CDS_pept        join(complement(337779..337967),complement(337643..337728),
FT                   complement(337377..337577),complement(336808..337330),
FT                   complement(336130..336750))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899792"
FT                   /orf_name="An16g01590"
FT                   /product="Remark: TOXA of Cochliobolus carbonum encodes an
FT                   HC-toxin"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK42776.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG330720"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCDEA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y0"
FT                   /transl_table=1
FT                   /translation="MATMTEEIVLTERVEEAAPASKIDSNAQVRDGGSHEEQPVYPHGF
FT                   HFALISASLVLTVFLTGLDETIITTAVPKITDEFHSIADVGWYGSAFRLASSMSQLLQG
FT                   RVFDQFSVKWAFLLHLIVFEAGAIISGAAPSSLVFIIGRVISGLGFSGISQGCMVIISM
FT                   TRPLNKRPIYIGAISASEFCATAIAPIIGGAITSSLSWRWCFYLNVIGSILPAITTLVI
FT                   FKSPSGRITHGVSHVQRLKQIDFAGMVLFAAGLLTLLLSIQWGGDTYSWSNDRIIALLT
FT                   ISPIFFVVFLLVQVKKQDFAMLPLRLLKQRSILFGALFSLALQAVNGIASYYLSLWFQV
FT                   VRSATPLQSGLMLLPMVISILLASVISGYAITYIGYYVIFMIPAGLITLAGAIMTTYFE
FT                   KDTPATFWIPALALLGFGIGLGISGPFLAVQAILPEKDTSVGLAIMSFSQEFGIALSLG
FT                   IAQCLFLNKLKESIEAITPYLDPESVINAGATSLVGTGLEKYASLIAEEYSKGLRVTFV
FT                   FGAGMAGVVFVMACCMEVRSVK"
FT   CDS_pept        join(complement(340365..340443),complement(339596..340317),
FT                   complement(339180..339512),complement(339074..339124),
FT                   complement(338727..338768))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212705" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116665"
FT                   /orf_name="An16g01600"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK42777.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG328342"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCE17"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y1"
FT                   /transl_table=1
FT                   /translation="MVSPKGKVFLIAGLVALAGLLYGLDTGSIGPVTQMPQFESSIGRL
FT                   SSTQQGVFVACILLSSSASSLASGHVSDRISRKYGILIGGLLSLAGTIISACSPNFASL
FT                   IVARLITGVGMGQAISVTTVYLVEIAPADVRGVVACSLQLYVVFGIMSGYFITYGTQYL
FT                   NGSMSWRVPFIIQAIMAAVLSVVMLLLPFSPRWLVQVGRNEDARRVLRKLRPEPVVEEE
FT                   LREIQDSLQSDQQRATASMAEIFGRKYIGRTSLGVFLMTFQQLTGIDVVLYYAPILFEQ
FT                   AGFTSTKASFLSSGIIGIVMLVFTIPAQIWVDRWGRRKPLIMGGSAMAICFIVIGALYA
FT                   RYGHTTHDAVTLDSHSAQWAVVVLIFIFVANFSWSWAVVGKIYASEIIPTRLRAKRCEL
FT                   TVGLNPAEI"
FT   mat_peptide     join(complement(340365..340374),complement(339596..340317),
FT                   complement(339180..339512),complement(339074..339124),
FT                   complement(338730..338768))
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y1 "
FT   sig_peptide     complement(340375..340443)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y1 "
FT   CDS_pept        join(341581..341614,341669..341887,341943..343120)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965656"
FT                   /orf_name="An16g01610"
FT                   /EC_number="1.14.11.1"
FT                   /function="gamma-butyrobetaine dioxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42778.1"
FT                   /db_xref="GO:0008336"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000EFCE18"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y2"
FT                   /transl_table=1
FT                   /translation="MDIKKCGLGANVPKFYDPSDVESIRASVFNDGIAFVEGCEEEALV
FT                   GLAHQLGQVVRPRNEATPGSGVSRIRFASDLIGKGYSSEELFFHTDRSGWDEPPRILMS
FT                   TLRSQSESGGESLLVDGQSVLNALKKHDEDLYNLFTSSKHTSFRADDGTFVPRAMVDKD
FT                   TGIFRFRFDDGIQMSASMVVGFAKLQDIIYQHAYFVTLRPGQGYVLDNHRYLHGRASFT
FT                   GSRELLRVLVKPSSPPSERVILFDIDGTLCRSEALSIDAYYSCVSDIVGKDINHANTPV
FT                   NLHGRTDLGLLHDSLDYHQVATKDQVVEKFLKLHPQYLERSLFRGLPSVICPGAQEMLS
FT                   WLIRENENSSLPKFQLGLITGNSRPNALLKLRGAGIDTGIFDLAISSFGDSHHNRLSLF
FT                   QDSLSKLQARFGSHIRAKDVLVVGDTPLDVECAKQAGCSVVAVATGNYKMEELASLKPN
FT                   FCCSQLTETKEYLLQAAF"
FT   CDS_pept        join(complement(344607..345055),complement(343347..344556))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167263" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965657"
FT                   /orf_name="An16g01620"
FT                   /product="Catalytic activity: ATP + D-hexose  "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAK42779.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG328160"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniParc:UPI0000EFCE19"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y3"
FT                   /transl_table=1
FT                   /translation="MGKSDPNLQEFLHPLSIDHHTLYNLSHRLSYTYRELAASSSEQFF
FT                   PTAITRLPTGHETGRYLAVYLGLSYLRVAFIELLGDQPVGRQPHVRRTLEKAWPIEERL
FT                   RRDQARSLFAWIGDCIAEVIADDLANSRGDPPKELIMGISFCFPTKQKFLNEAILMPTG
FT                   KGFALNSSLNLHQALLDGYECHTRRSDQDSSDMPAKRRKTYCLPKLKVTVMTNDTVATL
FT                   ASLAYSIRALPNTRVVMGLIVGAGCNSAIPMKLADLQESKVAHIREKQPEADETVVSTE
FT                   WTLHGATGPLEELGIVTKWDAELEEHSNRPGFQPLEYMVGGRYIGELVRIICYDWFHEA
FT                   KNIPRSSMPKKLVERDCLSTDFLSLVVASSSSNEHLAVALSNHLPSPSSSDWIWTPELA
FT                   GHIRMIAAAVQERSSALVAAATVGLLACTGEVKLKSTSRLETDDKSSGPSKSMSTQNDT
FT                   VPNPESLTPGWRKGPEELVVAVSGGVIQHYPHYKDRIQRHIDRLILSAGPQGEGKSVFL
FT                   REASDGGIVGVGVLAGTAAGEIQEIIGSTLESERS"
FT   CDS_pept        join(345863..345985,346038..346060,346120..346239,
FT                   346311..346870,346942..347147)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899793"
FT                   /orf_name="An16g01630"
FT                   /product="Function: probably involved in lovastatin
FT                   production."
FT                   /EC_number="1.3.1.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42780.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326376"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCE1A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y4"
FT                   /transl_table=1
FT                   /translation="MTQNKAAWITAPTEHPFTIRDAPYPTPGPGEIVIKNAAVSINPAD
FT                   WKIQTYGGPWLRNWPFVLGTDVAGVVVDVGPGVVRFTKGQRVVAYCHCLGTGDPANSGF
FT                   QLYTLVKEITVAGIPDSITFEEASVLPQAISTAAAGLFLKESLNLPIPPPTGAKPTGKS
FT                   ILIWGGASSVGATTIQFAEAAGLSAITTASTHNHGLVKSLGASAVFDYKSPTIVEDVAS
FT                   AIRNTDFIGVYDAISEPASFEMVRAVLDRLKADVKTICVSPYDKPTERFAPIFISSNFL
FT                   TYDSNKHVADGIWRDFVSEALENRRLKPKPDPEVVGKGLEEIQNAVDILKKGVSAKKII
FT                   VTL"
FT   CDS_pept        join(complement(349412..349578),complement(348811..349352),
FT                   complement(347688..348761),complement(347340..347614))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235035" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116666"
FT                   /orf_name="An16g01640"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42781.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG328345"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCE1B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y5"
FT                   /transl_table=1
FT                   /translation="MDISQSRRILRKTFACDECKRRKIRCSGNENCNNCRRDARSCRYS
FT                   SPSQRLSTLQRRLNESERLRADMERAWAIYLPTVDLQDALHTVRSQNDSITATQQGPHR
FT                   QKHLSDVTHATEQPPAGFVEPSNAEDYEFDESQDFDNSTDGMGFLTVDPHKAGYTGPQS
FT                   GIAALKFLQSLPLYLPLTSFSPLSCLDDDIDGGTACTAQQRRADVLRYLDDYFAFYHPA
FT                   YPILHEGTFRARVSGALAKPRDGSWPILYNIVLAIGAFVGDSQGTKVDIPFFKEARKHL
FT                   SMDVLEKGSLSYVQAIVLMANYMQKRNKPNAAFIVIGIGWSMALAIGLHREFGMPSTSP
FT                   FTMEIRRRVWWTLFVFVSGVQLTLGRPAVSLVGVNVHLPANVDDHDLAVDMDELPECGT
FT                   GPTITSCLIAQVNLAKIANVVQVELLTHHLPTQQKAADLEQRIHTWYQELPPHFGLSIP
FT                   LEPRFDIPRRVLLWRSFHLRIVINRPFLFQSIAAKSELTTSTGPVAACLTAADECVASI
FT                   CSFLESTSNRRRGLTWYATCWLLTASFVQATCYIYEPAHSLAQTWKCQIQRAVNCLGSL
FT                   GSSHDMALRARDVLQNILEHGHGIAVPSDMAPYASSQLPGSFRALWFPTNDQQTFKPNT
FT                   LGLDDNMSGYAPGSFNAEFLDAAGGLMIQNFFDNYSEERAQNAPGSSIPG"
FT   CDS_pept        join(350030..350122,350184..350858)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18965658"
FT                   /orf_name="An16g01650"
FT                   /product="Catalytic activity: scytalone + NADP+  "
FT                   /EC_number="1.1.1.252"
FT                   /function="binding"
FT                   /function="tetrahydroxynaphthalene reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42782.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0047039"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000EFCE1C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y6"
FT                   /transl_table=1
FT                   /translation="MSLKGKVAIVTGGARGIGAGIVRSLSEQGAKVAFNYVSPSSRKAA
FT                   DALVESLRQNNKEATAVQADITDPNAPNMIIQAALEAFQTDRIDILVNNAGAGDNRPLE
FT                   EVTMDSYMRLMDVNVRAVVFMTQAILPYIPRGGRIINLSSISSRGGYATQSVYAASKAA
FT                   VEGLTRVWATELGHKYGVTVNAVNPGPVDTDMYQAAGEVHLKRMEEQNKKVPAGQRCGT
FT                   VQDIGDIVSFLAEERSRWVTGDVICANGGMLYI"
FT   CDS_pept        join(351773..353120,353182..353226,353276..353415)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812490"
FT                   /orf_name="An16g01660"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK42783.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325037"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCE1D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y7"
FT                   /transl_table=1
FT                   /translation="MSAPPTGCHRKAASQQPTCDQIESASGPKILTEADCYSELGFSFP
FT                   NIKKWTIILVIFLVQTSMNFNTSLYSNAISGISEEFNVSKQAARCGAMIFLILYAFGCE
FT                   LWAPWSEEMGRKPILQLSLFLVNIWQIPVGIAPNFATIMVGRALGGICTAGGSVTLGMI
FT                   ADLWEPDDQQYAVACVVFSSVGGSVLGPVVGGFVEAYLPWRWNIWIQLIFGGFVQLAHL
FT                   ILVPETRTSVMIDRIAKQRREKGENVYGPTELIPLKDRFSGKEIVGTWLRPFHMLLTEP
FT                   IVLCLSLLSGFTDALIFIFIQSFGLVYAQWNFSTVAVGLSFLPIMIGYVITWIMVIPVI
FT                   KRNIHERRSKPNDERAQYESRLWWLLYTAPCLPIGLIGFAWTSLPQTHWVGSMFFSALV
FT                   GIANFSIFMATIDYMICAYGPYSASATGGNGWARDFLAGVLTVPATPFYENIGGKYRLE
FT                   YASTILFCISMILVATVYVVYFYGPTLRKRSPFAQKLLHERADIHASMEHNK"
FT   CDS_pept        join(complement(354877..354996),complement(353885..354814))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160912" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812491"
FT                   /orf_name="An16g01670"
FT                   /EC_number="2.5.1.10"
FT                   /EC_number="2.5.1.1"
FT                   /function="dimethylallyltranstransferase activity "
FT                   /function="geranyltranstransferase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAK42784.1"
FT                   /db_xref="GO:0004161"
FT                   /db_xref="GO:0004337"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="HOGENOM:HBG328346"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI0000EFCE1E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y8"
FT                   /transl_table=1
FT                   /translation="MGFTVDRSKFDGVLAELVADVLEHFASNGAPQEVKNYVEKCFYEN
FT                   STNGKMLRGLSVPQTGLSILGRPVTEQEYHDLCVLGWLVELLQAYLLTHDDIMDNSSTR
FT                   RGKPCWYRLPSVGMKAVNDGSLLRSSIFFLLKQHFQTHPAYLRIMETFHEVSFLCEIGQ
FT                   ECDGIASEQRSIENWTMAEYEKICNLKAGYYTFYLSVSIALQYLQLDTPLNVQQIQDIL
FT                   IPLGSFYQSQNDYLDIFGNHHLTGKIGTDIQENKCSWVIIRALQMCSTEQRHVLLENYG
FT                   QSSHDFALKCQRIFEALPLRELYRSEETRVFSGLQDKIGSLDDSEGLRGGIFDVLLGCV
FT                   RGVTKQARP"
FT   CDS_pept        join(complement(356118..356738),complement(355789..355982),
FT                   complement(355582..355698),complement(355385..355532),
FT                   complement(355276..355347))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201287" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899794"
FT                   /orf_name="An16g01680"
FT                   /product="Catalytic activity: RX + glutathione [ "
FT                   /EC_number="2.5.1.18"
FT                   /function="gamma-glutamyltransferase activity"
FT                   /function="glutathione transferase activity"
FT                   /protein_id="CAK42785.1"
FT                   /db_xref="GO:0003840"
FT                   /db_xref="GO:0004364"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI0000EFCE1F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Y9"
FT                   /transl_table=1
FT                   /translation="MTTPLEVWGRRDSSNVQAVMWCIAELNLPYLRHDIGQRFGGNNTP
FT                   EFLAMNPNGRIPVLRDGASEPLWESGAINRYLASAYGSDEFWPQDPRARAQIDKWAEWA
FT                   KVTFTPAFSLRIWWQLVRVAPSKRDPIAIREAVAGLDPILDIAEAQLTRQKFLAGDVFT
FT                   LADVQFGHLLFRYFSIDIERKERPGLQRYYEALKERPAYREHVMTKDQCENDLRNYSVD
FT                   IRDPLIDTYYYNHTIVSPKTPFSDVIAQKVLMVHRDTLQIIEAMKFGYAVYKETMLSNG
FT                   KSHRINGSITDDSTHDESYYGPGGHTSREEGVTSHLVAAGDTGLAISLTTPVNLLSEQK
FT                   AARGKHSSGKSRPSRDLENQFGQDTHDYVRAHKESCKSVLKNR"
FT   CDS_pept        join(complement(359124..359851),complement(358361..359093))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899795"
FT                   /orf_name="An16g01690"
FT                   /product="Remark: XPCT is subject to X chromosome
FT                   inactivation"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK42786.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329889"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCE20"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z0"
FT                   /transl_table=1
FT                   /translation="MDTIISAEPSHRRPKPTDSLRLVNQSEPDSKGRSSTKATDHESVS
FT                   EFTYPEGGFAAWTVAIGCWCSMTAGLGLVNSVGVLEAYVSYNMLPSSSPSAIGWIFGIY
FT                   VFISYFCGLQIGPIFDARGPRELMILGTVCSLAGIFCLGLCTGTVPLTGSQAHAANSSF
FT                   FSFLPEYYQFILSLSILNGIGSSFLFTPAMGTISHWFNAKRGLASGFAFTGSGLGGVIF
FT                   PLMLQSLIPRLGWGWSMRLVGVVLCRSRLPPKRGATSSWRDVLPSAAIFRDGTGAMAVT
FT                   SAGVFLVEWAYFVPITYLPTYYLTRKGLSGRQAIVDSDAAFAYRLLAILNSVSCLGRFF
FT                   IGYIADRIGRYNTMIVSTLLCLVSVMCLWLPDAMADSPPTLALIIAFVILFGFASGSNI
FT                   SLTPVCVGQLCGTQDYGRYYASAYTLVSFGCLTGIPIAGSLMKATDDSGRKSFWGVILF
FT                   TGMSYIASFACFLWVRVRIKGWNWKVIW"
FT   CDS_pept        join(complement(361677..361823),complement(361283..361615))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899796"
FT                   /orf_name="An16g01700"
FT                   /product="Catalytic activity: L-iditol + NAD(+) [ "
FT                   /EC_number="1.1.1.14"
FT                   /function="L-iditol 2-dehydrogenase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42787.1"
FT                   /db_xref="GO:0003939"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniParc:UPI0000EFCE21"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z1"
FT                   /transl_table=1
FT                   /translation="MSTLQPSVNRALVLHPGGTFTHSERRIPTIESDRDVLVRVVATGL
FT                   CGSDIHYWQHGKLGEYEVTQPLILAHESSGVIVATGGNFQGLKINDRVALEPRNPCNVC
FT                   PYCRSGRYKLCTSNSLESHCIMESSFWSDTSVSQNNLLAPTFSRNISNSCLKITT"
FT   CDS_pept        join(362195..362462,362589..363055,363133..363408)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899797"
FT                   /orf_name="An16g01710"
FT                   /product="Catalytic activity: L-iditol + NAD(+) [ "
FT                   /EC_number="1.1.1.14"
FT                   /function="L-iditol 2-dehydrogenase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42788.1"
FT                   /db_xref="GO:0003939"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCE22"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z2"
FT                   /transl_table=1
FT                   /translation="MEIIQQKPTNYAIHTSPANDLRLVECEIPKIAPNECLVHVRATGI
FT                   CGSDVHFWKHGHIGPMIVTGDNGLGHESAGVVLQVGEAVTRFKPGLYHACPDVVFFSTP
FT                   PHHGTLRRYHAHPEAWLHKIPDHVSFEEGSLLEPLTVALAGIDRSGLRLADPLVICGAG
FT                   PIGLVTLLAANAAGAEPIVITDLDENRLAKAKELVPRVRPVKVEKGESSADLGQRIISE
FT                   LGQEAKLVMECTGVESSVHAGIYATRFGGTVFVIGVGKDFQNIPFMHMSAKEINLKFQY
FT                   RYHDIYPKSIALVAAGMIDLKPLVSHRFKLEEGLKAFDTASNPRSGAIKVQILDD"
FT   CDS_pept        join(complement(364986..365054),complement(364781..364927),
FT                   complement(364610..364714),complement(364360..364556),
FT                   complement(364226..364310),complement(364113..364168),
FT                   complement(363679..364057))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899798"
FT                   /orf_name="An16g01720"
FT                   /product="Catalytic activity: an alcohol + NADP(+) [ "
FT                   /EC_number="1.1.1.21"
FT                   /function="aldehyde reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42789.1"
FT                   /db_xref="GO:0004032"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0000EFCE23"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z3"
FT                   /transl_table=1
FT                   /translation="MALNRTFKLNTGYDMPAVGLGTWQSKKDEVRDAVIAALKCGYRHI
FT                   DAAAVYGNEQEVGDGMRLSGVPREEIFLTSKLWNTHHHPENVEEAVDKSLADLQTDYLD
FT                   LYLIHWPVAFRYSTTTIQPVNEQTGLIDVVDVPIKDTWAAMEKLVEKGKVRSIGVSNFT
FT                   REKIEELLKTAKITPAVNQIEAHPFLQQRDLLEWSTQKGIVVAGYSPLGNNIYNIPRAV
FT                   DDPLVIETAKKLNKTPAQVLISWAVQRGTVVLPKSVTPERIESNFQGSLSPTHNICPHC
FT                   ANMDYSDFILPDDAFSTIQSLERHQRMNFPARIGVDIFSEVGEESVRKSALAWAEQQRV
FT                   LKAKA"
FT   CDS_pept        366773..368203
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116667"
FT                   /orf_name="An16g01730"
FT                   /EC_number="3.1.3.2"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="CAK42790.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG328349"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="UniParc:UPI0000EFCE24"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z4"
FT                   /transl_table=1
FT                   /translation="MHSLQSSRLCLALMAMSLALPASAEKVLGAYIFARHGDRTAKVLK
FT                   DTELTDLGYREVYTTGSYWRSRYIDSGSSLQIQDISEDIVKLSQISASTPSDDVLQNSA
FT                   TGFLQGVYPPVGSSANETLADGTVVDSPLDGYQLIPLAMTDSGSNSEDTTWLQSATNCQ
FT                   NAEVSSNNYYTSSLYNSLLNSTTDFYQSLSSLLNSTFSESSMSFKNAYTIFDYLNVGSI
FT                   HNTTNVPTAEQLQQAFLLANIEQYNLAYNSSEPIRAVAGAMLAGDVLQGLNKTITSKGK
FT                   TKLNLQFGSYGTFLSYFGLAQLPAADVNFTGIPDYASSMAWELVTNSTSNEFPSTSDIS
FT                   VRFVFHNGTLNESKNDSPTEYPLYGRSSATIPWSDFVSLSTKIAVTSQSQWCQACGNTD
FT                   GQCASYSTSSNSSSTSPTQEMSSSGISRPVAGVIGAMVTLAVILGAEALLLLVGGFRIT
FT                   KKGRIAQNAAADEEDKAS"
FT   sig_peptide     366773..366844
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z4 "
FT   mat_peptide     366845..368200
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z4 "
FT   CDS_pept        join(368844..369238,369293..369877,369931..369976)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659684"
FT                   /orf_name="An16g01740"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An14g02280 - Aspergillus niger"
FT                   /protein_id="CAK42791.1"
FT                   /db_xref="HOGENOM:HBG327437"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniParc:UPI0000EFCE25"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z5"
FT                   /transl_table=1
FT                   /translation="MQFLIRLTVAALLVLTVLWVGSQVSIVQPQQEIIPETNPVEDEYR
FT                   AATPTDSIQPDIADISHTPSASPSPSVSRKKRPSITDLLPSYQKDTASPQWAIDNMLDT
FT                   TQTPIDGVIVVGRLKFERPDWLINELPDWRHAIYTRDDRRHPLSIPKNKGKASTVYLQY
FT                   IIDHYHHLPATIVFLHNHRKPGHTEFRDYGNVAAVTFLRRDFVQKNGFANLRCTTSSSS
FT                   SPSTECGNVIRPVSDSKESSAQASSVEQEYPTIWKTFFNSTDVPEMIATPYCGQFAVSR
FT                   EQVRKRPREEYMRYQQWVMETKLKDEEIEQVMGSLWHVIFGREAVYCPDTAKCFEDVYG
FT                   L"
FT   sig_peptide     368844..368930
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z5 "
FT   mat_peptide     join(368931..369238,369293..369877,369931..369973)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z5 "
FT   CDS_pept        370421..372154
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161443" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812492"
FT                   /orf_name="An16g01750"
FT                   /product="Catalytic activity: peptidylproline "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAK42792.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG328350"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI0000EFCE48"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z6"
FT                   /transl_table=1
FT                   /translation="MSTHYNTEPTATASATLHTTLGPLHIALFASQTPLTCRNFLQHIQ
FT                   DNYYAGTIFHRIIPNFILQGGDPTGTGSGGTSIYEEPEFEYDPTARDPNEKVVLRDELH
FT                   SRLRFNRRGLVGMAKAEDGSYGSQFFITLGDASRELNGQCTLFGRIEGDSIYNVLKIAE
FT                   GEVVEGTERPVYPVRVTGCEVGELGPLEGKIVKRDLTARSSATAAGTGEGKGEKKAAQA
FT                   KKKGKAKGGKTLLSFGDDEGEEGEEMPVRPAKPKYNAALVTDTAGNGDAQPAEKKKLKA
FT                   RKASPSPPPRKRASPTPPPIDRPKTPDPATQLPLRDPESPERSPSPEEQPAQKSKLERT
FT                   NAEIESLKASMRRTVTTESDTGRKKSALEAMIPQTAIRGRKRPPPGSSASNSASNGITG
FT                   FSSTSDNAALKMFNAFKAKLENADSTTTTSTSTSSKPQPKSQKEKEEDDEDDEESQLCD
FT                   LHFIVNCQSCKSWSDNNATAPDAADGDEGTQLGDDTDQGWLTHQLRFGKDTLGKDLEWK
FT                   KEHPDDVDSLMVIDPREKEKDIVASGSGSGRRKRGMMERDRERDRKRGRVGDLEWEKGR
FT                   K"
FT   CDS_pept        join(complement(374911..375377),complement(372930..374853))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899799"
FT                   /orf_name="An16g01760"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42793.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG328351"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000EFCE49"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z7"
FT                   /transl_table=1
FT                   /translation="MSPQGITRKRPAPGTSPIVHPQLGPLSSYPQNPGNQLSNDQFLQW
FT                   GQSSSSVSSPSFPDANPYSATAYTSSPDVPAANVTATAPGQLARRQTPTQLVNRGRGYE
FT                   QTPPFSDHSTGTGENGGWGESLEDLYKRAMVAKREAQAKRKQIPPFVQKLSSFLDESKN
FT                   TELIRWSDDGNSFIVMDEDEFAKTLIPELFKHNNYASFVRQLNMYGFHKKVGLSDNSMR
FT                   ASERKNKSPSEYANPYFKRGHPDLLWLIQKPKNTAGQGSKSGKANVRVKTEEAEDQDHD
FT                   DYGDDGVGARDDRARNRQLSLITNNVMPKDQLAGVYRELQAIRQQQQIISNTISKLRRE
FT                   HEQLYAQAANFQEQHTRHENSINAILTFLATVYNRSLQGQEGPQNLANSFAGAISQDQG
FT                   NVVDMGDDYTLSTLGASNLNSPGGQRSMKKQPLLLKAPPGADRQSRATTLSPAAAAYDR
FT                   SQPRGHGRQPSASQPGHVEEVFDTSPRPKEAPVPANQQYPQRDIMSVIQNSNARNGMPT
FT                   TFADFPNVLSSLETSGGNSPLTPNQRADMLRLMANESNSSGTSPPVSQNNALMTPTPPP
FT                   MPHNYSGRLANTRAEIDNLVKMQAEQDRSVQNLTNLLQPLSPTGTIPGIGTDGSVPPPP
FT                   LNLDEIFTNDYFTDIGDLEHNKHSLDFGDSSHSVPVTTSADPTATTGPEDGVIKDANEL
FT                   FDFDQIPAEGDLFSGANPQSTAGYYNGFDGSGYGTNPMSSGVGADAQIPISHESNRTEA
FT                   LPDSESTSPANTVDDGLQYGGSETNDSQGGKGNGGGAKRRKKA"
FT   CDS_pept        join(complement(377397..377663),complement(376628..377314))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965659"
FT                   /orf_name="An16g01770"
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42794.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG520069"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0000EFCE4A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z8"
FT                   /transl_table=1
FT                   /translation="MARAAMSKLSWESHVLRPVQNAPPAIIPTLIYGTAWKKDQTADLV
FT                   HQALGAGFRAVDTAAQPKHYREDLVGEGIRRALQDGYVRREDLHVQTKFTSVNGQSPDN
FT                   MPYDPKASVTDQVHASIKSSLHNLRPSSTADSVNDAYIDMLILHSPLPTMSQTLEAWSA
FT                   VESYVPHQVRNLGISNTTLSILKELFAQAKVKPAVVQNRFYADTQYDVPLRAFCRENQI
FT                   IYQSFWTLSANPELIRSDAVQLLAHEADISPAAALYCLVLGLGYTTVLDGTTKRHHMEA
FT                   DLAALQKIERFTENQPDLWQRILKRFQQLTGDQTVE"
FT   CDS_pept        join(378991..379294,379348..379631)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899800"
FT                   /orf_name="An16g01780"
FT                   /protein_id="CAK42795.1"
FT                   /db_xref="UniParc:UPI0000EFCE4B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z9"
FT                   /transl_table=1
FT                   /translation="MHFHLIPALLAITTNLLLTPLVRADNDLDSDDVPDRCWSVCGPVV
FT                   GITQGCDHKYDDNDRAELNCICNWVEAPTLLPLCEACIANYRSEHDHDDDHDAHDNDAY
FT                   DILTSCSLSTTTWNAAAATSALQSVNSTSATATATGSGAGASGTGSVSSTGGSAAAAAA
FT                   TGDVNAAVGVSVPGLSSVAVMLAMGMGYLGVV"
FT   sig_peptide     378991..379062
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z9 "
FT   mat_peptide     join(379063..379294,379348..379628)
FT                   /db_xref="UniProtKB/TrEMBL:A2R6Z9 "
FT   CDS_pept        join(381628..381686,381902..382373)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899801"
FT                   /orf_name="An16g01790"
FT                   /protein_id="CAK42796.1"
FT                   /db_xref="UniParc:UPI0000EFCE4C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R700"
FT                   /transl_table=1
FT                   /translation="MLNHNDFLHARIISEKNSEFMIAIIITSHSTPVPEEPVMASSRHH
FT                   SKQNVHHTLMPISLLKIEIALYSYQRHGLRSDKPTNYHHLPIKHPSPTRMSNKERARQP
FT                   HSKSHLISIVRISHTSQPHSTPKSNPVIRGNKAHAFCLKPTPALALPTGEDYLILEINA
FT                   TNTTYYSQPHTCS"
FT   gap             383363..383462
FT                   /estimated_length="unknown"
FT   CDS_pept        join(384804..385145,385211..385754,385793..386754)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899802"
FT                   /orf_name="An16g01800"
FT                   /product="Similarity to hypothetical protein YBL051c -
FT                   Saccharomyces cerevisiae"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK42797.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG328354"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EFCE4D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R701"
FT                   /transl_table=1
FT                   /translation="MSYQQAQDMYHDNSAARSPGSQRHQQPLHRQPSRQFDAYGPMPVN
FT                   LYDDMARYDTGRLERLNSSLHNNSYAYDLAGSQTWNPNGFANAQALGGIRSASTSLKTT
FT                   SRTGRAGLPTTWLDQQPGIPSAFSNLGPGPLQSSAMRPEASGPSEAEDELIPTAIVIKN
FT                   IPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGVFRGLAFANFTSAEETATVIEVLNHFE
FT                   LQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHRPMATSQLQTQSSMSSLTSHLP
FT                   ATSPSPVSQRGQKLVANPCRVSTEVDLNDSTTLSYYSQLLLFKEDTARDTLVFPSNLSP
FT                   VQRRTVHTLAHNMGLGHASRGSGDQRQVHVFKVAPGTNVSPPLSSIPAAVQPAETARRG
FT                   LNRAATIDFSESRNDGPTHFNTLRGQPSSGFLGVLDSPGNFGNTQNLRAAKSFADLRSY
FT                   TPSPVPSSASFPAALQSNGARLQHYDGATSGTSNTPTLTSAPSGSSLGMQRDDSLLVNS
FT                   LSSLSLGTGIGGPNASPRRLRGMFSWEQPESQPSSAGPIGSNRSIGVGFDGQSQERMPI
FT                   RQPRGPMPEKGPGFRRQNGHQSRGSDELRTSSGVEIIVE"
FT   CDS_pept        join(complement(389646..389744),complement(389221..389290),
FT                   complement(388890..389137))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812493"
FT                   /gene_name="HTZ1"
FT                   /orf_name="An16g01810"
FT                   /product="Histone H2A.Z"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42798.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG610736"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000EFCE4E"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R702"
FT                   /transl_table=1
FT                   /translation="MPGGKGKSIGGKAGSKDSAGKSQKSHSAKAGLQFPCGRVKRFLKN
FT                   NTQNKMRVGAKAAVYVTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDEELD
FT                   TLIRATIAFGGVLPRINRALLLKVEQKKKNKTEA"
FT   CDS_pept        join(390713..390729,390835..390995,391053..391434,
FT                   391653..391704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161354" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899803"
FT                   /orf_name="An16g01820"
FT                   /protein_id="CAK42799.1"
FT                   /db_xref="HOGENOM:HBG328355"
FT                   /db_xref="InterPro:IPR012098"
FT                   /db_xref="InterPro:IPR019263"
FT                   /db_xref="UniParc:UPI0000EFCE4F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R703"
FT                   /transl_table=1
FT                   /translation="MVSPQVTNLAIIVVMMQLAKKVPFEDPDVLMLVRGMYILSNVIIL
FT                   GVYLYTQSKINKKNDLTTLKYVEPSPMGSGEEPKPVTTTNMEYDKGQLRQLMRSQLMGV
FT                   GMMGVMHLYFKYTNPLLIQSIIPLKGAFESNLVKIHVFGKPATGDLQRPFKANNSFLNQ
FT                   GQIKSDKASVENAEKNWRGGVKEETTSVVTSCPIITHAAA"
FT   CDS_pept        join(393594..393605,393681..393716,393776..393789,
FT                   393891..393954,394030..394714,394771..394941,3
FT                   95001..395029)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000071678" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899804"
FT                   /gene_name="gpdA"
FT                   /orf_name="An16g01830"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase gpdA-
FT                   Aspergillus niger"
FT                   /EC_number="1.2.1.12"
FT                   /function="NAD or NADH binding"
FT                   /function="glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating) activity"
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42800.1"
FT                   /db_xref="GO:0004365"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG571736"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniParc:UPI000012AE87"
FT                   /db_xref="UniProtKB/TrEMBL:A2R704"
FT                   /transl_table=1
FT                   /translation="MAPKVGINGFGRIGRIVFRNAINHGEVDVVAVNDPFIETHYAAYM
FT                   LKYDSTHGQFKGTIETYEEGLIVNGKKIRFFAERDPAAIPWGTTGADYIVESTGVFTTQ
FT                   EKAAAHLKGGAKKVVISAPSADAPMFVMGVNNTSYTKDINVLSNASCTTNCLAPLAKVI
FT                   NDKFGIVEGLMTTVHSYTATQKVVDAPSSKDWRGGRTAAQNIIPSSTGAAKAVGKVIPT
FT                   LNGKLTGMAMRVPTSNVSVVDLTCRLEKATSYDEIKKALKDASENELKGILGYTEDDIV
FT                   SSDLNGDDHSSIFDAKAGIALNSNFVKLVSWYDNEWGYSRRVVDLIAYISKVDAQ"
FT   CDS_pept        join(396133..396772,396824..397112,397298..397368,
FT                   397546..397706,397756..397966,398010..398121,
FT                   398165..398212,398263..398326,398372..398464,
FT                   398514..398599,398649..398728,398777..398883,3
FT                   98940..399212)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161343" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116668"
FT                   /orf_name="An16g01840"
FT                   /protein_id="CAK42801.1"
FT                   /db_xref="HOGENOM:HBG738492"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR019154"
FT                   /db_xref="UniParc:UPI0000EFCE50"
FT                   /db_xref="UniProtKB/TrEMBL:A2R705"
FT                   /transl_table=1
FT                   /translation="MDEDEDTVMGEAGSHHPTSVSSHQWPSNGPSSQGAGQLNGSSDPS
FT                   IAPPLLGPTMKLPLSVHSGDPRPENTASAEDQGVSPPKSLPKSDSGDATTEDFDKQDSL
FT                   VEDNSDWTDEDTVARTGLPIASLPSGLCYDVQMRYHCEVRPTADVHPEDPRRIYYIYKE
FT                   LCRAGLVDDPESCRPLVSRPLKRINARNATEAEISLIHTPDHFAFVESTKDMSDDELIA
FT                   LEHTRDSIYFNKLTFASSILSVGGAIETCLAVATRKVKNAIAVIRPPGHHAEHDKTMGF
FT                   CLFNNVSVAARVCQNRLGDSCRKILILDWMGNSTLEGKKVTGITVVKALVSEADVFISN
FT                   QCEPVASGFDAAAGDELGGCFVTPSCYAHMTHMLMTLANGKVAVCLEGGYNFRSISKSA
FT                   LAVTKTLMGDPPDRLHTTSPSALATTTVRRVMMIQSHYWHCMYPKGPPQDGLFTDRLHD
FT                   VIRAYQSKQLYDNYKLTSLFIYRTAISRSFENQVLASSNYHQTVPLVVIFHDPPEIMGL
FT                   PHPVTNKLEAHNCWLADVMKDYIGWIVSKGYAVIDVNIPKHVTIDPSSGKYEEEDENRP
FT                   TATEELAGYLWDNYIEPSEATEIFFMGVGNAFYGVANLLINRETLYKRVNSVVSFVAEN
FT                   PVRAIASHTQVWLSRWYKDNSLVFVSHTHGVWNNVETRRKPSKRYGQLVQSPKASLSEM
FT                   LMHHKEEVYQWISERADVQDSEETEDEKKPKSKSRSPTKENQTEPRSVPG"
FT   CDS_pept        400441..400920
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161332" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15899805"
FT                   /orf_name="An16g01850"
FT                   /protein_id="CAK42802.1"
FT                   /db_xref="HOGENOM:HBG324021"
FT                   /db_xref="InterPro:IPR006771"
FT                   /db_xref="UniParc:UPI0000EFCE51"
FT                   /db_xref="UniProtKB/TrEMBL:A2R706"
FT                   /transl_table=1
FT                   /translation="MHLSTKSLLSLLPLLPLASAVGSAIVQNNCTSPIYLWSVGGSVNS
FT                   MQTIDPGSSYSETFYYDTTSGGVALKITTTENGLYNGSPQTDYAYTLDTSSGNVFYDIS
FT                   DVFGDPFSGSVVSLVSSDSSCESICWAGGVPPAGSVVRSCQDEADEVLTVCADSC"
FT   sig_peptide     400441..400509
FT                   /db_xref="UniProtKB/TrEMBL:A2R706 "
FT   mat_peptide     400510..400917
FT                   /db_xref="UniProtKB/TrEMBL:A2R706 "
FT   CDS_pept        join(402143..402625,402703..402802,402866..405786)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659917"
FT                   /orf_name="An16g01860"
FT                   /product="EC:3.4.99.-"
FT                   /EC_number="3.4.-.-"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK42803.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG328356"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI0000EFCE52"
FT                   /db_xref="UniProtKB/TrEMBL:A2R707"
FT                   /transl_table=1
FT                   /translation="MPPRSPATRRLWNSQVPLYLRSPAFRAFSKLGASAAIAPHFIYPS
FT                   PRFPTPNERCSSFPALRSSHALVSLSLPSRARFFSNTATMGSIERIAEQLEKPELDDRS
FT                   YRVIRLPNKLEALLVHDPDTDKASAAVNVNVGNFSDADDMPGMAHAVEHLLFMGTQKYP
FT                   KENAYNQYLASHSGSSNAYTAATETNYFFEIDTPAKPNYPTSPLYGALDRFAQFFVEPL
FT                   FLESTLDRELRAVDSENKKNLQSDLWRLMQLNKTLSNPAHPYHHFSTGNLQTLKEEPQK
FT                   RGLEVRQEFIKFYQAHYSSNIMKLVVLGRDPLDEMEQWVGDLFKHVKNQDLPQNRWDHA
FT                   QPCLPEHLGKQIFAKPVMDMRSLDIYFPFMDEESMFESQPSRYLSHLIGHEGPGSILAY
FT                   IKAKGWANGLSAGVMPVCPGSAFFTISVRLTPEGLKQYREVTKVVFEYIGMIKEREPQQ
FT                   WIFDEMKNLAEVEFRFKQKSPASRFTSRLSSVMQKPYPREWLLSGSLLRKFEPELVKKA
FT                   LSYLRPDNFRMVIVAQDYPGDWNCREKWYGTEYKVEDIPQDFMDSIRKAVETSPESRLS
FT                   ELHMPHKNEFVPTRLSVEKKEVSEPAKTPKLIRHDDHVRLWYKKDDRFWVPKATVHITL
FT                   RNPLVWATPANLVKAKFYSELVRDALNEYSYDAELAGLDYSLSASLFGLDISVGGYNDK
FT                   MSVLLEKVLTSMRDLVVKPDRFNIIKERMTRNYKNAEYQQPFYQVGDYTRYLTAERTWL
FT                   NEQYAAELEHIEAEDVSCFFPQILRQNHIEVLAHGNLYKEDALRMTDLVESTLQSRTLP
FT                   ESQWYVRRNMILPPGANYIYERTLKDPANVNHCIEYYLFIGKIDDDALRAKLLLFAQMT
FT                   DEPAFDQLRSKEQLGYVVWSGARYSATTMGYRVIIQSERNAPYLESRIDSFLTGFGKSL
FT                   QNMSEQDFENHKRSVVNKRLEKLKNLSSETNRFWSHIGSEYFDFVQNESDAANVRKLTQ
FT                   ADLIQFFQQFVDPTSATRAKLAIHLKAQAGAHAHATKPEEQKAQLVSLFGKQLEAAGFA
FT                   ADTERLSAAFENVDVSSGDEAQILTTLKAFLESGLSLSEEQTKPVIGQVESNLGLQLKQ
FT                   VGIEPKKSDGTAVQANGTNGDIQKSTYINNVPEFKARLAVSAGPSPVTDLSEFEDFDAK
FT                   L"
FT   CDS_pept        join(406223..406263,406337..406588,406644..406891,
FT                   406966..407258)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900797"
FT                   /orf_name="An16g01870"
FT                   /product="Complex: in human"
FT                   /protein_id="CAK42804.1"
FT                   /db_xref="HOGENOM:HBG629877"
FT                   /db_xref="InterPro:IPR016706"
FT                   /db_xref="UniParc:UPI0000EFCE53"
FT                   /db_xref="UniProtKB/TrEMBL:A2R708"
FT                   /transl_table=1
FT                   /translation="MSTTTATAIQSSRPPIIPKDFSAQQPKTIRLYPLSNYTFGTKETQ
FT                   PEEDPSVLARLKRLEEHYDLHGMRRTCEGVLVCHEHNHPHVLMLQIANAFFKLPGDYLH
FT                   FEDDEVEGFKKRLNERLAPVGSQFSGEGVNEDWEIGDTLAQWWRPNFETFMYPFLPGHV
FT                   TRPKECKKLYFIQLPKKKVLSVPKNMKLLAVPLFELYDNTARYGPQLSAIPHLLSRYNF
FT                   EFVDENDNVVAATPGTPLPDHQIPRTKVLAGDSGDGQDEGMTDYPSGEGENGASA"
FT   CDS_pept        join(409372..409453,409508..409673,409719..410055,
FT                   410107..410415)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812739"
FT                   /orf_name="An16g01880"
FT                   /product="Similarity: sequence is almost identical to
FT                   sequence 1 from Patent WO9831790"
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid catabolic process"
FT                   /protein_id="CAK42805.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="HOGENOM:HBG325409"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR005592"
FT                   /db_xref="UniParc:UPI0000232ACA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R709"
FT                   /transl_table=1
FT                   /translation="MFSGRFGVLLTALAALSAAAPTPLDVRSVSTSTLDELQLFSQWSA
FT                   AAYCSNNIDSDDSNVTCTADACPSVEEASTKMLLEFDLTNNFGGTAGFLAADNTNKRLV
FT                   VAFRGSSTIKNWIADLDFILQDNDDLCTGCKVHTGFWKAWEAAADNLTSKIKSAMSTYS
FT                   GYTLYFTGHSLGGALATLGATVLRNDGYSVELYTYGCPRVGNYALAEHITSQGSGANFR
FT                   VTHLNDIVPRLPPMDFGFSQPSPEYWITSGTGASVTASDIELIEGINSTAGNAGEATVD
FT                   VLAHLWYFFAISECLL"
FT   sig_peptide     409372..409428
FT                   /db_xref="UniProtKB/TrEMBL:A2R709 "
FT   mat_peptide     join(409429..409453,409508..409673,409719..410055,
FT                   410107..410412)
FT                   /db_xref="UniProtKB/TrEMBL:A2R709 "
FT   CDS_pept        join(410951..411342,411398..411840,411894..412102)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965903"
FT                   /orf_name="An16g01890"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An14g02280 - Aspergillus niger"
FT                   /protein_id="CAK42806.1"
FT                   /db_xref="HOGENOM:HBG328357"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniParc:UPI0000EFCE54"
FT                   /db_xref="UniProtKB/TrEMBL:A2R710"
FT                   /transl_table=1
FT                   /translation="MLFFRGGVNSPRRRNQEKAIFCTILIIYALYFLFFAGSSDPKRSE
FT                   TSAEDAVKGGPHRDSRSGKASPSASASRQRQALDKDMVVASMKGDDVSWLYTYFPEWHK
FT                   SIYVADDKKAPLTVALNKGRESMVYLTYIIDNYDNLPDSVLFIHSQRYQWHNDDPYYDG
FT                   VPVLRNFQVPYLQKQGYVNLRCAWVLGCPAEIHPLSDTHRNDVHAGEYFKTGFMELFPG
FT                   AEVPEEVGVSCCAQFAVTRWKIRERPKSDYVRYRKWLTETTLPDDLSGRIMEYSWHMIF
FT                   GKGPVYCPTAEECYCKVFGLCNLDCPTEGDCAGRYVLPPYSSLPKGWPYVGWKGQKQDP
FT                   SKGLPEA"
FT   CDS_pept        join(complement(413892..414007),complement(413344..413836))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000235036" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965904"
FT                   /orf_name="An16g01900"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An04g06980 - Aspergillus niger"
FT                   /protein_id="CAK42807.1"
FT                   /db_xref="UniParc:UPI0000EFCE55"
FT                   /db_xref="UniProtKB/TrEMBL:A2R711"
FT                   /transl_table=1
FT                   /translation="MDSIIELMLFLFSVLLVKSLQMPTTRKLVVLSSFAVRLPLLVFTS
FT                   LHLYHLQKYAYSMNPTLDIIDGYVWTQMGMNYALIVCTSFCLAPFMRAISVTYGNAGEV
FT                   TLGTSSARSKSGKYARDVSKQSQSYVLQSMDNQEEAGHGMNNPRHSQPTFVPERYGGML
FT                   STTANDGSSRTDGDSVASSESTKMIIKKDVEYTVTHEPR"
FT   mat_peptide     join(complement(413892..413944),complement(413347..413836))
FT                   /db_xref="UniProtKB/TrEMBL:A2R711 "
FT   sig_peptide     complement(413945..414007)
FT                   /db_xref="UniProtKB/TrEMBL:A2R711 "
FT   CDS_pept        join(414723..414758,414871..415146)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900798"
FT                   /orf_name="An16g01910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42808.1"
FT                   /db_xref="UniParc:UPI0000EFCE7A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R712"
FT                   /transl_table=1
FT                   /translation="MTRATQRRQQATVLGAFRSERNKTISSGSRPWWQGQLGYQGSGPS
FT                   LRGLVKLRSIIGGSNSTKGSARAYGRIFGPDSESGQNVLRGTKGALFITADVRNLKPL"
FT   CDS_pept        join(complement(417798..417848),complement(417676..417746),
FT                   complement(417512..417625),complement(417377..417459),
FT                   complement(416918..417334),complement(416541..416866),
FT                   complement(416043..416477))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900799"
FT                   /orf_name="An16g01920"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK42809.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG325555"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EFCE7B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R713"
FT                   /transl_table=1
FT                   /translation="MADQRDMQALGKEQVLRRNFRFISIVAFGCTLIASWEVVLTMMSS
FT                   PLVDGGTAGFIWGFIVVSVGVLLLFASLAEMASMAPTAGGQYHWVSEFAPRKYQKFLSY
FT                   ITARSHLGWLCATGWECAIVSIAFLAGTIIQGLVILNYPDYVSERWHGTLITIAITLFS
FT                   VLFNTFLAKKLPLVEAFILILHVAGFFIVIIPLWVLAPIKDAKTVFTQFTNGGDWNSNG
FT                   TATMVGLITAITAMIGYDCTVHMSEEVRDASTTLPKAIMAACSLNGVLAFVVMVTLCFT
FT                   LGNVDEVLDSATGYPFIQVFFNATKSYAATNAMTAIVTMSLIASVITEVATASRQLWSF
FT                   ARDGGVPLATFFGHVNPNWNIPLNAVLVSLVLTMLLSLINIGSTVALDALITLTVGALL
FT                   NSYIVTVSCVSWKRIRGEPLPPHRWSLGRWGLWVNLGALAFLIPEFVFVMFPLYSTVDP
FT                   ENMNWSSLMYGGMLIFSIIYYVLYGRKTYVPPVALVKREI"
FT   CDS_pept        join(419030..419124,419245..419419,419465..419560)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659918"
FT                   /orf_name="An16g01930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42810.1"
FT                   /db_xref="HOGENOM:HBG324087"
FT                   /db_xref="UniParc:UPI0000EFCE7C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R714"
FT                   /transl_table=1
FT                   /translation="MAETYPIGTRKECERLVKDWGFKHVFTWADGSNAHYPPHSHGGVT
FT                   THLIRQGTLAITYPDDNAKLHNGEVKKETFGVGARLDVPAGKLHEVGADVGYGLSLTDY
FT                   DHLSDVLYYEFALLSNL"
FT   CDS_pept        join(complement(421333..421599),complement(420952..421280),
FT                   complement(420057..420900),complement(419885..420003),
FT                   complement(419746..419829),complement(419665..419689))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178876" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900800"
FT                   /orf_name="An16g01940"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK42811.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG324086"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCE7D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R715"
FT                   /transl_table=1
FT                   /translation="MTTDGVKEVPADTVSANEDTKKNPDVSTSSASSSSLTDSEHRVAK
FT                   VTDCAFDTTEDPRFYKPIPEYESAHRWDPYFEWTEEEEKQLIRKIDIRVCTFACVTFFA
FT                   LQLDRGNIVQANSDSMLGDLGMTTNDYNTGQTIFYLTFLFSELPSQLLSKKVGPDRWIP
FT                   IQMVAWSFVAAFQAFLKNRAGYFACRALLGLLEGGFIADTILFLSFFYKSKELPQRLSY
FT                   FWVSYEATSIVGAFLAFGFLHIHGSNGYTGGWRYLFAFEGLITGIIGIIAAFWMPASPT
FT                   QTKGGFRGKDGWFNEREEKILVNRVLRDDPSKGSMHNRQAVTPKMLWHALCDYDMWPIY
FT                   LLGLTWMIPNTPATNYITLELKSLGFGTFETNLLTIPAYVIFIINLLFWTWISERFNQR
FT                   LLLGVVSEFWCLVLLIALEVLPDGASGWARWIINALLIGAPYVHAIIVAMTSRNAGSVR
FT                   TRTVASAVYNMMVQASSIIASQIYQEKDKPYYRVGNKVLIALSVFSMALFIGAKFYYIW
FT                   RNKYNAARWNAMSSEEREEYLAANKDLGNKRLDFRFTH"
FT   CDS_pept        join(423185..423390,423441..423646,423702..424156,
FT                   424288..424437,424492..424605)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900801"
FT                   /orf_name="An16g01950"
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42812.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG327259"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI0000EFCE7E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R716"
FT                   /transl_table=1
FT                   /translation="MAPSLVEDTPLSLRAAPKSTLKTDAGFNKENVIGYGEAYKHENEL
FT                   KGTEKQPPASFPNYLPVWDNETERYPPLQPFEHYDHGKDADPTFPDLLPKDKVEVDDIT
FT                   PTIGTEVRGVQLSQLSKEGKDQLALYVAQRKVVAFRDQDFAHLPIEKALEFGGYFGRHH
FT                   IHQTSGAPKGFPEIHLVHRGADDRSGAEFLSQRTNTITWHSDVTFEKQPPGTTFLYILD
FT                   GPSSGGDTLFADMAQAYRRLSPEFRKRLHGLKAVHSGIEQVNNSLNKGGIARRDPITSE
FT                   HPIVRTHPTLTETVTRYIVGYKKEESDYLLKFLYDHIALSQDLQTRVRWRPGTVVVWDN
FT                   RVVTHSALFDWEDGQRRHHARITPQAEAPYETPYEG"
FT   CDS_pept        join(complement(426028..>426279),
FT                   complement(425773..425934),complement(424865..425269))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965905"
FT                   /orf_name="An16g01960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42813.1"
FT                   /db_xref="InterPro:IPR019193"
FT                   /db_xref="UniParc:UPI0000EFCE7F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R717"
FT                   /transl_table=1
FT                   /translation="PTILTCTTCTTQLGLPDPIANGYRLFKTSLSANTTSSSEDNNPPE
FT                   ETWESHPPETILTAQLLELIERESYRRFVIHCGAKDGLLIWPFNPSLRYSTTSASHSTA
FT                   AQLAMKVFYQHVDNVEEILHPEVGKGNQSLAIEELLIHPPPSSTMPPTTSQSQSHHPPR
FT                   SFSTSSDENNTVTWEHLEHVPPPSHSTNPTTTTPATTHNKNNLSTADNHPERILDPETH
FT                   PESEAFHMDDVMGAGEGTGTGTGTCMAPAIRIHPPGDAVSASTKSAAFSG"
FT   gap             426341..426440
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(<426676..427515)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965906"
FT                   /orf_name="An16g01970"
FT                   /protein_id="CAL00421.1"
FT                   /db_xref="HOGENOM:HBG324084"
FT                   /db_xref="InterPro:IPR019193"
FT                   /db_xref="UniParc:UPI0000EFCE80"
FT                   /db_xref="UniProtKB/TrEMBL:A2R718"
FT                   /transl_table=1
FT                   /translation="MSQSLQDESQTNPTTPLHLHAELLPNIRQLTLYISVPPKTPRSNL
FT                   QITLSDSRRAVTVTSSLPNTNQDDPTSTSETIKLPARVSESSRRILQQRPPSTQGESEY
FT                   SFRMQVDDNDTSLHKDETTLNDGFIPWTATDMSAHTRLRCVKCHNPIMEGGKVWKDLPS
FT                   GNWAEMMDFWHCHKPDPPEEERNKEGEDPNAVVKGYGAGNQLVAVEGTVLVDVTSFLVK
FT                   GVDCLGVDQVRNIYIDVFFWVALLVECWVCNRGVGWGVWATRRRPFQSMMRPSIQLPY"
FT   CDS_pept        join(complement(428500..429227),complement(427906..428440))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659919"
FT                   /orf_name="An16g01980"
FT                   /product="Similarity to hypothetical protein PA1213 -
FT                   Pseudomonas aeruginosa"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAL00422.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324524"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI0000EFCE81"
FT                   /db_xref="UniProtKB/TrEMBL:A2R719"
FT                   /transl_table=1
FT                   /translation="MPHPTQPDIQYFPDYEKYTSRTQRRQATEDLPTTLPVGFPTELKS
FT                   SLVWHGKDINNSTDWIFHLNEAQLDEINTALKSFQSLNLPLGHINQVTFPLPNLKTHLR
FT                   SLSKDLHTGRGFFILRGLNVDRYTREENIIIYCGVSAYVANLRGRQQDPHFTNGKSLVI
FT                   SHIKDLTRTKDAADVGAPSNTADKQVFHTDGGDIISLICLNPSVQGGESYIASSWLIYN
FT                   ILARERPDLIHTLSEDWPFDGFGNKTRPYTLRPLLFHQPATASTPDRVIMQYARRYFTG
FT                   FQAQPRSPDIPPITEAQAEALDALHFLAEENSATLDFQKGDIQYINNHSIFHARNGFVD
FT                   EPGNEYVYFLFPSLTAWLGSFAKMYRECRRHLIRLWLRDEEYGWETPEMLRPRWEHVYK
FT                   DVREEDQVFPLEPNVHKSLGS"
FT   CDS_pept        join(complement(430983..431183),complement(430790..430935),
FT                   complement(430609..430736),complement(429798..430552))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195205" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812740"
FT                   /orf_name="An16g01990"
FT                   /product="Similarity to hypothetical protein B18D24.50 -
FT                   Neurospora crassa"
FT                   /protein_id="CAL00423.1"
FT                   /db_xref="HOGENOM:HBG328680"
FT                   /db_xref="UniParc:UPI0000EFCE82"
FT                   /db_xref="UniProtKB/TrEMBL:A2R720"
FT                   /transl_table=1
FT                   /translation="MFSFLPQISKLLPFGDRVLFALPPVKIQEIDTAHEKPARALKHLL
FT                   KLNHANHAILYNDRKFHNHAPHILSSSFMQGADADDLHRVYEAESTHLEPWTDAPGEIS
FT                   DFDWRDFLGCREYQRAFVDFFEDELVRQSYDWKQVVNEYLFSGKEPIFNSLIADLGHPL
FT                   IHMAYAFEFASREVAMEALAMTSTCYSAIHKYLDDPSYAQAESSYQSTSLFDILNKVRL
FT                   DKQFNGLFGTPGGNNMDIIFRDCEAALLNHWNAWKIQDPVAQFRESQEVAVAILTGTHS
FT                   DRTSEQYDFFFVHILTTSHAVRILLPLIPPQFQLSLVRQWWLMTLCVYIAQLRPQIDLD
FT                   RIRKYELGGRDWNWTAKRAVKSEHSTDAHYVKALRAYKECAATWGDADEFYLKAAVRFG
FT                   EEFNCWGGFV"
FT   CDS_pept        join(complement(434283..434323),complement(434165..434198),
FT                   complement(433995..434064),complement(433805..433877),
FT                   complement(433728..433756),complement(433541..433563),
FT                   complement(433422..433493),complement(433255..433369),
FT                   complement(433123..433201),complement(433037..433071),
FT                   complement(432958..432986),complement(432800..432905),
FT                   complement(432549..432750),complement(432295..432501),
FT                   complement(432092..432239),complement(431957..432035),
FT                   complement(431724..431887))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900802"
FT                   /orf_name="An16g02000"
FT                   /EC_number="2.6.1.19"
FT                   /function="4-aminobutyrate transaminase activity "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAL00424.1"
FT                   /db_xref="GO:0003867"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EFCE83"
FT                   /db_xref="UniProtKB/TrEMBL:A2R721"
FT                   /transl_table=1
FT                   /translation="MGHKAELNRNFSMLSMLGLAFAILNSWTALSASLSLSLPSGGCVS
FT                   VIWGLITAGVCNLCMSASLAEFLSAYPTAGGQYHWVAGWANVTGWVALTATGGLLGSEL
FT                   ILGVISLMHPSYVSQRWHQFLIYIAYNVIAFLINAFMGSLLPKVTKGAFIWSLTGFTII
FT                   CITLLACSSPNYNSGEFVFGEFINETGWPDGLAWLLGLLQGGLGLTGFVSLPSSTMHPG
FT                   TNRYKDGVAHMIEEIPNPSVVGPKIMIGCVGIGTFTGTIFLIVLLFVAGNIYEDINSAA
FT                   TPLLQIFVNATKNNAGAICLLVFPLVCVLFAAITIMTTSSRMIYAFARDGGLPASPFFS
FT                   KVHTKLEVPLNALYLTNILVIIFGCIFLGSSSAFNAIVSASVVMLDIAYGIPIAVNCIR
FT                   GRKMLPERSFVLPNVVGWIANLISLAYVSLTTVLFLFPPDYPATGSNMTVFGIVFLVSI
FT                   FQWFVDGRKNFTGPRMDVDIISGQVAPGDGGEEVVVPSNFHEK"
FT   mat_peptide     join(complement(433995..434046),complement(433805..433877),
FT                   complement(433728..433756),complement(433541..433563),
FT                   complement(433422..433493),complement(433255..433369),
FT                   complement(433123..433201),complement(433037..433071),
FT                   complement(432958..432986),complement(432800..432905),
FT                   complement(432549..432750),complement(432295..432501),
FT                   complement(432092..432239),complement(431957..432035),
FT                   complement(431727..431887))
FT                   /db_xref="UniProtKB/TrEMBL:A2R721 "
FT   sig_peptide     join(complement(434283..434323),complement(434165..434198),
FT                   complement(434047..434064))
FT                   /db_xref="UniProtKB/TrEMBL:A2R721 "
FT   CDS_pept        join(complement(436171..440171),complement(435643..436111))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000195216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900803"
FT                   /orf_name="An16g02010"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAL00425.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG328362"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI0000EFCE84"
FT                   /db_xref="UniProtKB/TrEMBL:A2R722"
FT                   /transl_table=1
FT                   /translation="MDLEHRDLNNSDQPRRRRRNAVRRRMRNRAPISARLSLDPQLRGN
FT                   VGVVSEDLAGDLFHNSTIGKGNMTARGLYYTADLELTGIVEGIGKETDIHYIAISPYLA
FT                   GSNAVEDLAWTIIPVRPQSKERSSQSPLPHNTVLFPHSATSLQPFTDALSKLDPTRHTL
FT                   QAQRPIEIQLLDVAPLPLDTIYVTVERNLLRNHDDVQNKFGGGFTPSQNGPNGHWAKGG
FT                   KGGLDAKKQSKKVAAETDDRLTAAVRHALGAEKVVHTGDVLPLPLPPHPITYAPSPPAR
FT                   SSYCEPVSQGLLMPTTKVVLIQARPQGHRSQRSLRSSSGLLKQVAQDEADDTSNEQFYS
FT                   AAEDKPVESSTEVEATSTADESETEGSGNASDTSDDSLDDMISLAAPELPQPPSGVMSA
FT                   MTAATPRAGGRRGDGTHTPGSVASNFTSTTMRPGKTNGGKVFKAEGLLRRVSSDLLHPR
FT                   PREDDDTEFFIFVDISTLAKIGCFSGDWVRIEATEEPQLNMFASIKLGSFNEQEEDSGN
FT                   WRAAKIYGLPGLPSAKPRYSINQSGERRSSISQRAPTRLTPSVFVPPLLLNNLENPKYL
FT                   RISPITFAGANGVRPGLLHQVKSSVVRSPPLAKEVTLLKVSTPLSMDRVLQPALFAGLK
FT                   QYFESKRRLLKGGDLVGISVDEGLGRAVFPVTTGGDTGAQDDDLTNRLGQVTDTNNTAS
FT                   KKVGVAWFRVGQVIPSTSSEQDGSENQWGGVAVIDSATTRMVQAGSDVSRVPGTINNGW
FT                   EYWLGVKTVPRAANDAPTPHGLITETPQSFIPPLQQRIRDLMAVATSPRAIQLGMKPVV
FT                   ILIRSQQRHIGKATIANRACADIGLHTFPIDAYDILTEGGANGGDVKTEAYLKARAERA
FT                   FHCGPECTALLIKHIEVLTADRIISAMADIVADARVVIATTTDVEQIPEGIRSMFTHEF
FT                   EMTAPEEKEREGILRNAVTERGIKISPDVDLSTVALKTAALVAGDLVDVVERASAARTA
FT                   RLEKLAELASKNAGQAVSLRDVLVSGGDAARGVTKVDFDAAVDAARKNFADSIGAPKIP
FT                   NVSWDDVGGLTNVKDALIETIQLPLERPELFAKGMKKRSGILFYGPPGTGKTLLAKAIA
FT                   TEFSLNFFSVKGPELLNMYIGESEANVRRVFQRARDARPCVVFFDELDSVAPKRGNQGD
FT                   SGGVMDRIVSQLLAELDGMNGGEENSGGVFVIGATNRPDLLDTALLRPGRFDKMLYLGV
FT                   SDTHEKQSTILEALTRKFTLSPDLSLRRVADRLPLTYTGADLYALCSDAMLKAITRKAT
FT                   AVDEKIKQLPGEPVSTAYFFDHLATPEDVAVMVTEDDFKEAQDELVPSVSAKELEHFER
FT                   IRQTFESVDKQKQESGNSAPQTIEEVLEALKAGDQLEFSMDGPTTNGDSHAHDSGKGKG
FT                   KQVPSGQSTSGKGKGKSPAGTGGKSKNKLVAMPNGDSDSSLDGPTADRGAVRGYEDVGE
FT                   DDEDGVANGGDEDYIIRTDHLAQDGVSK"
FT   CDS_pept        join(complement(442923..443261),complement(442774..442870),
FT                   complement(442700..442723),complement(442264..442653),
FT                   complement(442151..442203),complement(441945..442122),
FT                   complement(441612..441884),complement(441297..441538),
FT                   complement(440849..441229))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900804"
FT                   /orf_name="An16g02020"
FT                   /product="Function: A. terreus dihydrogeodin oxidase "
FT                   /EC_number="1.10.3.-"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAL00426.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324478"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0000EFCE85"
FT                   /db_xref="UniProtKB/TrEMBL:A2R723"
FT                   /transl_table=1
FT                   /translation="MTLQTYLIAIITYFGFSSFHASQQPSLQYPLQLDDADLTPPAPKD
FT                   LSFIPPGAAEETIGEPFRCQYPSMAAEYIYNAKPENRSVWLKHRTNLSLDFDINTDYET
FT                   RWPVGIERKYILTVGERSLNLDGIEFPYAKVFNNSYPGPWIQACWGDRINITVKNNLRK
FT                   NGTAIHMHGLRMLSNGLMDGVPGVTQCPIAPGDTFSYVFNTTQYGTTWYHSHYSLQYSD
FT                   GVLGPLTIHGPTSANFDKAIDPIIFTDHNHQSAFQLYYQEQFANNSTRVPPKQTSILLN
FT                   GHGSYAGSFPERRYHKRVQAQSVYRQLTDSQGKKYILRLINGSTDTTFIFSIDGHNLTV
FT                   VGMDLVPVQPYTTDHIYVGIGQRYHILLETKTDFSDSMNMAYWIRTDPATGCHNFETFP
FT                   DTRQGILWYGGGSHPPIPTTNAHQYNNTCSDMLDLVPVVPWTIDEPPPHHPNVGDEPEA
FT                   TVNFWQFLNDTLWVNYAEPTVNHLDPPYNSSAVIYLAAEAQPAQITWNYMLIIGGNIVA
FT                   SPPVTGGNLAPNAHPIHLHGHDFAVLQYSTDKYNSSEDLDLNLENPHRRDAVLLPQNGF
FT                   IVIAFKTDNPGSWTLHCHIAWHASAGLAFQVLEEQPAFKAGIEDSTVARNQLDRTCQNW
FT                   DVWFANASNHWNPNGRFQDDSGI"
FT   mat_peptide     join(complement(442923..443198),complement(442774..442870),
FT                   complement(442700..442723),complement(442264..442653),
FT                   complement(442151..442203),complement(441945..442122),
FT                   complement(441612..441884),complement(441297..441538),
FT                   complement(440852..441229))
FT                   /db_xref="UniProtKB/TrEMBL:A2R723 "
FT   sig_peptide     complement(443199..443261)
FT                   /db_xref="UniProtKB/TrEMBL:A2R723 "
FT   CDS_pept        join(complement(445203..445443),complement(444741..445165))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900805"
FT                   /orf_name="An16g02030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAL00427.1"
FT                   /db_xref="UniParc:UPI0000EFCE86"
FT                   /db_xref="UniProtKB/TrEMBL:A2R724"
FT                   /transl_table=1
FT                   /translation="MDLNGTACKMYSRYREAQSGRICCLEYEALTLLCASKTGRVSSKS
FT                   ILECSRIAVPLLTEPKRVLLRNLGATNNLRGAGQFRVAGSSYQSTRIGQMSHQQYVHSS
FT                   FSLKGTPGAMGRLWIWSHGSHKNDPATSRAAPGFQGHPISKHGFQLSTGLSDFTFGGRA
FT                   RTIVTTRLLHMSEGEGSLCNPHTQTSAYRSIESSKIVDKLRLGGIVKHRLTPFVAYFW"
FT   CDS_pept        join(449325..449829,449887..450152,450207..450415,
FT                   450467..450739,450789..451755)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900806"
FT                   /orf_name="An16g02040"
FT                   /product="Function: H. jecorina ACEI protein is DNA-binding"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAL00428.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EFCE87"
FT                   /db_xref="UniProtKB/TrEMBL:A2R725"
FT                   /transl_table=1
FT                   /translation="MKSQNPRRGRHVARPPSLASTADVHASRSRYQLKKHQTFHSKSPS
FT                   SSDDEDPLADLACSPRRSSTSPAALQAILAGQQRMNKLLSRFDLDSSDSAPRKEHDGLP
FT                   VPRGYLEIHFERSQSGKGDSFHYDLRRGSSRKDSQTKVRKVHCHPSDSGLGTSISSCET
FT                   ASARQAKESRSKTVTRTQSAITSSLMAVEPDSASKQNLSLGASQEIEKRILTPLLGQEL
FT                   CKPFHHLVESAREQIEKKQIGTLRDLEKSLLHGAADVEAEVGSYYQFCSSTILCLSETY
FT                   THLDPRDLCIPTDKSYSNSYFLDLTAQVHRFKAMRDEARKNKKEASELKLTLEGGMSQT
FT                   GRPLELVAQKEGQAVSMQTGEAYDAHAPPLVKRTLSLNEADEGARRSMARRKKNAPPMN
FT                   INTKCSHCDKIFQRPCDLTKHEKTHSRPFKCPFEGCKYHELGWPTEKENERHVNDRHST
FT                   TPRMYACTFNGCAYKSKRESNCKQHMEKAHGWNYVRAKNNGRNAKRRATSARASPAEES
FT                   TAHSSPLHMSPDQVSPVQLAPAQLASLQMASDQLSTLQMTPDQVSLLQMNADHMSPLQL
FT                   SPDHMSPLQMTPDRASPAEMLSLQMSPDQGSSVQMSPPQVSPAQLSTPATGPLQSPGFV
FT                   NNYSQNPMLPLQDPYSQLKHEDCVLYTDNDFAPLNGTTDFFEDASFGYGEHMYQPGQMD
FT                   FSSIGAFYDDSIMNSMLFDSTATGNNNNFPDESMYMFNQTQMPPF"
FT   CDS_pept        join(complement(453755..453772),complement(453534..453653))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812741"
FT                   /orf_name="An16g02050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAL00429.1"
FT                   /db_xref="UniParc:UPI0000EFCEB3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R726"
FT                   /transl_table=1
FT                   /translation="MENPTQLLRGWSPQKGNPVEKKKLKKEDKGILKVSRGNILEDSLK
FT                   "
FT   CDS_pept        join(455484..455658,455705..456567)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965907"
FT                   /orf_name="An16g02060"
FT                   /product="Similarity to hypothetical protein Pa5D0029 -
FT                   Podospora anserina"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAL00430.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="InterPro:IPR015034"
FT                   /db_xref="UniParc:UPI0000EFCEB4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R727"
FT                   /transl_table=1
FT                   /translation="MPEVPMPDLSDESSFYGLYSPPPKRTPAPANKPHRFRRGDCTPRG
FT                   GSGQLRHRALLEHPRETVPSASSPAPEPEASDAVQPMDVSTSEISSVPPSTPIPTHDFD
FT                   VPISSTDTTPVRPNRPSPNEPISSFLARLRPSSTLSTSPTGSWIYTTSYSYEQPQADLK
FT                   KLVADGTKALKAHKEAIAQVRAEHAKKPKKKQTPAALTRELTQHRKDLENTLFSLARQT
FT                   NVVSGKWLLFVLPEKVDEVWGIVAEATAKGELGFGVKVATAAVAADGDDDAKKARLIAI
FT                   YTKDYEDRADVERVLRKMAALKLVDLDGRPVYYKCDAYTHLDIRGGNEWGLRASMYSSR
FT                   DFGKK"
FT   CDS_pept        join(complement(457030..457893),complement(456701..456937))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116912"
FT                   /orf_name="An16g02070"
FT                   /product="Similarity: shows only partial similarity to
FT                   human ANG2 protein"
FT                   /protein_id="CAL00431.1"
FT                   /db_xref="HOGENOM:HBG328367"
FT                   /db_xref="InterPro:IPR014812"
FT                   /db_xref="UniParc:UPI0000EFCEB5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R728"
FT                   /transl_table=1
FT                   /translation="MSTLSSPRPSIASSRAHSPTPTSSHRPSLDTLNTSYNLNNLSASS
FT                   TPSTARAVSPSLHPRRNRAALRDYYNLKPSSAADPNNDGRRSRSIPRHTDAGDISSSSS
FT                   GTVAGGPSILSTTGTELDSPDFDPQRYVNQLLASSSLSTVLKAENTLVGDIRTLDSERK
FT                   ALVYDNYSKLIRAVETIGKMRRTMDDRGAPLTMTKTLGPAIAFVAETAGGLIQEGEEQQ
FT                   RRMKEAKESEGGERRRAEKGTVRWVLAAPGRLEKLLEEGKGDEAEKDWDEVRKLLDKWE
FT                   GVKGVKESGKPMLHEKHESDFVELVPISAIELQSSQLLTTSSGSRWRASISPIGHFPAS
FT                   RHPIIHRGSLHSSSWSLSYHLSSPSH"
FT   CDS_pept        <458211..>458923
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116913"
FT                   /orf_name="An16g02080"
FT                   /product="Similarity to hypothetical protein SPAC26A3.03c -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAL00432.1"
FT                   /db_xref="HOGENOM:HBG023311"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="UniParc:UPI0000EFCEB6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R729"
FT                   /transl_table=1
FT                   /translation="MTTNPHDHIATHLLTTKSLPVSPTWLTTFLSSTSTSRTIPLSALT
FT                   QTALFRILTSDIRDSLSTSSPSTLLPTDIFNPTIQERRLNGPIPLQVLDIEDIGTSLWS
FT                   QVEAIERVERGEAIRGREIVRTVNVGEDSEAADNNNAAGGGESNGPHRLILQDAAGTRA
FT                   VGLEFARVSGIGLGKLAIGAKVVVKDVTVARGMVMLTPESCVVLGGKIEGLDIQWREGR
FT                   KKRLLERINGENEGS"
FT   CDS_pept        join(complement(463289..463404),complement(463028..463228),
FT                   complement(459038..462971))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195859" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812742"
FT                   /orf_name="An16g02090"
FT                   /product="Function: Ski2p"
FT                   /function="binding"
FT                   /protein_id="CAL00433.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG328368"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000EFCEB7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R730"
FT                   /transl_table=1
FT                   /translation="MSSKSALKAVRTALDAKDFELAAEKAKAIVQQDPQIYHANVFLGL
FT                   ALDKLNKNTEAERAYLSAIRVKENDKTAWQGLINLFEKQGTHKLDSYRDAVIRLGQVYA
FT                   ETDDKNRCQDLVDKYVGFAKKNGSRSQYKKALELHLPSCPLYDFLEGRVPHPSHTYLRL
FT                   IEMTEAEEKEFINREIGERRTRLGAKIDQVTLEVKREAFKRSELEELYRGIINWSHDDQ
FT                   VRRTYEEKLLQRANDILSVLPANEKDAKRAEVLQAAHDMVIIKHPYELAWKIVLEWQDI
FT                   QNFSEWDRNFLDDFIEFFPEDGLSKLLKGFLASDLSPFPKDKEPKEAAKKDEETENNNG
FT                   ESNELGVQDNLLLMVEGLEGSSASIVAHRVVAELYLSLEEYDSTVDVCRKGLRNVQDLV
FT                   RRTGISLQNTTDALNIMLANSLIYYQSPRHHPEAKRIFEEILAREPKSTSCLLGIGLIL
FT                   KVDEDYSEAVNFLERALERDPTNIKVRGELSWCRALNGDIASGLEGLQDVLEELQEAET
FT                   DNREFKAEILYRVGYCQWEIDPSPAARKDRTGAYASFLASIQSNMNFAPAYTSLGLYYA
FT                   DYKKDKTRARRCFHKAFELSASEIEAAERLAKTFADQREWDLVEAVSQRVVDSGKAKPA
FT                   PGSKRKGYSWPYAALGTVQINKQQYPKSIVSFQAALRISPNDYHSWVGLGESYHHSGRF
FT                   IAATKAFEHAQQLEDNLSDKEQIWFARYMLANVKRELGEYEDAIARYENVLQVRPNEFG
FT                   VAIALLQTLTESSWKSLDQGLYNDCIELARKALLVAKSLALERVDVFNLWKGIGDACTL
FT                   FSYVQSKAGRLPIDELRDLLETQLEPTALDILTEVDNVGHDYLSSLTADDETANRTSQC
FT                   LYAAILAYKRAIQVSLRDSHAQAVAWYNLGWAEYRAYRCLQTIVNTENKKQSRKLLKAA
FT                   MRCFKRAIELEAGNSEFWNALGVVTTSMSPKVAQHAFVRSLHLNDRSAQVWTNLGTLYL
FT                   IHNDIQLANEAFTRAQSTDPDYSPAWVGQGFLALLFGDPQEARGLFEHAFDISTSSTRL
FT                   SKKQYTMSLFDHLLSDSSLSNEISQLIQPFFALHQLSSQDPSDLPFVHLSALLAERIGE
FT                   HTDAEASLRLVCAGMESEYEVTESASSLSRYGQANADIARVLLARHDFEEAAEKAETAL
FT                   MLSGEEDAEKFDPETNRKLRLSAHLTAGLAHYYMKSMDNAIDMFRDALQEADNAPEVVC
FT                   LLAQVLWAKGGEEERAVARQQLFDCVEENPEHIGAVTLLGAIALLDADADAIEAVESDL
FT                   QNMITRDDIEIHERGKLIKLLTAISTLGFTDNSGVPEDVRRVGEATAAVMRSPYEPQGW
FT                   VELASATQELYPAEMATKRASRSVPPRSNLEAIDLSAAYAQTGKASDALRAIMVAPWKQ
FT                   TGWEELNHAVSTTS"
FT   CDS_pept        join(463989..464372,464431..465362,465411..465729,
FT                   465800..466453)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116914"
FT                   /orf_name="An16g02100"
FT                   /product="Similarity to hypothetical protein YIR007w -
FT                   Saccharomyces cerevisiae"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAL00434.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG397484"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniParc:UPI0000EFCEB8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R731"
FT                   /transl_table=1
FT                   /translation="MGPLRLRIEGRTFKDSHNREITLRGINVAGECKYPKNPDTPSYVS
FT                   DNFFDADNVSFVGRPFSLDDAHTHFARLRKWGYNTLRYIFTWEAIEHEGPGKYDDEWIA
FT                   FTIEVLRIAKQYQFYVFLDPHQDVWSRLSGGSGAPAWTLYAAGLNPRTFKKTEAALVQN
FT                   TYDIPAEFPKMIWSTNYTRLVCQTMFTLFWGGRDFAPKAIINGMNIQDYLQGHFIAACR
FT                   YFAQKIHEAGDIENDVVIGWESMNEPHRGLIGVQDISVIPPEQQLQLGTSPTAFQAMLT
FT                   GSGRACEQTTWNFGSFGPHQTGRELVDPEGESAWLPADYDDQKYGWKRDPDWKLGKCLW
FT                   AQHGVWDPSTDQLLRKDYFSKVPQTGEPLNYDRFTNTYFMEHYRAYRDALRSVWPGAIM
FT                   LCQPPVMEIPPDLKGTADDDPNMVHAVHYYDGLTLLTKHWNRLYNVDVIGVLRGKYLTP
FT                   AFAVKIGETAIRNCLRDQLKFLRDESLTYMGDHPLIFTEIGIPYDMDDKHAYRTGDYSS
FT                   QVSAMDANHFALEGSTGNGFTLWLYTTTNNHEWGDNWNGEDLSIYSLDDLELPSGKLLA
FT                   LEGESRTDPDPHSPAYSESQGNPEHHQVRPDNLKDALATPSITSEYTQSNADKLGFRAG
FT                   EAFIRPSPIYTYGDVSKYLFDLRNCTFTLSLVGSKRILGDEVATEIYLPEFHFPDTQTV
FT                   VSVSSGEWRIDYTEINSIKVQRLRWWHMEGEQDIKIQGVKRKPGDLSSVSADDLSYLEQ
FT                   CQKGGCTVM"
FT   CDS_pept        466870..467397
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965908"
FT                   /orf_name="An16g02110"
FT                   /product="Putative sequencing error "
FT                   /protein_id="CAL00435.1"
FT                   /db_xref="UniParc:UPI0000EFCEB9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R732"
FT                   /transl_table=1
FT                   /translation="MIDYGSPFYCCSRSSSSLKVLFLLLLLTSYPISAHSLLPPSVQLS
FT                   DVIDSGSPAPPQPKQAPRGETIPHFPSYSEHSFPRGSLPLINPFFRQKPHPPIHSRTPT
FT                   APPSRNCLGGGCRVSPTFFWKADCGSVCYLPNAVLPDPQRRISLIGKSDQGFARAIMPA
FT                   LVLPLEKVLS"
FT   sig_peptide     466870..466977
FT                   /db_xref="UniProtKB/TrEMBL:A2R732 "
FT   mat_peptide     466978..467388
FT   CDS_pept        join(467463..468290,468357..468545,468600..469071,
FT                   469121..469289,469402..469651,469702..469805,
FT                   469854..470112,470162..470304,470354..470952,4
FT                   71014..471690)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812743"
FT                   /orf_name="An16g02120"
FT                   /function="binding"
FT                   /protein_id="CAL00436.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG328370"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000EFCEBA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R733"
FT                   /transl_table=1
FT                   /translation="MAAEADLSEGRMADIIRALELIHSPSSTNELRREALTFVEAQKES
FT                   KSAARNGFLLASPEQSNPLVRYFGLGLLDHVLRHTSFEASEQIDALRGLVLKLAESVRP
FT                   EDPPYIRNKITQLWAEVAKRSWGLDWNDMDATLVQFWGASLVHKELVLSILETLSEDIF
FT                   YREDTVSSLRGTDLNRALVEICTPLSVFEEIHPKKDSVELRCGPEGWLSRICGFLADCI
FT                   GNIQNSKQAKDSALKALATLKSVLAWSIPKAILSANCVPSIARAFTCNDEYVLLAAVEA
FT                   LHALYSRSNVDIEGFQPLVHVMYETESLNVLQKLYEWSVVGPDDVDDLRYTICKKLSEV
FT                   LSYVAGFLEEKSFALESVQGLNLPFFFHLTVSVIQNQSLTVSIPVLHVWSKLIASERIG
FT                   NTDLVTGLVPSLLSICTERLIRWESFPSDSENATVVFLNEDIDTIPERHAFVGNYRRYC
FT                   SSIIESIVQKRPQEAILHILSEVDSNLDNLYAGVEPFSVKSFSKNSMPLMRADTQFAVV
FT                   EATLKGYNKWVSAHGRMPQQDVRNMGPIAFLQLTSIHLTYITLQDPILKQRVIKLVVDI
FT                   SSKALDKTPSFALKALEYILMTRLPDQPEYPVYSESVKELHGLTSHELRRLAMRYADYF
FT                   ATFYDILEPKIKEISMANRVDDKLQMELTSILLIIMQRANNVEPYLRQSRLVSFVEPIK
FT                   NAWQEEEFRNMSSTFEGFCVMLGLQSVGPYMQARQAPKLEDWSSVPLDSEGKLIQEEMT
FT                   RKFQQLPLRGTKTMLAVSSDKLKKTDQAYELACNIWHDIIPTILPTLLQLVSNAHAFHN
FT                   PENWGGLPHDMRGVVERILTDRFWQAGISTGSRDEFYAKITASRASLEGFASSVRGKIR
FT                   AVRESCYSMLFSMSRLREHFYGFAELPGPLAQALFKDSPHLSSHQFSVLLNISRCLIDD
FT                   CPVRFRAQFLPPMLSTLFTNIDKKVTSEWDAIERQKEGLGEGDLTDEMKSESILRQLTY
FT                   SAVIFVASLLDPQRGDPDDEPVDPSVPQAAPALSDSIRHFVLSSPEIFEPVMLFCTHAL
FT                   RMRDTRCCSIITRVIRSILQDFAPPNDTATTVTIREFISSEVLKACITSVHEPYFVDMQ
FT                   KDLAQLIASIWILYGSSSPTPRAVMLSLPGLDEQRVANAEAALIRSSAARQQRALILDL
FT                   LEGLRGVSIAEQGKILGSREERRKARSALQERYMSTGEMEGQQNHKVDINDGPDLAGVA
FT                   DLFG"
FT   CDS_pept        join(complement(472782..472832),complement(472601..472646),
FT                   complement(472320..472503),complement(472198..472246))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195836" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116915"
FT                   /orf_name="An16g02130"
FT                   /product="Function: murine protein is involved in cell
FT                   death in response to IFN/RA"
FT                   /protein_id="CAL00437.1"
FT                   /db_xref="HOGENOM:HBG328371"
FT                   /db_xref="InterPro:IPR009346"
FT                   /db_xref="UniParc:UPI0000EFCEBB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R734"
FT                   /transl_table=1
FT                   /translation="MPQDMPPQGGYLPVQYKRNIPARGFRPIYYLIGMDIDERGMNSEL
FT                   AREKMWGRIHIMPLLQAEEDRDQARRYFADKAREKELLGTDAKIYNSDRFVRPTFTYTP
FT                   SKVTQ"
FT   CDS_pept        473187..474437
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965909"
FT                   /orf_name="An16g02140"
FT                   /product="Similarity to hypothetical protein SPAC6B12.09 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAL00438.1"
FT                   /db_xref="HOGENOM:HBG717479"
FT                   /db_xref="InterPro:IPR007356"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="UniParc:UPI0000EFCEBC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R735"
FT                   /transl_table=1
FT                   /translation="MEEDNDRPRKLPKLDHDESQDSEPRMTGALQVTDNASTAATAGTD
FT                   NADNEQPTMTSENDNTHGAADSTTAPTTEDGAPKISKREMKRQRRREQWDQQRDQRLAK
FT                   RKKTAQARKERRRAAFEQARLDGTEAELKKQYERTQERFRKSTLLPVTLVIDCGYDELM
FT                   LEKERISLGSQITRSYSDNSRSVYRSHLVFSSFNKKLKERFDTKLNKHYLNWKGVRILP
FT                   DDFAQVAEKAKEWMVVPDGGKMEGMFADKTDMKPEDGEVIYLSSDSPNTLTELKPFSTY
FT                   IIGGLVDKNRHKAICYKQAVEKGIKTAKLPIGDYIQMASRQVLATNHVVEIMLKWLELG
FT                   DWGKAFLAVIPQRKGGTLKESGAEADGSQQEENNAEEEEEEALEQAQEVTDEAVEEAQQ
FT                   AAEEPDQAMAEAPVEGK"
FT   CDS_pept        join(474957..474975,475155..476716,476770..477588)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900807"
FT                   /orf_name="An16g02150"
FT                   /product="Similarity to hypothetical protein SPBC1685.14c -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAL00439.1"
FT                   /db_xref="HOGENOM:HBG328372"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013863"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000EFCEBD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R736"
FT                   /transl_table=1
FT                   /translation="MFVLRNVSKYLFGDSSKESIIEIPQGQLYLVRPLSPKGYSELIFK
FT                   DAAASIRRTGQEFQYQLVIQRAYEEGEEELGEEDDEQGGSDSLDKDEKVFLLDQALHFR
FT                   SEVREGGQKILAWRDLSGDIGDLFEFVCDPSVPSDKVSTFELAALQCQYERAYRRSSQN
FT                   VSREDLQEFSFQEEKPIPSASPISSSARSPARSPTSGESTAAMVKDVEYSRSKGQIKPA
FT                   ASEEATVAPPSAAQPEAREVLAKEKAELHLFDFVSGTFVLQAANVTATVSEIGDWKYWL
FT                   QISGEDKEWLGQAVVADINPVFNFEYLSFIFNAYSEDGSAFSWLLRFKDQETEERFQEG
FT                   LMQALWEQLNEMKWTKVKEQEREYVLDAFQDLTMEDAEEREAEAEEEEEEEDEEEDHYD
FT                   GQRSEHYDSDEEQDDVVTRDDDGNVNSQLAVGYKHDRSFVVRGSKIGVFKHTPDNNLEF
FT                   STNISKVETPRGKLFSPKKVMLHAEDTNMILQNGDDPNSLYRMDLEYGKIVDEWKVHDD
FT                   IPVTTFAPESKFSQMTSAQPFIGASKNALYRIDPRVDGNKLVDTDLKQYASKNEFSSVA
FT                   TTEKGYIAVASNKGDIRMFDRLGINAKTHIPALGEPIIGLDVSADGRWVLATCRTYLLL
FT                   IDSLQKEGKNEGKLGFERSFAKDSKPQPRRLGLQPAHVAQFQHETKKPISFTQARFNTG
FT                   VDSQETSIVTATGPFIITWSLKKVVAGRKDPYTIKRYGEDVMADNFRFGSDKNVIVALP
FT                   NEVNMVAKRSLMKPTRESIAGPPVTPRRRTQWGSRLGRDEIVNSPY"
FT   CDS_pept        join(complement(478532..479221),complement(478287..478369),
FT                   complement(478100..478228),complement(477926..477932))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900808"
FT                   /orf_name="An16g02160"
FT                   /product="Similarity: the C-terminal end "
FT                   /protein_id="CAL00440.1"
FT                   /db_xref="HOGENOM:HBG748961"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniParc:UPI0000EFCEBE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R737"
FT                   /transl_table=1
FT                   /translation="MSSSSSSRSGSRPPPTTSTSTTATTPSSLQQSAASYFSYPVTHVV
FT                   SGLYRRLTDPSTNTTNNMRRKTTTTDTTTNNNPVFTPIRTASPFQPPPLTPLTLSDPST
FT                   LLTRSLAEEIRLLVPPRLQLCNTWHLAYSLDRDGASLSTLYDNCRDIASTRSPRAGYIL
FT                   VIRDASPSSNAVFGAYMTDPPHPDSHYYGTGECFLWRASVLPPATAMLSNFSNANGDNG
FT                   GEEGVEADIRFKAFPYSGVNDYMMFCETGFLSLGGGDGHYGLWVDSSLEKGVSASCQTF
FT                   GNEPLSDEGVKFDIIGVEVCY"
FT   CDS_pept        join(complement(480975..481195),complement(480789..480922),
FT                   complement(480456..480728),complement(480398..480406),
FT                   complement(480161..480350),complement(479983..480103),
FT                   complement(479755..479919),complement(479617..479700))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000132894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900809"
FT                   /gene_name="hyl1"
FT                   /orf_name="An16g02170"
FT                   /product="Epoxide hydrolase hyl1-Aspergillus niger "
FT                   /EC_number="3.3.2.3"
FT                   /function="epoxide hydrolase activity"
FT                   /biological_process="response to toxin"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAL00441.1"
FT                   /db_xref="GO:0004301"
FT                   /db_xref="GO:0009636"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG714190"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="UniParc:UPI0000E66FED"
FT                   /db_xref="UniProtKB/TrEMBL:A2R738"
FT                   /transl_table=1
FT                   /translation="MSAPFGKLPSSASISPTPFTVSIPDEQLNDLKTLLRLSKIAPPTY
FT                   ENLQSDGRFGVTSEWLSSMREKWVSEFDWRTFEARMNSFPQFTTEIEGLTVHFAALFSQ
FT                   REDAVPIALLHGWPGNFVEFYPILQLFSEEYSPETLPFHLIVPSLPGYTFSSGPPLDRD
FT                   FGLVDIARVVDQLMKDLGFGSGYVIQGGDIGSFVGRVLGVSFDACKAVHLNLCAMRAPP
FT                   EGLSTESLTAAEKEGVARMEKFMTNGLAYALEHSTRPSTIGHVLSSSPIALLAWVGEKY
FT                   LQWVDEPLPSTTILEMVSLYWLTESFPRAIYSYRETTPTASVPNGATMLQNELYIHKPF
FT                   GFSFFPKDLCPVPRSWIATTGDLVFFQDHSEGGHFAALERPRELKADLTAFVEQVWQK"
FT   CDS_pept        complement(481993..482985)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15900810"
FT                   /orf_name="An16g02180"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAL00442.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCEF2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R739"
FT                   /transl_table=1
FT                   /translation="MGAQFSQFFPPRPTFTPDDLPQQSGKVVLITGGASGIGFEVAKVL
FT                   YRKGAKVYIAGRSESAAQAAILAIQKSVPENAKSSTGELHFLELHLDDLTTIKSTVSTF
FT                   SAIELKLDLLFNNAGVSQPPLGSVSQQGIELQLATNCLGPFLLTQLLTPLLEAAASSES
FT                   ELTTAGSVRVIWTSSQVAELSAPPEGIIMSELTNPPKDAVRNYVTSKLGNWFLSTEMAR
FT                   RYGEKGIVSVAQNPGAANTNLLRNARWMKLLSWPLLHSPALAAHTVLYAGLSGELGLEN
FT                   NGAYVVPWGRLHDAVAPTLLDAMKRKEEGGTGRACEFWEFCEARTKDYM"
FT   CDS_pept        483577..484182
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000084336" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900811"
FT                   /orf_name="An16g02190"
FT                   /product="Catalytic activity: proline racemaces catalyse
FT                   the reaction L-proline ["
FT                   /function="proline racemase activity"
FT                   /protein_id="CAL00443.1"
FT                   /db_xref="GO:0018112"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniParc:UPI0000EFCEF3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R740"
FT                   /transl_table=1
FT                   /translation="MVTEEYPAMSGGNAIATTTVLLETGMVAMTEPITKIVLETPAGLV
FT                   PITADCEGGKCEEVAFNTVSSFVFALDYKIDVPTLGFVSVDIAWGGMINGFVDATSLGI
FT                   SINNKNGPKLIEYGEGITDALQKAPFVPVHPENPGIRGVSILQFTEPLYWDTMMAVNTV
FT                   VVSPGRFDRCPCGTGSCARMAVLHARGQLAVDEEIPAS"
FT   CDS_pept        join(484570..484772,484836..485895)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196009" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812744"
FT                   /orf_name="An16g02200"
FT                   /product="Similarity to hypothetical protein YBR246w -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAL00444.1"
FT                   /db_xref="HOGENOM:HBG328374"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0000EFCEF4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R741"
FT                   /transl_table=1
FT                   /translation="MAQHPSSDTTIFLDQPPSCLQFHPSSPNHFLVGTYLLSEHKEDDS
FT                   APIQQTKTGSLQLWHLDPATNQLTLRHKHPLPYAVFDLHFHPTDPTLAAIATSAASVVF
FT                   FRITVPEGEENDRTPFIKEIQSHQVHEDPSIPALYLAWLPAGWHSTTTSNAGTEYGFAV
FT                   TFSDGLTTLFNTKVSPSPNSFSITEESSYPATQQIEVWYVAAATYPQPHSNGDNMRYIF
FT                   TGSDFGSLHTRYLPAPSNTNNSDEDNDEANMPILSHDDRARHHTAGVTAILPLPVPMTD
FT                   GAPWLLTGSYDESLRVYHASRRGEVLGEIGLGGGVWRLQILSTHSRPVDDSEGDVEWTF
FT                   LVLASCMHAGTRVVKVRVVLGESGQECEMEVVAEFTEHESMNYASDVWNWGGHKGGEGR
FT                   ELKVVSSSFYDRRVCVWRVNV"
FT   CDS_pept        join(complement(486416..486973),complement(486075..486353))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196008" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116916"
FT                   /orf_name="An16g02210"
FT                   /EC_number="3.4.25.1"
FT                   /function="hydrolase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="proteasome regulatory particle "
FT                   /protein_id="CAL00445.1"
FT                   /db_xref="GO:0005838"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG677040"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="InterPro:IPR006746"
FT                   /db_xref="UniParc:UPI0000EFCEF5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R742"
FT                   /transl_table=1
FT                   /translation="MANDLKAIVAELHSALGRQQFEAVNDLLSRGKRALLLQNVLIPTP
FT                   SAPAELVAQAREVLELGAIASIRQTDAPTFTRYYQQLQPFYDLERDSTNAGHVDIRSSQ
FT                   RSKITGLYLLLLLSMGDSTSFHTVLEGLVEEASLKGKSVEDDPFIKYPVELERNLMEGS
FT                   YDKVWRETNSERVPSEDFALFSNVLVGTIRSEIADCSEKAYPSLPISNAKNLLFLDSEG
FT                   AVIEFAQQRGWVLRDGRIYFPVEPEAAARSEKDILVASGTIIENAIGYARELETIV"
FT   CDS_pept        join(complement(488919..489090),complement(488803..488861),
FT                   complement(488611..488764),complement(488270..488350),
FT                   complement(487899..488115),complement(487677..487792),
FT                   complement(487275..487639))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235037" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812745"
FT                   /orf_name="An16g02220"
FT                   /protein_id="CAL00446.1"
FT                   /db_xref="HOGENOM:HBG328376"
FT                   /db_xref="UniParc:UPI0000EFCEF6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R743"
FT                   /transl_table=1
FT                   /translation="MAVAALDQLRSLFSGTTGSIVTPINKNNNNNNKNEFADRYQAAVT
FT                   PPGRTLAGPLQLEQALSSPSAPPATIQTYGSVLKSKELLADQNIAQPMSGNTRNKIYTW
FT                   LEEQGLSATGSREPQVETRWISFGDDGSLINANSKGSSDLHCALESSGSDFDHCGSSPG
FT                   HGRGSQDCAVCQLQQRICRGGHVLRDHPAEPPKAFEPFHNLRSLVTTVLPSTNGTLLSF
FT                   AQASQKRELYEQVYKTWLEVCKTLPTGAALHYTIHPIGTADIQAVSQSAASFLQFPIVP
FT                   KIRHRTNGYPAINRVGFAYEWPKDGSDDAAAQKAVDTISKTVQSLAKTKGTLLDFKYMT
FT                   FDTCSQKVLGSYGAENIKLMQEVAAKYDPEGVFQKLQNGGFLLRDNI"
FT   CDS_pept        join(490108..490544,490586..492605)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659920"
FT                   /orf_name="An16g02230"
FT                   /product="Function: co-expression of het-e and het-c lead
FT                   to cell death."
FT                   /protein_id="CAL00447.1"
FT                   /db_xref="UniParc:UPI0000EFCEF7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R744"
FT                   /transl_table=1
FT                   /translation="MEPISALSVACAVFQFADLGAKILTKGRELYQSHSGALDRHAELE
FT                   KCAEQLSALVNEYSKGANALPEALGKGMEDIIDECNLTAGLLSSLLNGLKIPEKSKGIL
FT                   RVFRAGRQAVRTAVRQSQIDELNDKMMDLREKLQAYMLAVLQLMGLVRNQSSATQETLK
FT                   KLSSDSAQRENNIASQLNDMRREMLSILQKPDSSLFLASDLEKLVPVLSNLVDESRAVT
FT                   CKTEILSSLYFPEMKERYDQIRDSEYSFEWILGSGRCNDTSVPRVYFVDWLHSQKANDN
FT                   TYWISGKPGSGKSTLMKFLYNHDQTRAILKEWAGQQKLVISGFYFWISGGSRLLKSQLG
FT                   LLRSLVFEVFWHMPEVIEYACPERYAKGLKPMQYGSLAWTLNELLEALKRATTNAQSNT
FT                   RFCFFIDGLDECDGYPQAMVDLIRDRFPKSPDIKFCLASRKWNAFIDEYGDVLGEREIP
FT                   RHLYLEDLTQTDIRRYVQRRLQAQRRFQQWHREDPVSSKRLIEDVVKKAEGVFLWVTLV
FT                   VESLIRGVQNKDHLATLQDRLDKIPSELPDYFAHMLRNVEDIYKVDAAKIYQIMLNTTE
FT                   QPYLLLFSYLWERDPQFGTVMETKPFSLRDINGMNDDLRVRLNARCTDLLDIVKDSRVH
FT                   IMWESKVAFLHRTVRDYMRSAEAQEILGKWLSQSKAHTSFNPDAYICQSAVAHIKRAPR
FT                   KPQYLSEQGRVSQLVNQFAYVARRIQKSLGDPQIELMNSLETTLNDYRQSQRLHATTYH
FT                   TSFWYSKASFLQWAEKEQLDLYVSYRLSKDPAGEEDLNEPRLLRRRQTFDEPEPKNNRT
FT                   KSQRRM"
FT   sig_peptide     490108..490170
FT                   /db_xref="UniProtKB/TrEMBL:A2R744 "
FT   mat_peptide     join(490171..490544,490586..492602)
FT                   /db_xref="UniProtKB/TrEMBL:A2R744 "
FT   CDS_pept        complement(493100..494041)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116917"
FT                   /orf_name="An16g02240"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAL00448.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCEF8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R745"
FT                   /transl_table=1
FT                   /translation="MSPKSILVLSATGNQGRGVVQHCLSAGHSVSAYVRNPASSAAVQL
FT                   AEQGATLITGDLDDLESLRSATQNVDAVFFTEVQTGNRELDLKRMENVILAAQESSTIS
FT                   HIILSTALKTGQHESFPGWEGGAHPMKEYWLQKHALENRVREAAAAKNGGRWTIIRPGH
FT                   FLQNLLPPVRDFMFPGFKEERVLRVAYRAGTELPLVDARDVGIVVAAAVKEPERFSSKA
FT                   VDVAVEVVTVEQLAGKIGKVVGEEVKVEFLDDEVVDGMIKEGHLGAASSRWADEVPGGD
FT                   GVSNCREELGPLAEGLTSVDAFLKENEKGILA"
FT   mat_peptide     complement(493103..493987)
FT                   /db_xref="UniProtKB/TrEMBL:A2R745 "
FT   sig_peptide     complement(493988..494041)
FT                   /db_xref="UniProtKB/TrEMBL:A2R745 "
FT   CDS_pept        join(complement(495463..496389),complement(494903..495417),
FT                   complement(494567..494846))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171253" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900812"
FT                   /orf_name="An16g02250"
FT                   /product="Catalytic activity: CLN2 of H. sapiens encodes
FT                   the lysosomal tripeptidyl peptidase I "
FT                   /EC_number="3.4.14.9"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAL00449.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG324076"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI000004F5F6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R746"
FT                   /transl_table=1
FT                   /translation="MIYVNYILGLLSLLHTAVATAPDYVVVDQLNSIPDGWTKGAAPPP
FT                   FTPMKFWLSMHHEYKADFEQKVIDISTPGHRDYGRHMKRNDVMAFMRPSDQVSKIIFSW
FT                   LESEHVPPNAIEDRGDWVAFTVPLAQAQSMMKTDFYNFHHLETNTTQIRTLKYSVPEQV
FT                   DAHLQMIQPTTRFGRPKTQTSLPSLMPVSVNIDEISEDCLTGVTPICLRQLYGLPSTKA
FT                   SPDSRNVLGISGYLDQYARYSDLDEFLAVYSPNSVDADFSVVSINGGQNPQNSQEGSTE
FT                   ASLDIQYALSMAFDANATFYTTAGRAPSPYLEQLQYLVGLPDEDLPAVLSTSYGEDEQS
FT                   LPEEYTEATCNLFAQLGARGVSVIFSSGDSGVGGSCVSNDGSQRTRFQPIFPASCPFVT
FT                   SVGGTEGVGPEKAVDFSSGGFSERFARPSYQNASVEAYLARLGDKWDGLYNPDGRGIPD
FT                   VSAQASNYVIRDHGQWLQTAGTSAAAPVFAAVISRLNAARLEQGKPTLGFLNPWLYSLD
FT                   QQGFTDIVDGGSVGCDGSNGGALVPYASWNATKGWDPVTGLGTPLYQTLEQLAQSA"
FT   mat_peptide     join(complement(495463..496332),complement(494903..495417),
FT                   complement(494570..494846))
FT                   /db_xref="UniProtKB/TrEMBL:A2R746 "
FT   sig_peptide     complement(496333..496389)
FT                   /db_xref="UniProtKB/TrEMBL:A2R746 "
FT   CDS_pept        join(496712..496786,496936..497049,497214..497468)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812746"
FT                   /orf_name="An16g02260"
FT                   /product="Similarity to hypothetical cDNA FLJ20093 fis -
FT                   Homo sapiens"
FT                   /protein_id="CAL00450.1"
FT                   /db_xref="UniParc:UPI0000EFCEF9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R747"
FT                   /transl_table=1
FT                   /translation="MKNVTACLPTHRACNSADPRTLDAKGGPVGIESIQSSIRGYSLTP
FT                   SSSKGRLECASQGMREAACLLGPKDKELGTDTFQQAVAHSSCSGPPPPCDKAVARTSPV
FT                   AFPSCCLIDSDNLFIRIGLLCYADKHPALWFPVIELVLSRGLC"
FT   CDS_pept        join(complement(498654..498759),complement(498557..498609))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812747"
FT                   /orf_name="An16g02270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAL00451.1"
FT                   /db_xref="UniParc:UPI0000EFCEFA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R748"
FT                   /transl_table=1
FT                   /translation="MIKPLFTTITKKKQGQVPNLEPSTTGCLMQEGQNYAPSAPCPELC
FT                   QPTVSSS"
FT   CDS_pept        join(complement(502296..502394),complement(501835..502243),
FT                   complement(501442..501752),complement(501304..501384),
FT                   complement(500628..501244),complement(500403..500576),
FT                   complement(499964..500341),complement(499772..499850))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900813"
FT                   /orf_name="An16g02280"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAL00452.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCEFB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R749"
FT                   /transl_table=1
FT                   /translation="MPNTAKESPRSPGRTRRSRKRAPVACQSCHARKMIFPVCRGKAGD
FT                   QSKRYSNLSAKNSSANPLTSCRSRRGLPYHLSTVSSPSNSDPATQSTPLGDDSFPPGPE
FT                   RLVALKDLSGPSGPSPTSPAVGDTGDGIETPYRPFNEHFSHHYEGDTGASQLDGDATDK
FT                   RCSPLYGDPRGVGLVVDICEPEPGEKSGHFLIPQIRPTHIDQDTIEYLRRKGVFDFPTP
FT                   AVCEMMIRTYFYYVHPFFPVVDAHSFLDTFENERSEVSVHLLWSMFLAAANFADDNTLR
FT                   AANFLSRKDMKRAMYIRAKALYDAEYERRKITLIQAVLLTGFWYSDTEDRTGPWHWNGI
FT                   AISLCQTIGLHRHPDTGRKHSKAIPTSDSSIWRQLWWSCFYREAWFSAGMGRPMRINLA
FT                   DCSTRMPDANDSDNLLAGIPECIRKKYLPEGTKDLSKLWTELLTLTISLAKILSWQNRA
FT                   ERTRPGKTEIQHMDDTIRQYSFRKDHAIAHGHNHVVSLHMYHLELYLDSVLLTLYRPFL
FT                   FDKPLDLSTDEWTSTVLRRTKDAATNTNRILGNMIGADMISNTQAMVCIALVPALQIHL
FT                   LDATSEKQMVQRMGRHNLEFCMMVIEELKSVYFGAEILSRMFTKAKNWIYYRTFAPATA
FT                   PRDYMPQSSRDSTIGSIPELPDDARQDDLEMFDAFVTLLSPFAPVSAGGSFDNDELLAF
FT                   ESTVTLEQLMFPEPESSADTR"
FT   CDS_pept        join(complement(503833..504023),complement(503151..503763))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000027948" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900814"
FT                   /orf_name="An16g02290"
FT                   /product="Complex: ECI1 of S. cerevisiae is a homohexamer "
FT                   /function="catalytic activity"
FT                   /protein_id="CAL00453.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG327837"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniParc:UPI0000EFCEFC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R750"
FT                   /transl_table=1
FT                   /translation="MAEEDLVRLDINGIFAVITLNNPQKFNALTQSLYYRLASLLREAE
FT                   DNSDVYVTVLIGEGAFFSAGADLKGKPPSMEEMLSRPHWLPKLVNNNIDVARAFYTHSK
FT                   VLVTALNGPVIGLSAALISHSDFIYAVSDAWLMTPFTSLGLVAEGGSSVAFVQRMGQGK
FT                   ANEALLLGRKIPVSELAQVGFVNKVFESKGNFREQVMGYLQQTFGEHLVKSSLLETKAL
FT                   MRRRLIREQDEQAPLEMFGGLDRFCQGIPQAKMGEALSKSKASRL"
FT   CDS_pept        join(504340..504411,504468..505256)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185464" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965910"
FT                   /orf_name="An16g02300"
FT                   /product="Similarity to hypothetical protein YBR096w -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAL00454.1"
FT                   /db_xref="UniParc:UPI0000EFCEFD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R751"
FT                   /transl_table=1
FT                   /translation="MGIWIWCLGLVLGLSLKNLPFMWHFRFFGALAMGYFTRRRSSHAL
FT                   QQHHAFLPAVVRSRSPATEGDFNFHKSNSTYITDLDVSRAYLSGLLFAPIFLQIKSSTP
FT                   CNLIVSAVSCTFHREIRLFQQYEIWTRVASWDDKWIYMVTHFVDNSKFWPRCCVMQANA
FT                   SINSKMRFPVSHDKERQKSVFASAVTRMVFKRGRLTVPPKRALEICGLLPAPTSETPTV
FT                   ASRPDPGAGVTESATGFNEWTVEEMALYKDANLPIVRLERGWDAVRGLFREEELALAEH
FT                   REFMW"
FT   sig_peptide     join(504340..504411,504468..504491)
FT                   /db_xref="UniProtKB/TrEMBL:A2R751 "
FT   mat_peptide     504492..505253
FT                   /db_xref="UniProtKB/TrEMBL:A2R751 "
FT   CDS_pept        505470..505730
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812748"
FT                   /orf_name="An16g02310"
FT                   /protein_id="CAL00455.1"
FT                   /db_xref="UniParc:UPI0000EFCEFE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R752"
FT                   /transl_table=1
FT                   /translation="MLKDESRNQLDTGPVLPDEARAGFGELKGCFYRSTLLRHFNSNLI
FT                   KLETDAPGFAMSAVISQLQRGNRYWRSIAFFARKMTYPERN"
FT   CDS_pept        join(506977..507121,507299..507661,507716..507975,
FT                   508036..508986)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235038" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900815"
FT                   /orf_name="An16g02320"
FT                   /protein_id="CAL00456.1"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI0000EFCEFF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R753"
FT                   /transl_table=1
FT                   /translation="MQLSWKPGYSLSNRPVRRSAARRINRGRLGNADGPQQFVFVAEHP
FT                   MRDLNVSEEASLSVETPFEVSGDASPTSAADSPGPETDPRTAELQPHGDNSEDQGQSPC
FT                   SSTPTDDGQLQLADRDAFYDWSSQVATTIESSPMAASDLPNTTTSMPPSVLYNNIWQQF
FT                   GPILERYNMEFCTIPLTFDLQMNPFRYRKTNVPEPMFLVHAVMALAGHHVKSPSTDDHH
FT                   YTALKLLRESINASGNVEDGCSMLDAIMILFSFDETQSTLGYWSTHLKGAYGLIEACGG
FT                   IEAWTTSARADAQIGLLLWYLTPLTPFSSPQPNILRKISRVLPAKLFRWDAITSLLSRE
FT                   NCVFPYAYVEAILSNPDDRKWNFFDLCGCPHSVVTLLMQVVRLSAEKRQSSSMRYVTFD
FT                   TTMVAQIEQALESWHHISPAALAFGSEEDIQKDQDCMHCSEAWRHGLLLYIYRVFRWKP
FT                   GSPIPTHVVRWARVVVDHVVACRDESMVARQALLPLFFAGCEQRDRSIRQKIVQFCSVW
FT                   NDRTRYQMFGSTIPLLEEVWAEQEAKGFENVWWGHVVDRKHTVSCYPLQMRLCFG"
FT   CDS_pept        join(complement(511656..511791),complement(510115..511589))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900816"
FT                   /orf_name="An16g02330"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAL00457.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328126"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCF00"
FT                   /db_xref="UniProtKB/TrEMBL:A2R754"
FT                   /transl_table=1
FT                   /translation="MPPPDCSRRQIAPKADGCRADLGNVPITLDELEIDSYFASCPRTE
FT                   GPSSTQESVIVTWNGEDDPKDPYNWPLSKKWRATGIGLLASFVCSMNGTILTVAHTAIG
FT                   DEFHISDATFPNTYWLTTSWGIGAALCPLLLFPVMEDFGVRPVLLTTYFCFISFLIPVG
FT                   LAPNFATLIVVRFFSGGCVPLISDAVAGITSNVFHGDRARSVPICLYVTIYLAATSLGP
FT                   VVGSAILQFLSWRWIAYIELIWTAALYPILIFGLPESRGPAILRAKAKRLRREGTNAYT
FT                   TEKIDRVALPQLILQSVQRPLYMLCTEGVVFVATVWAAFSLGTIYLFTQSVEQVYKELY
FT                   RWDPIQCGYVQVAIVIGELLGGGFCILTDPWYYASATRNTEAPGTPIPEARLHASIIGG
FT                   LFGVTSGMFVYGWASYTSIHWMAPTVGLAMVGFGTTAVIVGNANYLIDAYSKYAASALG
FT                   AVGFVENISIAFLPLAAAAMYTNIGFQWASSLLAFVSLALVATPFVVLQWGKEIRSYSP
FT                   FMQEATVERTRDSAAAAGV"
FT   CDS_pept        join(512342..512533,512925..513041,513503..513604)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116918"
FT                   /orf_name="An16g02340"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAL00458.1"
FT                   /db_xref="UniParc:UPI0000EFCF01"
FT                   /db_xref="UniProtKB/TrEMBL:A2R755"
FT                   /transl_table=1
FT                   /translation="MAEIKMRRASISSVAVATILSADKMRIRSVLCTVFKYLRCVLSRS
FT                   GSCQTVDARLWQNPSMGPTVRGNSQILQLPDKRTVRKRIPAQMPPFASLMLKVGPVEEG
FT                   LTETQGTQSSAHSVLSDRPTLLRACSGLLSGH"
FT   sig_peptide     512342..512407
FT                   /db_xref="UniProtKB/TrEMBL:A2R755 "
FT   mat_peptide     join(512408..512533,512925..513041,513503..513601)
FT                   /db_xref="UniProtKB/TrEMBL:A2R755 "
FT   CDS_pept        complement(513739..515082)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812749"
FT                   /orf_name="An16g02350"
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAL00459.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG328387"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI0000EFCF36"
FT                   /db_xref="UniProtKB/TrEMBL:A2R756"
FT                   /transl_table=1
FT                   /translation="MDDYLDVFGQQTFTINIQSCFCFPLPDNSACPEIVGTLTKGLERL
FT                   RTSFPWLAGQVVNEGSSDGDTGYFMIRPLENEAQLVVRDLQNDLSVATMKDLQRANYPI
FT                   GMLDQNILAPRKIFPENQDDSKPVFLIQATFITGGLLLTFVAQHNAMDATGLVNIIHLF
FT                   SKACRNEEFTYEELRDGNLPRRDIVPLLEDSHATDAELNRYIVKTAPYKHSTNLPGTRM
FT                   PKCSWTSFKISPRSLEELKSVAMASLPPPSFVSTDDALTAFIWQSVTRARLRRLGPSTH
FT                   STIMRAVDVRGLLDISPLYPGPIQSNVYTESSIMRLIEEPLGNIALQLRLALSDESRLE
FT                   HHTRVIATFLSRTPDKNIFSFGASIDTTTDLIFSSWAKLESYRFDFNLGLGLPEAVRKP
FT                   RCNEVEGLTFLLPKTREGEVIVAIYLRDEDIEELRSDVVFIKHAEYVG"
FT   CDS_pept        join(complement(516701..516755),complement(515706..516640))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965911"
FT                   /orf_name="An16g02360"
FT                   /EC_number="1.1.1.65"
FT                   /function="pyridoxine 4-dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAL00460.1"
FT                   /db_xref="GO:0050236"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0000EFCF37"
FT                   /db_xref="UniProtKB/TrEMBL:A2R757"
FT                   /transl_table=1
FT                   /translation="MTVTLVNKAIGPIGFGLMGLTWRANPTPYDEAVKVMKRALDLGAN
FT                   FWNAGEFYGPPHANSLQLLDYYFTKYPEDSSKVVLSVKGGLGPKGPDGTTEGIRASIDN
FT                   CLKLLNGKVFISIFEPARVDPNTPIETTISAIADYVKAGKIGGIGISECSEQTVGRAHA
FT                   IHPLAAVEVELSLFSTDPLENGVAAACKELNIPLVAYSPLSRGWLTGQLRSLDDLPADD
FT                   SRRNYPRFQPDVFHLNLKLVEQLEQIARKKKATLAQTAISWVRAQNKLPGNPVIIPIPG
FT                   CTTVERVEENMADVELSESELKEIAAILKEIPVHGDRYGGVLARLMNL"
FT   CDS_pept        join(complement(517539..518072),complement(517311..517511))
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18116919"
FT                   /orf_name="An16g02370"
FT                   /product="Putative sequencing error "
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAL00461.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCF38"
FT                   /db_xref="UniProtKB/TrEMBL:A2R758"
FT                   /transl_table=1
FT                   /translation="MASLNSTIVPITGANQGLGFAVAKKLATDHPGYHVLMGYRDATKG
FT                   EEAIAKLKSRGLTVEGVMIDVTDDTSMXRAAEQASAQFGRLDVLINNAGVISEGRSPEG
FT                   TSLRHTWQTGFDINITAHVITPEAFVPLLEKAALPLVVFVSSALGSCPGRLDPNDQFAA
FT                   FRFPAYRSTKVALNMGPKGWKVNASDPGNYATNFNGFRGSGSPLSGALQTVRLASLDKD
FT                   GPTGIFSNTDGPLGWQNRCVSI"
FT   CDS_pept        join(519035..519063,519228..519297,519368..519448,
FT                   519512..520122,520173..520347,520400..520799,5
FT                   20912..521024)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000133030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900817"
FT                   /orf_name="An16g02380"
FT                   /protein_id="CAL00462.1"
FT                   /db_xref="HOGENOM:HBG383580"
FT                   /db_xref="UniParc:UPI0000EFCF39"
FT                   /db_xref="UniProtKB/TrEMBL:A2R759"
FT                   /transl_table=1
FT                   /translation="MPPDLLAVLFNVDVLVIGAGPTGLGAAKRLQQLNSATWMIIDANE
FT                   TPGGLASTDITPEGFLSDVGGHVIFSHYKYFDDCLHEALPKTEDWYEHQRVSYVRYQDR
FT                   WVPYPFQNNISVLPKEEQVQCIESLIDAALEVRTRPASDKPQNFDIWNTRNVGQQLNEI
FT                   FMRPYNFKVWAMPPSKMNATWVGERVAAPNLKLLTSNVILNKVAGNWGPNATFKFPANG
FT                   GTGGIWIAVANTIAQEKTRFGEHGTVVKVDAEAKKVYLKDGLYHCHYGSLISTMAVDYL
FT                   AEAMADTALQQHCEPLFYSSTNVIGVGIRGTRPERIGDKCWLYFPEDNCPFYRATIFSN
FT                   YSPNNQPQQKVKLPTKQLANSQKSASSDAQEGLYWSIMLEVSESQYKPVNHDILLDDCI
FT                   QGLINTTLLQPEDEIVSTYVRHFDHGYPTPSLERNGALNKILLYLQQKDILSRGRFVDH
FT                   IISGAVELTLAYPDFVNGRANTERRLSSMKTVTQ"
FT   sig_peptide     join(519035..519063,519228..519255)
FT                   /db_xref="UniProtKB/TrEMBL:A2R759 "
FT   mat_peptide     join(519256..519297,519368..519448,519512..520122,
FT                   520173..520347,520400..520799,520912..521021)
FT                   /db_xref="UniProtKB/TrEMBL:A2R759 "
FT   CDS_pept        join(521734..521783,521837..522415,522475..522613,
FT                   522665..523054)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900818"
FT                   /orf_name="An16g02390"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An08g08410 - Aspergillus niger"
FT                   /protein_id="CAL00463.1"
FT                   /db_xref="UniParc:UPI0000EFCF3A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R760"
FT                   /transl_table=1
FT                   /translation="MTDPLEPFRKFSKADRHQSPHTPALEVTLTEYRTFYTENPDGNFI
FT                   KVTIARSKEQQEPKPCYFYWSPSTDEGFRVFRDRPGEGIEVEVQSNCSLPVTQQSGSPH
FT                   LWYLGAKDKSVSWDIPLGENIPRAIEKDKWIIYDLFWPGGEVYLWDWGPKDTNKEKLES
FT                   AELKPKSTPIILPGGVWCRFCLIEGSPPPPPPRPLTPPILELDPSTLTPGVPIFSLEIE
FT                   GPPTWRTQERWPLTWKLTYHGVSGDETPRPITFSDTGEWESWRGDGVCGYALFEDEDVP
FT                   RAVGSSTGFISLQPNETWCKVQGLGMMADLPEDARGGEVMRHRFKGCKWTWWDWGTKGD
FT                   HLDTIVMVVGFGVITKPADNDGRPEVVVPASNMVEFTVIEQERET"
FT   CDS_pept        join(complement(523703..523977),complement(523077..523638))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812750"
FT                   /orf_name="An16g02400"
FT                   /product="Similarity to ORF 2 in the cited reference. "
FT                   /protein_id="CAL00464.1"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI0000EFCF3B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R761"
FT                   /transl_table=1
FT                   /translation="MLTLFNSLLLGLSIISFLPQLQLLWTTKNSSGLSLCYLLFNLICA
FT                   TEQFLLAFLYNNNPEAEPNMFVESPGSLGDWLNLIRITVIWILFSLTFTLSLRYPSDSS
FT                   FRNKLSAALSYIIYLLIAVIPSVCVVLTTDRGEDPPTSENEWVFALWSGVHLIFVNPAM
FT                   TLLAFSAVFCQAPKLRKSVPPPAALSLRGLAIQAGVFSVLALSWPFRFVNINPDWDIFA
FT                   SWFTLYSWYVTVGWTAVDCAIFALVQAILLWMACRNMKYWRLAEGAETEPLLANHE"
FT   mat_peptide     join(complement(523703..523908),complement(523080..523638))
FT                   /db_xref="UniProtKB/TrEMBL:A2R761 "
FT   sig_peptide     complement(523909..523977)
FT                   /db_xref="UniProtKB/TrEMBL:A2R761 "
FT   CDS_pept        join(complement(525552..525724),complement(525357..525471))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900819"
FT                   /orf_name="An16g02410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAL00465.1"
FT                   /db_xref="UniParc:UPI0000EFCF3C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R762"
FT                   /transl_table=1
FT                   /translation="MVRAGSNVTEAEQSRRDRKLGIAVCAQEVETEKIIDSWPAMGDGE
FT                   QGLREEERTKAVRDLAHFRAPSLDPVAEGSFSACFTNHDFIDASSNDPGR"
FT   CDS_pept        join(526306..526920,526977..527654,527716..528399,
FT                   528458..528907,528964..529551)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900820"
FT                   /orf_name="An16g02420"
FT                   /product="Similarity to hypothetical CG7701 -Drosophila
FT                   melanogaster"
FT                   /protein_id="CAL00466.1"
FT                   /db_xref="HOGENOM:HBG324077"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000EFCF3D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R763"
FT                   /transl_table=1
FT                   /translation="MSHPLVAAVWEQLGRRDLAHILREIIGEHALDIALYQQDAKASVE
FT                   PLTRSVFWIKTIFDAQRTYLQGLSHVRDCHPYFLPYLLPTETIFSALMYLVKVKVELFP
FT                   SHKTTDGDFIRYRLLIAHTLLTGIRVLLLRGEAIDTDRKFQFERAMRAAWRNPDLSNVE
FT                   RFLISDFLPKALTSIGSPDLSTSQAFLLDCGKPYLPPFATGLYPLSGAPERLITDLLTN
FT                   VMKNGADQLVSFCLLYDMLWAVDSAIIQCHIDRRRISQEQGYTSPAAYKVDESFNQAQE
FT                   IKKKLTRTVLAAFDDEFNTAPLRIFATIILSQTADEHPPLQTRRIRDTWHQMSPIRTSW
FT                   EKASGQFVRWLINRRVQMWDCNGELEAFSHDYQQHLTQWLQSSSAAEADPKPQPKTSRV
FT                   SAVYVVNCPAVHPVPGPLLEESLKAHDKSAYEQLQGSPEFLTMDIDCPLCPGNKRVQHA
FT                   RMIEPLEQLSDALHFFSDSEAERRHSLLDSTSRDTTSCSSSLSHSTSQSSRLESDPAKR
FT                   PISPASNPAPLSKVTSKQAIATTTEVFSPVLSRSRTDQSFDRQAIKTLSRDLRNVKLPF
FT                   GGGASLFRRNSARGHQLPRQPRFCFSTSGSCLLFWGAGSNWVMRFETSVGDGKKPKGHK
FT                   YDIPGVQQAAAGDQRCAVLASVGQHYELVVFENDSDVPQAYLTIETENQTFPVTCMVMS
FT                   RNDRYVAFTLQDQVRVYEICTRTIQRVSLGSGMDRSSDFGHRSVMGASPNAKGTAYQGK
FT                   RQEAIIERKLQFSPDGKHFAIATHLGDHYAYVDVWNCTFQQWSIVPDKSKSFKLPSWTS
FT                   NDGDFTGVFYDGTQHAVLLTAFFAKEYPAFFSMLDDKTTNDSFSTRVVHAAQSPSGTRF
FT                   IIANGMCEVYVGDSKANGRLQLSRVRKASSKISPSVFRPGQLALSFPQETEVLAFWVKA
FT                   GKLVLRSVRMQDGIETTSDCDLRSDFDRLVVERPLAADFHSQRRRHSLLSTELLAEIDG
FT                   LPSLPRPDLPELSST"
FT   CDS_pept        join(530435..530555,530639..530799,530848..531570,
FT                   531627..531833)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659921"
FT                   /orf_name="An16g02430"
FT                   /product="Function: cofactor C of H. sapiens is a tubulin-
FT                   folding protein"
FT                   /function="binding"
FT                   /protein_id="CAL00467.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG328391"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="UniParc:UPI0000EFCF3E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R764"
FT                   /transl_table=1
FT                   /translation="MSMPEFDPARRPSQSENQTILKSEIPLKERFFRYFQHEITALQEQ
FT                   MDRLADTSLVGGERTDATDHCLAGIARLSNEVKDAASYIPTYDQRIYAEAIKALQDKLV
FT                   ETRAAVEPRPKFSFKTKKNASAISLSDAAHLAAQGRRSIPGFPSPDTSSVSSSATQTPM
FT                   YPSTPLNEPDNRLHLQRPELAPTSIPAFTMDEDEDKPKSDVGAGFAATAVSSVSVNNHH
FT                   NLHIMLPSSGSTATVPASITHLRHCVVDMSIPTANGKPYTSLTIKSVKESLLVCGQING
FT                   PAHITGVENSILVIDCRQFRMHDCSNVDVYLSCSSNPIIEDCSNVRFGRKPRIYTLDHD
FT                   RPDDEDHWSQVEDFKWIKPEPSPNWSLLDAEDAVPEEVWAEIVPGGPGWSLDDILRAIN
FT                   ISSH"
FT   CDS_pept        join(complement(533755..534041),complement(532480..533696),
FT                   complement(532373..532397),complement(532302..532335))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000195965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900821"
FT                   /orf_name="An16g02440"
FT                   /product="Similarity to hypothetical mlr1518 -Mesorhizobium
FT                   loti"
FT                   /protein_id="CAL00468.1"
FT                   /db_xref="HOGENOM:HBG299238"
FT                   /db_xref="UniParc:UPI0000EFCF3F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R765"
FT                   /transl_table=1
FT                   /translation="MRVHSLLPMLPSAVAALPSSSFASFSNIVNQTTCGSTTYSYTGLE
FT                   GYGFVPSNATDKYGDTMGGFGSSAAFDLSTWQRTSPDTYTGIIYCLPDRGWNTNGTLNF
FT                   QPRIHTFNLTLQLSPNASATHPSPPNIHLHYLDTLLLTGPDNAPLTGLDAITTTTNTTT
FT                   TTTKYPNFPPLPIATYPGDGFGGPGPGGHRIPLDAEGLALPAHDPAHIWVSDEYGPYVY
FT                   KFDKRTGRMVYAIQPPQAYLPRRNNTLSFSADSPPIYDAELVPIPEDPSTGRDNNQGFE
FT                   GLTISSDGKKLYTLLQSALNQEGGLKKKYRDQARLLQYDISNSSGVDAVYEAEYVVTLP
FT                   KYYNPEKGHDIVAAQSEIHLLPTGDFLILARDSGFGHGQSDSLSVYRHADIFHISTNTT
FT                   TDLKNLRGVDAPNGTIASDKGILHDGIPPAEYCSFLDYNVPGQLAKFGLHNGGEQDRWL
FT                   LNEKWESLALVPVNPDTEDSSGGNGEKDYFLFSISDNDFITQDGHMNFGRFRCWRLEFV
FT                   SRF"
FT   mat_peptide     join(complement(533755..533972),complement(532480..533696),
FT                   complement(532373..532397),complement(532305..532335))
FT                   /db_xref="UniProtKB/TrEMBL:A2R765 "
FT   sig_peptide     complement(533973..534041)
FT                   /db_xref="UniProtKB/TrEMBL:A2R765 "
FT   CDS_pept        join(complement(536410..536956),complement(536183..536216),
FT                   complement(535789..535994),complement(534865..535741),
FT                   complement(534592..534809),complement(534464..534543))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965912"
FT                   /orf_name="An16g02450"
FT                   /protein_id="CAL00469.1"
FT                   /db_xref="HOGENOM:HBG328392"
FT                   /db_xref="UniParc:UPI0000EFCF40"
FT                   /db_xref="UniProtKB/TrEMBL:A2R766"
FT                   /transl_table=1
FT                   /translation="MTEILESESPPTFLRPHDGPGASTSQPRNTQSISGNSSGAGTVPL
FT                   EGDSPSTHRHEANTDVVLPYSIEEPDDEPAETAGRTTGKPVIRLLVGDESEMWQGELVD
FT                   SMEGLQCDSDQSASQTRGKKRKPSTTATGTSRPSRQSSSGSIPNAQRDESNDGPKRRRR
FT                   KGRCTKDHLSPGMFWQHDSIDAALARTGWTLTSTRQAAQKAKEAIAAAPDVKSRGPAGA
FT                   KRKETTDKGPAPKKGKKEDDKVKPEKDQQPATEDEVKTTEERAEEPEKPESKPEEAPEK
FT                   PAEKEEPQKTDEEPAAAPSEPADKAEDKQKPNEPEEKPEQNVEQKPEEKSEEKRDAEPD
FT                   TKPEEKSEEKPAPAADGAETGVKTSQEREEKVASNVLEKGIVYFFYRPRVNVTDPQSVS
FT                   DVARSFLVLRPTPIGATLNQQQGSVEPGAKCRLLMLPKKKFPTSGKERDMGFVEKAGHS
FT                   MKSLQESFIAGDTYETSTRGERTVPEARPFAEGVYAITSTTRASHLAYILTIPETIGSI
FT                   QEDFGLHSRGSWVIQSKNPKYPGPSYAQIQKDPEYPESIREKFGDYRWVPLQPEFIDYP
FT                   NAQFLMIGEATDDLGKAATAEEGGKQANEAQPGEELEKLGQENEERIEALRGDDTIYED
FT                   LGLDAKNYPKVPTTWNSE"
FT   CDS_pept        join(537744..537755,537850..537899,537961..538280,
FT                   538334..538669,538725..539691,539745..540340,
FT                   540390..541474,541532..541786)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116920"
FT                   /orf_name="An16g02460"
FT                   /product="Complex: the coatomer is an oligomeric complex
FT                   that consist of at least the alpha "
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="CAL00470.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG328393"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000EFCF41"
FT                   /db_xref="UniProtKB/TrEMBL:A2R767"
FT                   /transl_table=1
FT                   /translation="MLTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDYRMGTLID
FT                   RFEEHDGPVRGIDFHPTQPLFVSGGDDYKIKVWNYQTRRCMFTLNGHLDYVRTVFFHHE
FT                   LPWILSCSDDQTIRIWNWQNRSLICTMTGHNHYVMCAQFHPTEDLIASASLDQSVRIWD
FT                   ISGLRKKHSAPTSMSFEDQMARANPAQADMFGNTDAVVKFVLEGHDRGVNWVSFHPTLP
FT                   LIVSAGDDRLIKLWRMSDTKAWEVDTCRGHFQNASACLFHPHQDLILSVGEDKTIRCWD
FT                   LNKRTSVQSFKRDLDRFWVIAAHPEINLFAAGHDTGVMVFKLERERPASAVYQNQLFYI
FT                   TKEKHVKSYDFAKNVETPPMLSLRKLGSPWVPPRTLSYNPAERAILVTSPTDGGVYELI
FT                   HLPRDATGAVEPTDVKRGQGSSAVFVARNRFAVFSQGNQQVDIKDLSNSTTKSIKPPAG
FT                   TTDIYFGGTGCLLFITPTNVVLFDIQQKKQLAELAVSGVKYVVWSNDGLYAALLSKHNV
FT                   TIVTKSLEQVSSLHETIRIKSAAWDDAGVLLYSTLNHVKYSLLNGDNGIIRTLDQTVYL
FT                   VKVKGRNVYCLDRNAKPRVLEIDPTEYRFKLALVKRNYDEMLQIIKTSSLVGQSIISYL
FT                   QKKGYPEIALQFVQDPQTRFELALECGNLEVAIEMARELDRPKLWSRLGAEALAHGNHQ
FT                   TVEMSYQKQRNFDKLSFLYLATGDQEKLSRMAKIAEHRGDFTSRFQNAIYRGDVEDRIQ
FT                   MFKEVDQYPLAYLTAKSHGLTEEAESILEACGLTEDQITLPSVDEPARVPHPIVPTFKS
FT                   NWPVKAAGHSSFEKALLGEVGAGDEEAAAIEFEPEEEDEAITARDTLEDEEEDVAGWDM
FT                   GDEINVEEDVDFVNVDSAEAGAGSTEADLWARNSPLAADHVAAGSFETAMQLLNRQVGA
FT                   VNFAPLKPRFLEVYKASKTFLPASAGLPPLVNYVRRTVDETDSRKVLPIIPKDLETIAN
FT                   VDLQEGYAAMRANKLEDGVRIFRNILNSVLVNTVSSEAEVEQAKKIVETAREYILAMSI
FT                   ELERRSIPTDTPDNLKRSLELSAYFTIPKLEVAHRQLALMAAMKLAFANKNYSSALSFA
FT                   NRMLANGGSPKLLEQARKIKAQCERSPQDKIDIEFDQFAEFDICAASFTPIYGGSPSVS
FT                   DPFTGAKYHEQYKGTVCRISQVTEIGAPASGLRLFVPGQY"
FT   CDS_pept        join(complement(542850..543016),complement(542308..542785))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195924" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900822"
FT                   /orf_name="An16g02470"
FT                   /product="Complex: Erv1 of S. cerevisiae is a homodimer "
FT                   /function="thiol oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAL00471.1"
FT                   /db_xref="GO:0016972"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG315946"
FT                   /db_xref="InterPro:IPR006863"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="UniParc:UPI0000EFCF42"
FT                   /db_xref="UniProtKB/TrEMBL:A2R768"
FT                   /transl_table=1
FT                   /translation="MPKHLFIHQQQQQPATPSSSTQQQAPATATAAKDDSVPAGMTKLP
FT                   NGVILDKDGKPCRLCTSAASWRALTKQAKSTPSTTTSTASTIPKTLATTPGYTDCPPDS
FT                   EALGRSTWTFLHSLTASYPAQASSEQQSEMRQFLGIFSKLYPCWVCAEDFRAWMAEPSG
FT                   ENQPRLGGRKEFGDWMCRAHNEVNRKLGKSEFDCRFWEERWRKGWGDGRCE"
FT   CDS_pept        join(543659..543916,544011..544841)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195925" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116921"
FT                   /orf_name="An16g02480"
FT                   /product="Similarity to HIRA-interacting protein 3 HIRIP3 -
FT                   Homo sapiens"
FT                   /protein_id="CAL00472.1"
FT                   /db_xref="HOGENOM:HBG328394"
FT                   /db_xref="UniParc:UPI0000EFCF43"
FT                   /db_xref="UniProtKB/TrEMBL:A2R769"
FT                   /transl_table=1
FT                   /translation="MAPRYALSSSEPESEAESASGRPADDALEQALRDAVTKVYKSGKM
FT                   EELTVKRVRLAAEKALELEEGFYKTQGDWKTRSEQIIKDQVEEEEKATQEPVSDDQEDA
FT                   ASSASEDAKPAKRTRPEKPSASRKRQKKSASVSDGGDAANGSPYEEEDKVEKLPKKQTK
FT                   AAPKKQPSPKASEDYVHDSDEEEVEKPKNAEETPKDDSESELSVVLDEEPKPKPNRKRQ
FT                   KSAEGPPRKGRKQTTAKGKDSDMDPNQAEIKRLQGWLLKCGIRKMWARELAPYDTPKAK
FT                   INHLKGMLKDAGMEGRYSVEKANRIREERELKADLEMVQEGAKRWGKESASENSDDGQP
FT                   KRRLNRGRKSLAFLESEGEETD"
FT   CDS_pept        join(545696..545772,545828..545848,545919..546050,
FT                   546110..546747,546803..547371,547426..547787,5
FT                   47850..548297)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900823"
FT                   /orf_name="An16g02490"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAL00473.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG718694"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="UniParc:UPI0000EFCF67"
FT                   /db_xref="UniProtKB/TrEMBL:A2R770"
FT                   /transl_table=1
FT                   /translation="MAMNRIRGAFAVPRKGETFELRAGLVSQYAYERKESIQKTIMAMT
FT                   LGKDVSALFPDVLKNIATNDLEQKKLVYLYLMNYAKSHPDLCILAVNTFVQDSEDPNPL
FT                   IRALAIRTMGCIRVDKMVDYMEEPLRKTLRDESPYVRKTAAICVAKLFDLNPAMCLENG
FT                   FLEMLQEMIGDPNPMVVANSVTALSEIYHAAPETQALKVTSNTLRKLLMALNECTEWGR
FT                   VTILTTLAEYRTNEVTESEHICERVSPQFQHANPSVVLAAVKVVFLHMRNVNYELAKTY
FT                   LKKMAPPLVTLVSSAPEVQYVALRNIDLLLQKQPDILNKELRVFFCKYNDPPYVKFQKL
FT                   EIMVRIANDRNVDQLLAELKEYALEVDMDFVRRAVKAIGQVAIKIESASEKCVNTLLDL
FT                   INTKVNYVVQEAIVVIKDIFRKYPGYEGIIPTLCKCIDELDEPNARAALIWIVGQYAEK
FT                   ISNAGDILAGFVEGFNEEFSQTQLQILTAVVKLFLKRPEKAQGLVQKVLQAATAENDNP
FT                   DVRDRAYVYWRLLSNTSDPNATKNIVLSDKPPIVTTIQSLPPNLLDQLLGELSTLASVY
FT                   HKPPEQFVGQGRFGADAVQRAAIEEQIQNARENPLAAAAAAAAVTGSAPPPQSQSNVEN
FT                   LLDIDFDGTAPASAQKEPGGGMSGLEGLAGTPVRVESPAAGAPSGSNNLDDLLGVFGDG
FT                   AAAAPASGSGAPNGGAADLMNGFEGLDLSGGGMASPPPGGSQPKKTNEDIMSLF"
FT   CDS_pept        join(548838..548973,549037..549340,549423..550989,
FT                   551502..551525)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900824"
FT                   /orf_name="An16g02500"
FT                   /EC_number="4.2.1.20"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="tryptophan synthase activity"
FT                   /protein_id="CAL00474.1"
FT                   /db_xref="GO:0004834"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG303148"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="UniParc:UPI0000EFCF68"
FT                   /db_xref="UniProtKB/TrEMBL:A2R771"
FT                   /transl_table=1
FT                   /translation="MDQIKKTFARCAQEGRPALVTYVTAGFPTAAETPDIMLAMQAGGA
FT                   DVIELGLPFTDPIADGPTIQMSNLKALDNGVTISSMFQMVQAARQRGLHVPVLFMGYYN
FT                   PIMRYGESELLAASRTAGVDGFIIVDLPPEEAVRFRNQCRAAGLSYVPLIAPSTTEERM
FT                   RTLCGIADSFIYLVSRMGVTGATGTLSHELPELMKRVKHLSGGVPVAVGFGVSTREHFL
FT                   GVTSIADGAVIGSEIITQLANAPAGQGAAVIQDYCSQITCRTVEPIEPHSVPTNAEPSS
FT                   SSATLPTSEQSTEASKPGRFGTFGGQYVPEALTTCLNELEAGFNAAIDDPTFWAEYRSY
FT                   YPYIGRPSSLHQAPRLTSHAGGATIWLKREDLNHTGSHKINNALGQILLARRLGKTEII
FT                   AETGAGQHGVATATVCAKFGMKCTVYMGSEDVRRQALNVFRMRLLGATVIPVESGSRTL
FT                   RDAVNESFRAWITRLNTTHYIIGSAIGPHPFPTIVRTFQSIIGEETKAQLAQEINRLPD
FT                   AVVACVGGGSNAVGMFYPFSEDPSVQLIGVEAGGDGDGSPEHHCATLSSGSGSVGVFHG
FT                   VRTYVLQNEHGQISGTHSVSAGLDYPGVGPELAHWKEVGRAKFISATDEEALEGLRLLC
FT                   RLEGILPALETSHAIAKVVDVAREVGVGGHVVLCLTSTTLF"
FT   CDS_pept        join(552522..552695,552763..553374,553443..553736)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900825"
FT                   /orf_name="An16g02510"
FT                   /product="Catalytic activity: alcohol dehydrogenase C "
FT                   /EC_number="1.1.1.2"
FT                   /function="alcohol dehydrogenase (NADP+) activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAL00475.1"
FT                   /db_xref="GO:0008106"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCF69"
FT                   /db_xref="UniProtKB/TrEMBL:A2R772"
FT                   /transl_table=1
FT                   /translation="MAQDYKFEGWMGLDKDSADGKMVWQEFEPKPWEETDVDIKITHCG
FT                   ICGSDLHTLRSGWRPTLYPCCVGHEIVGTAVRVGSKAVGGIKVGDRVGVGAQSDSCLGR
FT                   LGDCPECAMGDEQYCSHKIVGTYNNVHLNGGKSYGGYALYNRTPSHFVVKIPDSIPSAQ
FT                   AAPMLCGGVTLFSPLKHHNCGPGKRVGIIGVGGLGHFGVLLAKAMGADKVVAISRKTGK
FT                   ANDALAMGADLYIATDDEPDWATKYARSLDLIVCTVSSTKMPMTEYLGLLATGGALVQV
FT                   GLPDDGVLLAPVGKLQRRLKATSSFIGSPNEIREMFQLVAEKGVKAWIEEIPMKDANQA
FT                   IVDMHAGKARYRYVLVNEQ"
FT   CDS_pept        join(554082..554135,554237..554562,554632..555498,
FT                   555541..555856)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965913"
FT                   /orf_name="An16g02520"
FT                   /product="Catalytic activity: threonine synthase "
FT                   /EC_number="4.2.3.1"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="threonine synthase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /protein_id="CAL00476.1"
FT                   /db_xref="GO:0004795"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG521025"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="UniParc:UPI0000EFCF6A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R773"
FT                   /transl_table=1
FT                   /translation="MSPTLSQRFLSTRGGSYGLSFEEVVLKGLASDGGLFIPEEIPTLP
FT                   AGWESEWRDLSFEELAFRIMSLYISESEIPSEDLKDIIKRSYATFRHPERTPIVELDGK
FT                   RNLYLLELFHGPTFAFKDVALQNLGNLFEYFLVRKNQGKEGKDRHHLTVVGATSGDTGS
FT                   AAIYGLRGKKDVSVFILFPKGKVSPIQQAQMTTILDANVHNLTVEGTFDDCQDFVKALF
FT                   ADPDMNSTHNLAAINSINFARILAQITYYFYSYLALTKTPGYNNKMRFVVPSGNFGDIL
FT                   AGWFAKRMGLPAEKLVIATNENDILDRFFRTGGTYSKSDSKGAGVKETHSPAMDILVSS
FT                   NFERLLWFLAYQTSEASTADERRKQACENVSNWLNQLKTEGGFSVPSALFEAAQAEFES
FT                   ERVSNDETIAQIRSTYHSKTGGYILDPHSAIGVAASLRSIERNSGVSHISLSTAHPAKF
FT                   ASAVDLALRGQDGYDFTEVLPQEFIGLEDRESRVTAVGPGAGWQQVREIVKAEVEQELE
FT                   GKR"
FT   CDS_pept        complement(556761..>557150)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965914"
FT                   /orf_name="An16g02530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAL00477.1"
FT                   /db_xref="UniParc:UPI0000EFCF6B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R774"
FT                   /transl_table=1
FT                   /translation="GPSGVSPVSPGETAPSGVSPVSPGETAPSGVSPVTPGETAGPSGV
FT                   SPVSPGETAPSGVSPVSPGETAPSGVSPVTPGETAGPSGVSPVTPGETSAGATGVSPAF
FT                   TGAASSNMQPAAGFLAAVMGIMALL"
FT   gap             557151..557250
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(558410..558476),complement(558340..558346),
FT                   complement(<557251..558241))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900826"
FT                   /orf_name="An16g02540"
FT                   /product="Catalytic activity: Triacylglycerol + H(2)O [ "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /protein_id="CAK46784.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="HOGENOM:HBG267811"
FT                   /db_xref="UniParc:UPI0000EFCF6C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R775"
FT                   /transl_table=1
FT                   /translation="MVKGGVAFLAFAGPALAGVIARAWCGYWHGPPPPPPPIQFPTGTA
FT                   PQPKPTTSHGTAPIKPTTSIGTAPIRPTTSIGTAPIRPTTSIGTAPIRPTTSIGTAPIR
FT                   PTTSIGTAPIRPTTSIGTAPIRPTTSIGTAPIRPTTSIGTAPIRPTTSIGTAPIRPTTS
FT                   IGTAPIRPTTSQGTAPIRPTTSSGTAPIRPTTSSGTAPIRPTTSSGTAPIRPGTTETTV
FT                   GPIPTNGTTVIPPATVTTHTPVPIQNSTVIPTQSTQPPFQNTTVPVVPVVPTQSPQPPV
FT                   QNTTVPVVPVVPGQSTVPAVPGQSTVPGVPGQSTVPGVPGQSTVPGVPGQSTVPGVPGQ
FT                   STVPAVPGQSTVPGV"
FT   sig_peptide     complement(558414..558476)
FT                   /db_xref="UniProtKB/TrEMBL:A2R775 "
FT   CDS_pept        join(560038..560252,560312..560509,560567..561696)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900827"
FT                   /orf_name="An16g02550"
FT                   /product="Putative frameshift"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="CAK46785.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="UniParc:UPI0000EFCF6D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R776"
FT                   /transl_table=1
FT                   /translation="MPHSVSSQDSSAGRKDDELLPDAPPAETAPANQEANAASGVKLED
FT                   LFNDDDDDEYPASSAPETKNGASSAPEPAAAPGPQVDTDTMLAFYQRLFPFRYLFQWLN
FT                   HGIVPSPDFGNREFALTLQNDAYLRYQSYATADLFRKDILKMNPSRFEIGPVYNTNPRD
FT                   RKTLRGGQMKPIAKELVFDIDLTDYDDIRSCCEKANICSKCWAFVTMAMKVVDTALRED
FT                   FGFEHILWVYSGRRGAHAWVCDPRARNLPDDRRRAIAGYLDVIRGGNSSGKRVLKRPLH
FT                   PHMSRSLEILKPYFAQTTLVDQETFGSEQAQRLLSLLPDKGLNESLRKRWESSPDRSSA
FT                   NKWADIDALAKTGKSSTLNPTTLRDAKQDIVLEYTYPRLDSEVSKKMIHLLKSPFVIHP
FT                   GTGRVCVPIDARKAEQFDPLSVPTVSELLAEIDAWDAEHPSTNAGPEVADGEGSVPDSD
FT                   ARGSRRLQDYEKTSLKPYVDYFRSFIAGLLKEERTGKRERNDDATEVKTESMEF"
FT   CDS_pept        join(562087..562218,562288..563282,563345..563738)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200322" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965915"
FT                   /orf_name="An16g02560"
FT                   /product="Similarity"
FT                   /protein_id="CAK46786.1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR021860"
FT                   /db_xref="UniParc:UPI0000EFCF6E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R777"
FT                   /transl_table=1
FT                   /translation="MAADHTNTNPLDERFETLVQETLNYWHVPGISIAVVDGDNTWAKG
FT                   YGIATFPSEPVTPSTLFYAGSTTKAFTAALMATFVEDNDTHPQVHWDTPISHLIRDDFV
FT                   LHDEHTTEHTTIEDALSHRSGLPRHDQAYGNRLTRDKAVRTIVRQLRHLPLTAPPRTKL
FT                   QYCNLMYVVVSHVIETLTGGEWLGDTLARTIWQPLDMKSTFFDLNNAKASPHHLAHGYY
FT                   HTPSDKGSDSHYHEVPWMPLDEISGAGSIITNVLDYAKWARALLNQTEPLSPAVYKAIF
FT                   EPRTVLPPEAPFTGPRAYALGWYTGVYQGVQFFEHTGGMNAFGAEIILFPSLKYAVVML
FT                   ANTAGTSNYAQKALAFRLVDEKLGVPVERRFDWNAKNMAHIEEEKKKALDAIHKVPAHV
FT                   IPHSLDLHEYVGTYVHPGYQTVEIYLDRSKSTLRADRDRTTWPEYLSFKHVNGEHFLAI
FT                   SEHVGDLGAFFPDVYAAEFRIGEKGKPSALGVAWEKTMKEKIWFTRSD"
FT   CDS_pept        join(complement(565052..565250),complement(564753..564874),
FT                   complement(564631..564689),complement(564032..564558),
FT                   complement(563950..563975))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196042" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900828"
FT                   /orf_name="An16g02570"
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAK46787.1"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="HOGENOM:HBG328398"
FT                   /db_xref="InterPro:IPR003428"
FT                   /db_xref="UniParc:UPI0000EFCF6F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R778"
FT                   /transl_table=1
FT                   /translation="MMSLRTLARSVPRTISRSVAVSSRSAVSRPLSAVPKNAFQSSLKQ
FT                   ITRPSYAAFSTSRAFKQSPAEGDVELVAKLEDELKHEKASGLEDLESSVQNIQYVLQNN
FT                   SWEVKDVPGEQEVVLTKKFGNEEIRLTFTVADLQNLSEQEDFDDAALDEMDFGGHQPVN
FT                   QGRSGNVSQHSEDRVAPADREGDELDRDLEPSFPARVNITVEKPSNGALLIQTVAQDGL
FT                   FQIEEVSYFNKSDLAHAQTAEKDWTRQSMYAGPPFENLDEDLQTFLERYLDERGINAEL
FT                   ANMIPDYIQVKEQKEYVRWLENVKNFVSA"
FT   CDS_pept        join(complement(566164..566332),complement(566014..566098),
FT                   complement(565672..565939))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196054" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659922"
FT                   /orf_name="An16g02580"
FT                   /product="Similarity to hypothetical protein YOR252w -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAK46788.1"
FT                   /db_xref="HOGENOM:HBG328399"
FT                   /db_xref="InterPro:IPR021346"
FT                   /db_xref="UniParc:UPI0000EFCF70"
FT                   /db_xref="UniProtKB/TrEMBL:A2R779"
FT                   /transl_table=1
FT                   /translation="MPKTFQKVTKHIAKKRGAVEALHEFSRDARRLRRANARDDRVARV
FT                   SANMSRARQTYVERIAYFHESIPEGQAPMSEDEMKDIVVSVPEIEQLQSERRKGRPPSK
FT                   REEALLQRTDVENREFKTGFWMPDFSDEGVLKALASWNGDWSGLSTMKFIRITKDGAKQ
FT                   PSAFPPKGMS"
FT   CDS_pept        join(566780..566792,566851..566998,567055..569170)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900829"
FT                   /orf_name="An16g02590"
FT                   /EC_number="3.1.11.1"
FT                   /function="DNA binding"
FT                   /function="exodeoxyribonuclease I activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAK46789.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008852"
FT                   /db_xref="HOGENOM:HBG328400"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniParc:UPI0000EFCF71"
FT                   /db_xref="UniProtKB/TrEMBL:A2R780"
FT                   /transl_table=1
FT                   /translation="MGIKGLHGLLKSIQKPCHLKKFSGQTLGIDAYGWLHRGTVACAVD
FT                   LVLERPTRKHIDFVLNRVRMLLYFGVTPYLVFDGDELPSKAGTEVERQKRRQDSKALGL
FT                   ELQRKGRIAEAYQELQKAVDVTPLMARELIEELKKINVQYVVAPYEADAQLAYLERQGV
FT                   ISGIISEDSDLLVFGAKRLLSKLDQHGDCIEINRADFSACREVSLIGWTDDDFRRMCIL
FT                   SGCDYLPNIARLGLKTAYRSIRKYKNVERALRMLQFDGQYHVPSDYLDNFRQAELTFLY
FT                   QRVFCPKAGKLVTLTPPEAEIILEDLTFIGGDVEPDIAVGVARGDLDPTTKEPLVLKPS
FT                   LAAKPADKRLTNTISRRQTLGSSAELKPNKPINSFFTPKRVPLAELDPNSLSPSPSQQR
FT                   LLQRHANSSWDSVPAPSRPALIRSASSVGSSNRASSPLIRSVERNAFLAHASRTSNLQP
FT                   AKRQRLCSDAEEANLPNPPDCRSRFFSGSVDDSSPSAQKATRTKKARKSTLDVFSDDSA
FT                   EDLMTQLPDPSHATETPRVEIQIIGDNNSSISGRSIQTPAAATSGSGASESPAANCKDP
FT                   TEKQSFSTAEQASEKRSNAVDDSPTPDLVPNANSATLSKYVFQAGNVSVSPRNDKHGGK
FT                   GHQSGSLDEHMVPTGVRHGLLGHSPRRQRTTPLQRLGQSALARSRSLNCVSPSLAAFRA
FT                   SETPTKSPAVAKLDSNPVRSLATPSQGSEDMIIPDSEDEESEGETQAPVGLASFDVRRF
FT                   SFMGK"
FT   CDS_pept        join(571029..571056,571122..571190,571243..571832)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208899" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900830"
FT                   /orf_name="An16g02595"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46790.1"
FT                   /db_xref="UniParc:UPI0000EFCF72"
FT                   /db_xref="UniProtKB/TrEMBL:A2R781"
FT                   /transl_table=1
FT                   /translation="MPGITAKLPRVLQLVGYHHVLMIIIAVAIILLSLLLAGCSSSSPQ
FT                   IPDIFLISMYYERYKPTFNLAQVDPGVVTATANIVGGAEMEVRVGYFGICVQPDAGSYI
FT                   CNSNATALAEIVTVDQDPLNLIWVASTFKDAVVFPYLLYALIFPPQQGVLTDCCNPEFL
FT                   PSSSLSSASSFSPPSLDGTTSWTPAVPKSKPDRSHRGLYPKQHXPXLLWPRSSFLSQYY
FT                   GSTPHP"
FT   CDS_pept        join(complement(574467..574787),complement(574210..574396),
FT                   complement(573643..574139),complement(572973..573574),
FT                   complement(572747..572785),complement(572629..572671))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900831"
FT                   /orf_name="An16g02610"
FT                   /product="Function: S. cerevisiae Flr1p is a multiple drug
FT                   resistance"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK46791.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCF73"
FT                   /db_xref="UniProtKB/TrEMBL:A2R782"
FT                   /transl_table=1
FT                   /translation="METIRDSAFGKLVRIFSRKRWLRYPEENDTGMWTEYLKTEKQVKD
FT                   EEAAASESDQENLGLYTVLSQASRASRRLSSASTVRQGGGEGAHPNLNASLVIDWSGPD
FT                   DPENPQNWSTFKKLFASSLIWLLTFAIYIGSAIYTPGIPDVCEQFGVSRVAATLGLTLF
FT                   VLGYGLGPMVWSPLSELPPVGRSPTYVLTLFVFVFFQFAVIYATNFGMLLAFRFLTGFI
FT                   GSPALATGAASMGDIWNPKMRDYMIIIWGAFAISAPVLGPLVGGFAAQAEGWKWTIWQL
FT                   LWVSGFAFVLLFFFLPETYAPNILYRRARRVRQITGNSNYRCEAEIEVANMKKADIIFE
FT                   ALVRPFELCFFEPIVLIMNLYIALIYGILYIWFEAFPIVFSEIHGFNTGESGLAFLGIL
FT                   VSTCCITIPCYFWWKWKYQAKYFDENWNITPEMQLPPACIGCFALPISLFWFGWTGQFA
FT                   SVHWIVPIIASMLFSVGGCLIFNCIFCYQAHAYPKYAASVLAGNDFLRSSFGAGFPLFA
FT                   TAMFHNLGVGWACTLLGCFALYKSISFIYTRSIVYCAFAFAFTYI"
FT   CDS_pept        join(complement(575384..575473),complement(574882..575031))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965916"
FT                   /orf_name="An16g02620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46792.1"
FT                   /db_xref="UniParc:UPI0000EFCF74"
FT                   /db_xref="UniProtKB/TrEMBL:A2R783"
FT                   /transl_table=1
FT                   /translation="MGRELRFARVPLRIFAVGMWMLNELGSPVVVLPSDIRLYDRHYGY
FT                   SSGREGPSPVKLALEFIDQRTALIAADCHWISFL"
FT   mat_peptide     join(complement(575384..575395),complement(574885..575031))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R783 "
FT   sig_peptide     complement(575396..575473)
FT                   /db_xref="UniProtKB/TrEMBL:A2R783 "
FT   CDS_pept        join(complement(576001..576057),complement(575674..575736),
FT                   complement(575515..575580))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900832"
FT                   /orf_name="An16g02630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46793.1"
FT                   /db_xref="UniParc:UPI0000EFCF75"
FT                   /db_xref="UniProtKB/TrEMBL:A2R784"
FT                   /transl_table=1
FT                   /translation="MAMFCYAPDQVGIYSRSRPTFLWALIALLPACKNADVRREVEATG
FT                   MMGNLIHWQEPSPKAC"
FT   mat_peptide     join(complement(575674..575691),complement(575518..575580))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R784 "
FT   sig_peptide     join(complement(576001..576057),complement(575692..575736))
FT                   /db_xref="UniProtKB/TrEMBL:A2R784 "
FT   CDS_pept        join(578456..578608,578671..578874,578938..578988,
FT                   579048..579668,579976..580702,581324..581832)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659923"
FT                   /orf_name="An16g02640"
FT                   /product="Similarity to hypothetical protein MTH632 -
FT                   Methanobacterium thermoautotrophicum "
FT                   /function="ATP binding"
FT                   /protein_id="CAK46794.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI0000EFCFA4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R785"
FT                   /transl_table=1
FT                   /translation="MAGNHHPQAPTPTTLPENDQSHLCGYYFDQRNESSVVHVPSAQDD
FT                   FWFQSQPLSGSLLKRLNSIQLITSSYDDHDNVSDVSGTNRSWFELSIFRENAEAQNGHR
FT                   WMSHENRFGTNALQYHKGRVFTRHSEILKLLKDGDRIGVHAAAVQSDSNNYRQNGILIY
FT                   GICCKGHEQPLQDSVLRKMLRMDERDPNAHSTFEYLSDKTTDQVEDEIKGDGENPIVAR
FT                   MKWEDTNKFATLATEAKVKRKNVLLLLDAEDLPESTNIDRRLSWGQTVENIWKCKMKEL
FT                   CNAIWQAPENNYFHFLVQLGLEGAIYKGFQENATQAHLIYEPTSAKGGFLRSYSDKDME
FT                   NLNERPSNPSPPTTSWSLETDSEPVLVSVELDLANAETTSRVPLVLKSLPCSPQKAAQD
FT                   TLIQGFECVLPYMPSARFGNLITADRGEVDGFRKIANMVHEWYLSNDESKPLSIAVFGQ
FT                   PGSGKSFGVKEVIKSILAADGKGITDLEFNLSQFREETDLRHAFEVIRGKALSREVPIV
FT                   FFDEFDSTFQERELGWLPHFIKPIKEGKYKDGAVERPLGRGIYIFIGGTKTNHDDFFKS
FT                   LSNGDDSGGDPHRKVKEDFRTALKGYVDILGPSQLGDQDMNYFPIRRAILLRSMLERIF
FT                   KFAKGKPIEMDTGVRNALLFTPTVLHGARSLESILSMSKINAGNPIKVNDICKEDQRKL
FT                   HVKDPKFEQYLNGKINPPNAERDEQHYAWIERKSGRAYKPRPVVHFDPTTTSAVSGSAS
FT                   G"
FT   CDS_pept        join(complement(584234..584315),complement(584127..584174),
FT                   complement(583891..584072),complement(583567..583835),
FT                   complement(582442..583513))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900833"
FT                   /orf_name="An16g02650"
FT                   /protein_id="CAK46795.1"
FT                   /db_xref="HOGENOM:HBG324075"
FT                   /db_xref="InterPro:IPR018812"
FT                   /db_xref="UniParc:UPI0000EFCFA5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R786"
FT                   /transl_table=1
FT                   /translation="MRVQAHGAPARTITSLRRWSIANRELPAVSHIRSIHVYDFDNTLF
FT                   LSPLPNPQLWNGPTIGFLQAYESFANGGWWHDPNLLAATGDGIDKEEPRAWEGWWNEQI
FT                   VQLVKLSMEQKDALTVLLTGRGETNFSDLVRRMVDSKKLEFDLICLKPEVGPRSQRFST
FT                   TMEFKQTFLEDLVLTYDQAEEIRVYEDRVKHVKAFRDYFEQLNRRFQAPNSGRRPIGSE
FT                   VIQVAEGSMYLAPVMETAEVQRMINSHNLTIRNPSLNLAKSPYGRLRIKRTIFYTGYLI
FT                   SNADSGRLIRQILNPMLPFGHADSNDLKYMANSILITPRPAPRSILDKVGGIGKKLSWQ
FT                   VTGTACFENRVWAARLTPVPATEKYYTENPHPVVVLAVRKGARPIDAGKIQNWHPVPAD
FT                   KALTFETVVGEKVVLRVEEENPNEGEWESQFLNKNHKRRHQQERDEEILYPDGTQDGPP
FT                   HSRPHFNPRYGGNNRNHHDDGPRRGGSYRGRGRGSAQRGRGHQNRGGTRGRGRGRDAGP
FT                   PGGYRSLDDYGGGYDGNHYEEKPGPGGGPVMNY"
FT   CDS_pept        join(585038..585245,585307..586165,586268..586295)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900834"
FT                   /orf_name="An16g02660"
FT                   /product="Similarity to hypothetical RING finger protein -
FT                   Schizosaccharomyces pombe"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK46796.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG328406"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0000EFCFA6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R787"
FT                   /transl_table=1
FT                   /translation="MSDDVDLQQEILQRTLQEVAHDEGEHDANPCVICLEPISEAAIAV
FT                   PCRHANFDFLCLLSWLEQRRNCPLCKSEITSVKYNLEDINGPKIYQLPASTSDTTSTSS
FT                   TSHLPTPSHHRPPRRPRRPRSPRPQQQQQSTDPLRRRQHIYRHQLYSLRVGSNRLSQYR
FT                   ELTPERFNREEDLVSRARKWIRRELQVFEFLNPESEDRQGGGVARPGQQRLENRRGNNA
FT                   EFLLEYIIAILRTVDIKGSAGQAEELLRDFLGRENARLFLHELQAWLRSPYISLEDWDR
FT                   NVQYEDTVGSGGNAHPSRREREESRTATPVYRDNRGPRFPNSSGRVNKPPYHRRGGRSS
FT                   RDAVAQARRVQYARDRSSDMVSQV"
FT   CDS_pept        join(complement(588008..588149),complement(586411..587942))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196120" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900835"
FT                   /orf_name="An16g02670"
FT                   /product="Similarity to hypothetical protein SPAC6B12.11 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK46797.1"
FT                   /db_xref="HOGENOM:HBG328407"
FT                   /db_xref="InterPro:IPR021110"
FT                   /db_xref="UniParc:UPI0000EFCFA7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R788"
FT                   /transl_table=1
FT                   /translation="MATVMAPEMATQSASLRAELKEWERAFADANGGRKAERSDIKKVP
FT                   EIAAKYKEYSRLKALETSSSTTKTDKNPVQLEERPKKRKHTSPNGPSTSLTTSTPRKTA
FT                   KGAAAFETPSKSRPVATSHPSEVDPYDSPSVLRRLFSPSTHQTPLKTAIGPTPQRDGKA
FT                   LGLFDLLSESGGSTATPSATRIASLRDTAVQTPSRRRKQLDTIAEEGEDEDDDEDDNSP
FT                   RGARTPASSGKKWMLSTLFATPTTWRYAMMENENQGPRYPAYIRTDDTASKQTESHAGP
FT                   NAEETPSFLRRATATRYNPNNNAADDGGLSPIAVRKRPQFVGKGLSALVQGLRDMEEEQ
FT                   MQDDMDILHEIEAEQQQQAAGTITDSQTQQQYPPTEESRPFKKKGQKRTTRKVRMKPVT
FT                   AKPKPEPQLPASDNEEEEEDNEADIVPETQHLNIPGTETHDTDDELNSIHSISGSEPDL
FT                   DPDYDYDEEEEALSKPPARSKSFSERMKEAIEADKPQAREKEQEHTEKEKKKTKSKAQT
FT                   QTQTQPRARKVNPAAHANYRSLKLRNRGSKGRYGGRFGRR"
FT   CDS_pept        complement(588659..589591)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900836"
FT                   /orf_name="An16g02680"
FT                   /product="Similarity to hypothetical protein YBR151w -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAK46798.1"
FT                   /db_xref="HOGENOM:HBG324680"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000EFCFA8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R789"
FT                   /transl_table=1
FT                   /translation="MFRSLLSRGGLIRNDSYIFPTVDPTEDGPDCKRDCADCTVQFPSK
FT                   VKVETSKPLYGHIKEFHTHVLVATGKSDWTEKVENEKGSLMQAFDESAHLSKHGVCLPR
FT                   NLSSLKVPANRNERFMISASNLTPPETDDETNQGTTVLLLPSFTFIDAVKQSDVNEVIT
FT                   RFMDAPLSQNGAIPANPESKLNPRPCEYDYVVLLCSHKRRDARCGITAPLIKKELERHL
FT                   RPLGLYRDANDERPGGVGIFFVSHVGGHKFSANVLIYRKEQQQMIWLARIRPEHCEGLV
FT                   KYTLLEGKVVHPETQLRGGFDRARGLTSW"
FT   CDS_pept        join(589866..590027,590147..590275,590599..590676,
FT                   590775..590879)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659924"
FT                   /orf_name="An16g02690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46799.1"
FT                   /db_xref="UniParc:UPI0000EFCFA9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R790"
FT                   /transl_table=1
FT                   /translation="MAPVRSDRWHSVCVKYSVVKVNSPIRGEKLSETEILQPTSGSLFA
FT                   VRFTRLAMADYLHWSSMELKYSSVNPLVEITPGGVLLSPTSGHSPSSLVKLIGVAATSA
FT                   VIIRQCPRFTADTTRQLDKGRSETHPGEAARFGEKGRWAKHVSPATSLLLLLI"
FT   CDS_pept        join(591152..591811,591911..593189,593241..593542,
FT                   593607..593693,593756..593833)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196142" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900837"
FT                   /orf_name="An16g02700"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46800.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG328409"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCFAA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R791"
FT                   /transl_table=1
FT                   /translation="MADFHQQQPLGAAVAAPPDHEPPPEQQRVRKRRRRTMACMQCRSR
FT                   KLRCDREYPVCSRCQKSKTPNKCTYEDGFLWQQPNTVASPVFSERGPTTTVQMPQADRA
FT                   TAHPTPDSGISSLASRCHPSHPVEEKRDKFLETVLGAPKAAVNQEPYVNTELLQRPRHP
FT                   PESHHHSNNSQPYPDDNDETPTSPSQQLDVSPRIMMRGKETKTRFNGSGIFANLIAQFP
FT                   DLRSFAEEIRQASPHLSALRPDLMRVRKGVWKKKPLNTPFPTPTTSSLIPMLPSRAVVD
FT                   ELVTLYCTYIESTHRILHIPSFLNELETFWAQRESPDMVSPIFVVQLLLVLSCAWNLAD
FT                   FQTLQMKSEGHLQCYTAVEWVLHAEKWMENAHIKRPELTSLRLNTLLIIALNIHGMKRS
FT                   QAWLATGTLVKQAMMAGYHRDPTRYSRISVFNMEMRRRIWTTIVEIDLQVSLERGMPPS
FT                   IQEADYDTAPALNINDDEIHEDSTELPTAKPLDVMTDCSFQAVLVQSLSLRLKACALMH
FT                   SPRISCRYEDILHFDFELNRHLSKIPTWPTSDVDNFQTAHRGILIRAMLENKIGHSLLS
FT                   IHTPFAIEAPKDSLFTPSARARLEVASMILSTQRRLRETSQRLSLCNMGDWTMQAYCTI
FT                   CELLHQGQITNGASTFLTRTLPGLPESLISLVEVVLTCLESRLLLVVKGAKEYFFMSTI
FT                   VALVKVGLWPSQAQIYKQEVVERVILFAQTLFTRHANCAHLGEWGLGNFKTNQVPSLNA
FT                   NPGLAPPFVPDVSMGQTPQFGMMPPGGDLDPFLDAFDWGDLTGFTLQQ"
FT   CDS_pept        join(594040..594195,594448..594538,594627..594736)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18116922"
FT                   /orf_name="An16g02710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46801.1"
FT                   /db_xref="UniParc:UPI0000EFCFAB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R792"
FT                   /transl_table=1
FT                   /translation="MAIIGHIHFVIIDVNNKSLYTTAEPSFVYTTGKVDRGIDSPDRDA
FT                   DRMISELKLSSRDVRSAKRVTTVELTSGSAAIRPSNPGDSALLFPFEESASIRWFSVAL
FT                   HRISLNAVFYRARG"
FT   CDS_pept        join(complement(595885..595943),complement(595711..595791),
FT                   complement(595481..595642),complement(595305..595410),
FT                   complement(594861..595067))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900838"
FT                   /orf_name="An16g02720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46802.1"
FT                   /db_xref="UniParc:UPI0000EFCFAC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R793"
FT                   /transl_table=1
FT                   /translation="MRVLELEDKADRDAELDQAAADAQNSPLRFGPRGCGSKIKRLKSV
FT                   CKADGITTKHVTSDKVGEKSRFAHDGNRSKNRPSQAFALTFTPTRYTEYHYRSHRLSRS
FT                   PTAGHDPACSALRRSSYRQYRIDRTEDTTAAKEESTVPHNASNCIILPATFEKWPRGRG
FT                   VEKPAASCAVSLYSLYRVGYFYRVSATHRVYYYLGDSDSDS"
FT   CDS_pept        join(596168..596964,597018..597205,597256..597284,
FT                   597336..597422)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000292006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900839"
FT                   /orf_name="An16g02730"
FT                   /EC_number="3.2.1.99"
FT                   /function="arabinan endo-1,5-alpha-L-arabinosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK46803.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0046558"
FT                   /db_xref="HOGENOM:HBG346382"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016840"
FT                   /db_xref="UniParc:UPI0000591332"
FT                   /db_xref="UniProtKB/TrEMBL:A2R794"
FT                   /transl_table=1
FT                   /translation="MLPSLLSVLFFLLYAVNAVPLAPRASALAGIDTKSFSKTKDYPLP
FT                   NLGNIVAHDPNVIQHDGYFYLYKGGVHIPIHRARSLSGPWEQVGTVLDDSSVIPKQNRS
FT                   RPWAPTTIQHDNRFYCFYAISENGSRDSAIGVASSDTPVGGNWTDHGAVVNTGKGDLSD
FT                   IYPYSVSNAIDGAFITDQQTGQSHLLYGSYWHGIFSVPLADDLLSVKTPKTPNATNLAY
FT                   IPDAKSKPIEGSFMTYKAPYYYLWFSHGKCCHFDIHAFPPMGDEYNIRVGRSKSATGPF
FT                   VDKDGHDTLKGGGTIVYGSNHGIVYAPGGVGVLINNGSEADVLYYHYLNTTSGFAQGDA
FT                   HLGWNYLHYVNGWPVAVEGYVNANGK"
FT   sig_peptide     596168..596221
FT                   /db_xref="UniProtKB/TrEMBL:A2R794 "
FT   mat_peptide     join(596222..596964,597018..597205,597256..597284,
FT                   597336..597419)
FT                   /db_xref="UniProtKB/TrEMBL:A2R794 "
FT   gap             597557..597656
FT                   /estimated_length="unknown"
FT   CDS_pept        join(599049..599165,599255..599350,599492..600087,
FT                   600169..600364)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235001" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900840"
FT                   /orf_name="An16g02740"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An15g02580 - Aspergillus niger"
FT                   /protein_id="CAK48584.1"
FT                   /db_xref="HOGENOM:HBG327917"
FT                   /db_xref="UniParc:UPI0000EFCFAD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R795"
FT                   /transl_table=1
FT                   /translation="MSQPMSEVSWPAGIPQIRLHLTDLDPEELAEEAKGWLLFEESHPT
FT                   SNTEDALRQRRALIETWATASQEFRESYHSRSVGYTSAVDYPAQVLSQLAPRPNKRFLC
FT                   LAPINRKTHPRSYIHLVKFLILLYVHQDEWSRRHPFDLRGAGDAPRCHIPELLGCPPAA
FT                   TATTTLSEVLPALYLAPADYRAISMTRQGTVVFADGPDLTWFVIDAPGLATGRLTLVEY
FT                   GSNGDVRVSTLRRPWNMGQTMTFEQVLGKDLDEIAESGIGGPPQYNEPLDMNLPILELL
FT                   ESTRLNNKFLFPGYGCRDLWVRIIEQSAPGYLELEAQGREVEFELDDLLVVDP"
FT   CDS_pept        join(complement(601858..602105),complement(601421..601766),
FT                   complement(601097..601381))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900841"
FT                   /orf_name="An16g02750"
FT                   /EC_number="2.5.-.-"
FT                   /function="prenyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK48585.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG325736"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniParc:UPI0000EFCFAE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R796"
FT                   /transl_table=1
FT                   /translation="MDVAGKLIPETNMLDDYTHKRFRAIWEMGRLHTREAWLSVIPAVW
FT                   GASIGAKAGWTDGWSFAWVLFGIWASATVSHAAFCTWKQVERCKGRPLPSGLISVKEAT
FT                   FFFLCWILLTLGTTWYTLGPQATLCTTPAWLLGLIYPFMKRVMPFPQLVVGLSVASGVM
FT                   PGYVSVRGILEFNGSVLALFGATACWIIFLDTAYASLAVFLGKRVRMFLALAAVITIAF
FT                   FSTAALLSNLSLFTWIFGVGVWAASMIRSIFLLDLNVCASGGRVFKSNIEPGFYLTVVT
FT                   LVEGYLQACFS"
FT   CDS_pept        join(complement(605947..606088),complement(605803..605885),
FT                   complement(605483..605739),complement(604566..605432),
FT                   complement(604279..604510),complement(603444..604244))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000235039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659925"
FT                   /gene_name="afcA"
FT                   /orf_name="An16g02760"
FT                   /product="Probable alpha-fucosidase A "
FT                   /EC_number="3.2.1.51"
FT                   /function="alpha-L-fucosidase activity"
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK48586.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0004560"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="UniParc:UPI0000EFCFAF"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R797"
FT                   /transl_table=1
FT                   /translation="MLISGSSAALCALALPFAAAKSLWSDSPGNYSSFITTAFPLGNGR
FT                   LGAMPIGSYDKEIVNLNVDSLWRGGPFESPTYSGGNPNVSKAGALPGIREWIFQNGTGN
FT                   VSALLGEYPYYGSYQVLANLTIDMGELSDIDGYRRNLDLDSAVYSDHFSTGETYIEREA
FT                   FCSYPDNVCVYRLSSNSSLPEITFGLENQLTSPAPNVSCHGNSISLYGQTYPVIGMIYN
FT                   ARVTVVVPGSSNTTDLCSSSTVKVPEGEKEVFLVFAADTNYEASNGNSKASFSFKGENP
FT                   YMKVLQTATNAAKKSYSALKSSHVKDYQGVFNKFTLTLPDPNGSADRPTTELLSSYSQP
FT                   GDPYVENLLFDYGRYLFISSSRPGSLPPNLQGLWTESYSPAWSGDYHANINLQMNHWAV
FT                   DQTGLGELTEPLWTYMAETWMPRGAETAELLYGTSEGWVTHDEMNTFGHTAMKDVAQWA
FT                   DYPATNAWMSHHVWDHFDYSQDSAWYRETGYPILKGAAQFWLSQLVKDEYFKDGTLVVN
FT                   PCNSPEHGPTLTPQTFGCTHYQQLIWELFDHVLQGWTASGDDDTSFKNAITSKFSTLDP
FT                   GIHIGSWGQIQEWKLDIDVKNDTHRHLSNLYGWYPGYIISSVHGSNKTITDAVETTLYS
FT                   RGTGVEDSNTGWAKVWRSACWALLNVTDEAYSELSLAIQDNFAENGFDMYSGSPPFQID
FT                   ANFGLVGAMVQMLIRDSDRSSADASAGKTQDVLLGPAIPAAWGGGSVGGLRLRGGGVVS
FT                   FSWNDSGVVDSCKADLSARGSDVSQVKFYVAGGRAIDCSS"
FT   mat_peptide     join(complement(605947..606028),complement(605803..605885),
FT                   complement(605483..605739),complement(604566..605432),
FT                   complement(604279..604510),complement(603447..604244))
FT                   /product="Probable alpha-fucosidase A "
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R797 "
FT   sig_peptide     complement(606029..606088)
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R797 "
FT   CDS_pept        join(complement(608093..608226),complement(607430..608012),
FT                   complement(607009..607377),complement(606603..606947))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965917"
FT                   /orf_name="An16g02770"
FT                   /EC_number="1.14.-.-"
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK48587.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG328414"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI0000EFCFB0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R798"
FT                   /transl_table=1
FT                   /translation="MSPIKSVAVIGTGPAGAIAVDALMQEKAFDRVRVFERQEKAGGCW
FT                   VSRNEKQVPLDVDKLSARTADAPIPIPTQFPASTPALAQHRYTDSHIYPNLHTNVDAST
FT                   MEYSQESIPAIRSEMSIALHGPDTPFRHHTVIRQYIEDLLNRNGYQDLVEYNTTVERAV
FT                   KDPKTGKWELILRRAGKPGGYDYWWSESFDALVVASGHYSVPFIPSIPGLKEWIDKYPE
FT                   NVLHTKQYRGPERYRGKKVVTVGASVSAADTAVSLIGSAQSPIHAVVRGRYNPYFGDWA
FT                   FRHPSISRKPPISRVESGNGQRTVYFEDGTSVSDVDYIIFGTGFTWALPYLPDIPTRNN
FT                   RVPDLYLHIFHQSDPTLAFLGAVGAGLTFKIFEWQAVAAARVLAGKAQLPPLEEQQKWE
FT                   QDRIAKKGDGPAFSTINPDFREYFETLRQLAGEPKAGEPGRVLPPFEQEWLDVFNAGHE
FT                   RRIRMWQKANEAAAKSKL"
FT   CDS_pept        join(complement(609278..609341),complement(608926..609075),
FT                   complement(608762..608872),complement(608546..608604))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965918"
FT                   /orf_name="An16g02780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48588.1"
FT                   /db_xref="UniParc:UPI0000EFCFB1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R799"
FT                   /transl_table=1
FT                   /translation="MPEDDSHSGGTGLAMMNLLRQAQRLAAGFVEPHYVHASEMLAPLP
FT                   GANIAWCTITRGSANPTRNHLCLPAHFEYKKNNQRALILRIAPHGLVSCDPRIALERVS
FT                   ESFREAEMDQSASRMRKNAIIEK"
FT   CDS_pept        join(609747..609772,609858..609933,610030..610131,
FT                   610302..610367,610498..610549,610633..610681,6
FT                   10742..610904)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900842"
FT                   /orf_name="An16g02790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48589.1"
FT                   /db_xref="UniParc:UPI0000EFCFB2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A0"
FT                   /transl_table=1
FT                   /translation="MAYLDIGGLESIHPRVEHAIRVPKAYVVISQLRYGTWHTVTAQLT
FT                   LVGGMNMKLKAQQLDLRDLYCIETKCLLPGGFPMIAIYSEASPAQGILIERRDFLLDCF
FT                   GHESIQKGGRVFEQYAASERHSGWERNPPIDPGTAPHLPVPKLFFFLSLRDRSSRSFGN
FT                   DIVLASHVLDPDGG"
FT   CDS_pept        join(complement(611808..611835),complement(611669..611758),
FT                   complement(611523..611629),complement(611111..611413))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812751"
FT                   /orf_name="An16g02800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48590.1"
FT                   /db_xref="UniParc:UPI0000EFCFB3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A1"
FT                   /transl_table=1
FT                   /translation="MGIRRAVHEARTQDDASNNLLLWDKTNIEPLHEQVCFGAGILKHW
FT                   RARGFCPRQKLIDAPKNEAEPLKPRNGPILGLGGKPKSPASPCPCWRNSQPGEPWVESR
FT                   LSERPWIMQAPIGANNCNRVPDQRFKHPGHLISARGTLWPVASALTLSLKSSRSIGICI
FT                   ESPCGRCQRVLG"
FT   CDS_pept        612024..613319
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900843"
FT                   /orf_name="An16g02810"
FT                   /product="Remark: there are nucleoporins with different
FT                   length matching to this ORF."
FT                   /protein_id="CAK48591.1"
FT                   /db_xref="UniParc:UPI0000EFCFE0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A2"
FT                   /transl_table=1
FT                   /translation="MKFQHVAPVCLAGCALALPTPVEKRQDLSDLLPFPIPSNLIPTGL
FT                   SLPSGLSLPSGLPSFSLPTDLSDLGLKRRDLPFSLPSGAALPTDSKGLSQLLPSGLPDL
FT                   SDLGITLPTGLPFEKRQFGGGGPSLGGGSGGPSSSPFGGLSGLGDGDSSSGSSSSSPFG
FT                   SLPSLGGGGGDSSSSPFGGLPGLGGGDSSQSSGSPSPSSSSSSSSGGLPDFLNGLGGSS
FT                   SDSSSSAQPSSGSPLGGLSGILGSLGGDSSQSSSGPSSSSQPSSSDGLSGLPDFLKPFL
FT                   GGGSSSSSSAGDSSSPSLPSGGSNPFGGSSQPQPSSGAAAPSQPSGGFPNPFGGSSSSS
FT                   DSSSPAQPSGAFPSISLPEPAGSSSSSDSSDSSSSASESEPSLSLPTPLAFSPGGLNIP
FT                   APSSSSAIPTSSAIPPSGAVPTAPSSFKQFMA"
FT   sig_peptide     612024..612074
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A2 "
FT   mat_peptide     612075..613316
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A2 "
FT   CDS_pept        join(complement(617431..617551),complement(617043..617288),
FT                   complement(616538..616978),complement(615488..616474),
FT                   complement(613900..615419))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659926"
FT                   /orf_name="An16g02820"
FT                   /function="FMN binding"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK48592.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG334751"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR015702"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023206"
FT                   /db_xref="UniParc:UPI0000EFCFE1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A3"
FT                   /transl_table=1
FT                   /translation="MGSVKPVPIPGPKGVPFLGNVYDIDQEMPVRSFELMADQYGPIYR
FT                   LTTFGLSRVVVSTQELVDEVCNEERFAKSVDGGLGQLRNLLHDGLFTARYPGEENWALA
FT                   HRVLIPAFGPLSIRGMFDEMQDIANQLVMKWARQGPETPIVVTEDFTRLTLDSIALCAM
FT                   GTRFNSFYHDSMHPFVEAMVGGMQVASYRAQRPSFLNQLPTSENNAFWNDISYMRNLAK
FT                   ELIEDRRKHPSDKKDLLNALILGRDPQSGKGLSDESIIDNMITFLIAGHETTSGMLSFV
FT                   FYYLLKNAHAYKKAQEEVDRVIGRRKITVDDLSKLPYINAVMREALRLNPPASVMRVHA
FT                   HPTKNKEDPVTLGNGRYVLNKDEPITVLLPKLHRDPKVYGADAEEFKPERMLDENFNSL
FT                   PRNSWKPFGNGMRGCIGRPFAWQEGLLAIALLLQNFNFQLDDPSYDLRIKQTLTIKPKD
FT                   FKMRATLRHGLDPITLEPALNSGSVPRESSTVASRERKKDAALSEGDMKPMHIFFGSNT
FT                   GTCEALARRLADDAVAWGFSAKVNSLDSATENVPKGDPVVFIAASYEGQPADNAAHFFE
FT                   WLSAANDNELEGINYAVFGCGHHDWTATFYRIPKAINELVKEHGGNRLCDIGLVDTAIA
FT                   DMFTDFDNWSESALWPAISSKFGSKSQGQAGKKASSGLQVELSSEKRVTTLGLQLQEGY
FT                   VIENKLLTAPDVSAKRLVRIKLPSDMTYQCGDYLAVLPVNPTSIVRRAMRRFKLPWDAF
FT                   LTVRKSSQTQNGPSAIPTDTPISAFALLSSYVELSQPASKRDLTALADAAVADEESQAE
FT                   LRYMANSPSRFNEEVVTKRLSLLDILDRYPSIGLPLGDFLAMLPPMRVRQYSISSSPLT
FT                   DPTECSITVSVLNAPSLSGTDEPYMGVASTYLSILQADERIHIAVRPSHSGFKPPADLN
FT                   TPMIMACAGSGLGPFRGFVMDRAEKILSRSDSITEKPAPAILYVGCRTKGKDDIHAEEL
FT                   AEWSRQGIVDVRWAYSRPSDGSVAQHIQDRITSDRDEVVSLFEQGARIYVCGSAEVGKA
FT                   VRQAFKNIYVDVKQERRRVALETKQEEVPSEVNDEDVEKFFDDLKASMRYATDVFT"
FT   CDS_pept        join(617809..617937,618075..618212)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900844"
FT                   /orf_name="An16g02830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48593.1"
FT                   /db_xref="UniParc:UPI0000EFCFE2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A4"
FT                   /transl_table=1
FT                   /translation="MERHHSTPSYAKGIPQSEGRPSAYQDNHRGERHGADESGSWSFQR
FT                   NAYDPSTGKSDSGLGDHGPMPEVDSRSNDPWILSVMPLIRFGE"
FT   tRNA            618268..618339
FT                   /gene_name="tRNA-Arg (CCG)"
FT   CDS_pept        join(complement(619516..620312),complement(619154..619448))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900845"
FT                   /orf_name="An16g02850"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK48594.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG592277"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI0000EFCFE3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A5"
FT                   /transl_table=1
FT                   /translation="MSLFHVLALLVASLNLVTAQTFTNCNPLNETCPADAALGTNHTWY
FT                   FNTTVDDTIWNVTNGNIGITDEGAEFSIAQKMDSPTMQSNFFIFFGIVESHVKMAKGGG
FT                   VVSSVVLQSDDLDEIDWEWVGYNTSEVQSNYFGKGNDTSFDRGGFHYVPNADTEFHNYT
FT                   TYWTSEKVEWWIDQQLVRTLKYEDAVGGKNFPQTPSNIRFGIWPAGDPSQPHGTIVWAG
FT                   GEIDYSAGPYTMVVQKVRVHDFHTGKEYSYSDHSGSWESIKVVSGNSTTVEQLNKPPPK
FT                   SLSERWNELPSGAKAGIGIGIAAVGASCLAGFIFFCLKQRKRGRLEHALNDAQWNSERT
FT                   EMNNFQAEWKQSEWKHKGYQPVS"
FT   mat_peptide     join(complement(619516..620255),complement(619157..619448))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A5 "
FT   sig_peptide     complement(620256..620312)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A5 "
FT   CDS_pept        join(complement(623539..623544),complement(623128..623257),
FT                   complement(623010..623105),complement(622107..622770),
FT                   complement(621858..622056),complement(621655..621759))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900846"
FT                   /orf_name="An16g02860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48595.1"
FT                   /db_xref="UniParc:UPI0000EFCFE4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A6"
FT                   /transl_table=1
FT                   /translation="MTDSPGSRCIQWDRCNHGIQGSNPMGWEFPERSRALNIPRFRKSH
FT                   VREVVTCRSTMSSGFQMADYGKRGVVVWLTSTTIADTLTIPASTLSLGFLDLPLKIRNT
FT                   IYNHVLVIPHPLHIFQDPGCSLEVFAPERPCSWLALTYVNRQISDETRKILYSMNRFIF
FT                   QEMETARRQGTLLESFLICIGSSNSRVLSHLCINFPAIERLPGLSSEARLTEDGLRRLQ
FT                   LLRQSCTGLKTLEILIFGHFANILVADHQLIDKSFRNIILEVDAQIRGITPLEAIVVRI
FT                   VYSRGIPAAVRGYLQGLGMGEMEHSRNHNLPNTQFLRSSLVNCLKLMAGLLRTLDCVSS
FT                   ERALSPKKGAWNFSHWSWADYLLNEFGILASRSSERLLAVGKECLANPKLQTLHKLGGR
FT                   "
FT   CDS_pept        623978..625261
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900847"
FT                   /orf_name="An16g02870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48596.1"
FT                   /db_xref="UniParc:UPI0000EFCFE5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A7"
FT                   /transl_table=1
FT                   /translation="MDNKPVPDKLSELYNTLLSRRASNEHKDWELTITALELLAVTHRP
FT                   FSILELSWAVTLHTSRHVTTVDYLSKLVDHQKLLSLIQPFIACVEPSNLRRYQVQLIYQ
FT                   SMKELILRRWEPNATYSGSPASERDDGQRFGGPEALILDICIRYLLLTEIDDQYLFSEE
FT                   QIAMSELPQESDLFNDEKEPAKYDTHCSWEAWEEDMIQFNPAELGLGEFFVYASCYWLK
FT                   YYSLVTAEALPNLASIEKLCRANSIRIRNWTQQNRRPGCAMPPRFQFDSQLYDPLSITC
FT                   LYGSVDMLHVMLRGSDFDNNHFLNMTAINAADQILQWGDMSRLSTLFLDPRLGHQLRNL
FT                   DFFRLIIRRWRESSVSRPDWDDAFALIDLATDQMVQQQWGLELLCVAASAGCAPVAQRL
FT                   LSGARHNEGLRRELLRQFPLMPQVAPLK"
FT   CDS_pept        join(625951..625985,626041..626686)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000156894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659927"
FT                   /orf_name="An16g02880"
FT                   /product="Catalytic activity: L-lysine  "
FT                   /EC_number="4.1.1.-"
FT                   /function="lyase activity"
FT                   /protein_id="CAK48597.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG437583"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniParc:UPI0000EFCFE6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A8"
FT                   /transl_table=1
FT                   /translation="MYILPTTVDKNVCGAQPGDSPEFLAAARALAHELHAANAKLVYGG
FT                   GTKGLMGEVAKTLVSLSGPSAVHGFIPRALVAYYPDADVGKSQNDGKQPERIQAPGSSL
FT                   AEGEYGRITVVDSMHERKQKMAEQVLAGGPGSGFVALPGGYGTLEEVAENQLGIHDRGI
FT                   VLLNVNGFWDGLVAWIAKAAQRGFIGPANKDIMVECKEVGEVIGALKAYNPSGGRLNLS
FT                   WGCK"
FT   CDS_pept        join(complement(627833..628336),complement(627114..627776))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000218813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900848"
FT                   /orf_name="An16g02890"
FT                   /product="Catalytic activity: adenosine + H2O  "
FT                   /EC_number="3.5.4.4"
FT                   /function="adenosine deaminase activity"
FT                   /biological_process="purine ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAK48598.1"
FT                   /db_xref="GO:0004000"
FT                   /db_xref="GO:0009168"
FT                   /db_xref="HOGENOM:HBG630382"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="UniParc:UPI0000EFCFE7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7A9"
FT                   /transl_table=1
FT                   /translation="MASKVSVLSNETLRDYRSAIHQHNDKFIKDIPKVEMHVHIEGTMT
FT                   PELRWELAQRRGESVLNINTQQPCESLSELKGTYELLNDLEEGGVDGGMRRFFELYYGG
FT                   FSVLRDEEDFYRLAMNYFRKAASMNVRYCEPFFDPQGHTRRGVPFETMMNGFKRAQSEA
FT                   SQSLGVHSQWIMCMLRDMSPESAMEHYFQALPYRDMIVGIGLDSLEVDRPPLLFEDVFL
FT                   RARRDGFRITCHCDVGDKDTLRNIGQVVDQLGGSGADRIDHGLHAADDSSLLQRIKEKD
FT                   LGMTICPWGYLCYSGEAEIIDRVRTLYNAGIKIAIGSDDPSYMEDIWLNNSLYLLRLLG
FT                   NFTDAEFFQLQRNAIAICWAPADIKAAILKELEGFWPKEGAEHGSHAD"
FT   CDS_pept        join(complement(630087..630089),complement(629609..629926),
FT                   complement(629305..629391))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18965919"
FT                   /orf_name="An16g02900"
FT                   /product="Similarity to hypothetical protein CP0627 -
FT                   Chlamydophila pneumoniae"
FT                   /protein_id="CAK48599.1"
FT                   /db_xref="UniParc:UPI0000EFCFE8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B0"
FT                   /transl_table=1
FT                   /translation="MAPIINLPLHQTRNSNNLLSPRDNPDCPNTISGGGIAGIVLGTIA
FT                   GTLLILWLWHLCSLPGASSSGGSDYGEANLATSTTRRRRRRHSSPTVYYLEKHPSGHGG
FT                   GGSNSDPSEMEEVIQSPVAHDQKIAEAESVF"
FT   CDS_pept        join(complement(633372..633639),complement(633185..633306),
FT                   complement(632986..633072),complement(632818..632938),
FT                   complement(632252..632767),complement(632109..632199),
FT                   complement(631506..632047),complement(631365..631453),
FT                   complement(631296..631313),complement(631096..631199),
FT                   complement(630677..631046))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000122165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812752"
FT                   /orf_name="An16g02910"
FT                   /product="Function: due to the short stretches of homology
FT                   to these proteins"
FT                   /protein_id="CAK48600.1"
FT                   /db_xref="HOGENOM:HBG325423"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="UniParc:UPI0000EFCFE9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B1"
FT                   /transl_table=1
FT                   /translation="MRVPNRLLLLALGVSDLITAAQVDYSQYVNPFMGSEGPTPGQGYG
FT                   GGDIFVGGARPFGVAKVGLDTTAANWSIAVLNGGWTPDGNVTAVTMMHESGTGGAPKYG
FT                   LIPQMPLTSVESPVNLLDNLTYSQPRIELSASRHAGIIQYSFPDGEKHVLVDISHYLPG
FT                   SPGDSNGQFYVGGEISLEDDGNAYSGYGTYVGGWNNGAPFTVYFYGEFSTAPKNARTFT
FT                   GANTDPMPRYQNLANGGIPQPTYGNTSDKATSGPMNDRIGALFSWDTETDAQISSRVGI
FT                   SFISTEKARSYITSEIPSWTLNDTVQAAVDEWNQDVFSKTQVSLDSTANMTNVRLLYSS
FT                   LYFIHLMPSDRTGENPLWQSDEPFWDDFYTLWDIFRCTVSFYHVYQPTYYESMIRGLID
FT                   IWRHQGFLPDGRSGNWNGLVQGGSDADNMLADAYVKGLRGAINWTDGYAAMKTNAEVIP
FT                   YNTWDATDLSASTKEGRGALGDWLELGYVSQDRNTRCISRTVEYSLNDFAVSQVAAGEE
FT                   PREQEKYLNRSAGWQHIWNPDVQSLNFTGFLAPKFSNGSFNNSGYDPRYCYGCEWLAYT
FT                   YEGVPWEYSFVLPHDMETLIDYMGGADTFESRLDIMFEPNMSVIERNEPDFATPYLYNY
FT                   INKQAKSVEKSRNLGYQYFRDEAYGVPGNSDAGAMNSWLLWQMLGIYPVVTQPVYLLSS
FT                   PWFPDLNMTVNGNQTLRIIANGLDKGYYVQSVKINGQAWTKNWFEHEDVMTQGGTIEFE
FT                   LGADMTAWDTSSVPPSPGHRSI"
FT   mat_peptide     join(complement(633372..633579),complement(633185..633306),
FT                   complement(632986..633072),complement(632818..632938),
FT                   complement(632252..632767),complement(632109..632199),
FT                   complement(631506..632047),complement(631365..631453),
FT                   complement(631296..631313),complement(631096..631199),
FT                   complement(630680..631046))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B1 "
FT   sig_peptide     complement(633580..633639)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B1 "
FT   CDS_pept        join(634584..634595,634786..635864,635918..636569)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659928"
FT                   /orf_name="An16g02920"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK48601.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCFEA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B2"
FT                   /transl_table=1
FT                   /translation="MPFQPPPVAAKPGRKKQSCDECFFAKTACDRASPCSRCQSLGKQC
FT                   SFGAQTPSTENIPSMSPSPSPSVSQIPQRRSDPFFFLAHFTDPSIKQDRLAIAETAKCS
FT                   TRRHLDPIYFQQEEPLLPHDSLSAYMPGFSVADLFLQPLSTPIGQLSMEFIPESTFASR
FT                   LSNRLSEMMMILVDTSNSMGLANAGPQNQLDMAELNSLFTTCNLSVFISAFFQSLHWHL
FT                   PIVHFPTFDPAKVSNPLLLAIFLAGATYATSQDGPVFASRILDVAEEYIFRQLANLSST
FT                   PFPSSAPYLLPSLEVIQGALIIEMLQFGQGETGTRRRIRIIRHPCVISTVRSLGILQSK
FT                   RSLTPDMCNDETWRALIAEEVCIRIACWAFLADGFLTVCFNNHPALSIFEMDCQFPWSS
FT                   ALFEAENASSFNEMAASYTMGRPLPSLREFITRLLDENATDDLIQWSRSLVGEHLLILI
FT                   YGLCNRPRSTSDTIDLTMSLAMHSLAFQARTGLFGWISTNSIKRAAENWRSIWDSVSSI
FT                   VGKEGIHHLGYPKHAEELWWLLTATLDRASGRNVNLRYLDNAATDDLESLNNFIRDIKG
FT                   PNRT"
FT   CDS_pept        join(complement(637550..637773),complement(636970..637475),
FT                   complement(636750..636922))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200579" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900849"
FT                   /orf_name="An16g02930"
FT                   /product="Catalytic activity: ERG3 of S. cerevisiae encodes
FT                   C-5 sterol desaturase"
FT                   /EC_number="1.-.-.-"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK48602.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG559159"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI0000EFCFEB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B3"
FT                   /transl_table=1
FT                   /translation="MDVVLDVLDTFVLDRVYASVLPGGNNSTSDFDTSFLLNQHVGRYY
FT                   PLQPSQWATASRWKRDDLPRQATSLLFITWLFGLAIYFIGSTIFYHTWWDKSLLKHPRF
FT                   LKNQVRLEIEQALFSIPIMAILTVPFFLTEIRGWSKLYDFASEAPFPAYNWLQYPLFVA
FT                   FTDSGIYWIHRAEHHPLVYRWLHKRHHKWLVPTPFASFAFNPLDGWAQSLPYHVYPILF
FT                   PLQKGAYLGLFVFVTLWTVLIHDADCLSHSAVINGPECHTLHHLYFNYNYGQFTTFWDR
FT                   VGGTYRKARGDEFKTIKSQ"
FT   CDS_pept        join(638532..638701,638958..639591)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076530" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812753"
FT                   /orf_name="An16g02940"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit K"
FT                   /function="ribosome binding"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="regulation of translational initiation"
FT                   /cellular_component="eukaryotic translation initiation
FT                   factor 3 complex"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK48603.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005852"
FT                   /db_xref="GO:0006446"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="HOGENOM:HBG328426"
FT                   /db_xref="InterPro:IPR009374"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016020"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019280"
FT                   /db_xref="UniParc:UPI0000EFCFEC"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R7B4"
FT                   /transl_table=1
FT                   /translation="MGVTFDKCETRPANIDAILNGLDRYNPETTTVFQDYVAQQCEDRT
FT                   FDCYANLALLKLYQFNPHLLQAETVTNVLVKALTVFPSPAFSLCLALLPAHTQPFQASD
FT                   AEAQAAAQTSDFVESIQKLARLSTLLESAQYTQFWSTLNSDDLYADLVADVAGFEELVR
FT                   IRIAVEVGKTFREIPAEVLEQWLDLRSREALEKFVAEVCSWEVDKSGANTVIKVPTNKE
FT                   NEARSEVKSERVGVDMFGRVIRRGSSRLHERIDKRYPHRTQPFSF"
FT   CDS_pept        join(complement(641503..641628),complement(640234..641430))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196221" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812754"
FT                   /orf_name="An16g02950"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK48604.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG398669"
FT                   /db_xref="InterPro:IPR007320"
FT                   /db_xref="UniParc:UPI0000EFCFED"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B5"
FT                   /transl_table=1
FT                   /translation="MDPYDSDSSFDDEGDFSETNVLLGYAADEIVEDTISHLGGWPTWL
FT                   DDATPPPGDFAKCKVCNQPMLLLLELHGDLPNDFPDDERRLYIFSCPRKACNRKPGSIR
FT                   ALRATRKLKIEPQQQPPRQREEQKPEPPKEEEEKKPAAAKPDLGASLFGSSTLTGSVSA
FT                   SANPFSSGASSTSNNNNPFAAPAPSPGLAAKPTPSPAPTLSESFADKVRISSPQQQQQP
FT                   KTNLIPPPEASTGPRTPWPAQSDFPAPYTNFYLDAEYETMSRPSTPTIPADVTIDNTEE
FT                   EGPNGGAAELKDTFESELDKAFIRFSTRLGHNPEQVLRYEFRGSPLLYSHADAVGKRLH
FT                   DPSKTANPSAKVTTVGGGSRMPRCEYCGSERVFELQLVPHAISVLEEGREGVGLGPKDD
FT                   AGMEWGTIILGVCGKDCGPNQVGVVGYREEWAGVQWEEPTK"
FT   CDS_pept        join(642171..642330,642389..643583,643647..643887)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196210" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900850"
FT                   /orf_name="An16g02960"
FT                   /product="Catalytic activity: a prenyl-L-cysteine + H2O  "
FT                   /EC_number="4.4.-.-"
FT                   /function="lyase activity"
FT                   /function="oxidoreductase activity, acting on a sulfur
FT                   group of donors, oxygen as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="prenylcysteine catabolic process "
FT                   /protein_id="CAK48605.1"
FT                   /db_xref="GO:0016670"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0030328"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG328427"
FT                   /db_xref="InterPro:IPR010795"
FT                   /db_xref="InterPro:IPR017046"
FT                   /db_xref="UniParc:UPI0000EFCFEE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B6"
FT                   /transl_table=1
FT                   /translation="MHRSSLPYFLRFILHIHVVYYVLALCLSPHANATEQQPLGSFGVT
FT                   PPKRVAVIGAGAAGSSTAYSLRKYADALDIPLNITVFERSPYVGGRSTTVNVHDNPATP
FT                   VELGASIFVEVNHHLVNASKELGLHVNSANHDRPRETEDTLGVWDGEQFVFVMKEASSW
FT                   WNIAKLVWRYGWTPVRTYRLMKSTVNNFLKLYDEPIFPFSSLTSASEAVGLVNVTAVPG
FT                   EAFLQQNQVSAKFSREVIQASTRVNYGQNLALIHGLETMVCMATEGAMAVEGGNWLIFD
FT                   GMLKLSHADLRLNHTVTSLDWDANGPSTLTFTTATNSEEKLEFDEVVIAGPWQFSNITV
FT                   TPPLKKTPDEIPFVTLYVTLFATPHRLSPKYFGLTEPNAYTPETILTTLPPETDIGKSE
FT                   AGVGPAGFWSISTLRTVDAPDPSEGKHYVYKIFSPERPTAEFIESILGLEHKSWFHEKI
FT                   WRPYPFEYPRVTFEEPLLAPHVWYTGGIESFISTMETSALMGRNVAALMSREWQAQADG
FT                   REAESAAYAVRHEL"
FT   sig_peptide     642171..642269
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B6 "
FT   mat_peptide     join(642270..642330,642389..643583,643647..643884)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B6 "
FT   CDS_pept        join(complement(646090..646125),complement(645965..646015),
FT                   complement(645530..645894),complement(644488..645451))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900851"
FT                   /orf_name="An16g02970"
FT                   /product="Catalytic activity: 5"
FT                   /EC_number="2.1.2.1"
FT                   /function="glycine hydroxymethyltransferase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="L-serine metabolic process "
FT                   /biological_process="glycine metabolic process "
FT                   /protein_id="CAK48606.1"
FT                   /db_xref="GO:0004372"
FT                   /db_xref="GO:0006544"
FT                   /db_xref="GO:0006563"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG301263"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniParc:UPI0000EFD01D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B7"
FT                   /transl_table=1
FT                   /translation="MATYALSPAHRNQMEVSLVDSDPEIAQIMEKEIQRQRESIVLIAS
FT                   ENFTSHAVFDALGSPMSNKYSEGYPGARYYGGNQHIDAIELTCQARALKAFNLDPAKWG
FT                   VNVQCLSGSPANLQVYQALMRPHDRLMGLDLPHGGHLSHGYQTPARKISAVSTYFETFP
FT                   YRVNLETGIIDYDQLEANAELYRPKCLVAGTSAYCRLIDYARMRKIADKVGAYLIVDMA
FT                   HISGLIAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVRSTDPKTGKDIMYDLE
FT                   GPINFSVFPGHQGGPHNHTITALAVALKQVDTPEFKQYQQQVIKNAKALEEEFKALGHK
FT                   LVSDGTDSHMVLVDLRNKSLDGARVEAVLEQINIACNKNSIPGDKSALTPCGIRIGAPA
FT                   MTTRGMGEEDFKRIARYIDQSINLCKKVQSELPKEANKLKDFKAKVASETVPEILSLRK
FT                   EVAEWASTFPLPV"
FT   CDS_pept        complement(647721..648344)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900852"
FT                   /orf_name="An16g02980"
FT                   /product="Similarity to transferrin binding protein B tbpB
FT                   - Moraxella catarrhalis"
FT                   /protein_id="CAK48607.1"
FT                   /db_xref="HOGENOM:HBG328428"
FT                   /db_xref="InterPro:IPR011425"
FT                   /db_xref="UniParc:UPI0000EFD01E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B8"
FT                   /transl_table=1
FT                   /translation="MASRSPTAVTPLPKSSVAPETPMVKDAPATPQAVPFPSPQTFDIV
FT                   PPLHGLLSRLLSPPTNAAGVSNGVRAADDPTGAAAPTGPPSGTPGQPQSQQQAGSENTN
FT                   NAGVLGTVTSAGPGGAEISGLGSSTSPALDIKDLPTEVSSIKIRIQKAQAVVENLPDVD
FT                   RSVADQEEEIQELEDRIAKLKSVISDFGQMASSGGARKHKSQGP"
FT   CDS_pept        join(648955..648985,649051..649788,649844..650426,
FT                   650494..650704)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900853"
FT                   /orf_name="An16g02990"
FT                   /product="Catalytic activity: 2-phospho-D-glycerate  "
FT                   /EC_number="5.4.2.1"
FT                   /function="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase activity"
FT                   /function="manganese ion binding"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK48608.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="GO:0046537"
FT                   /db_xref="HOGENOM:HBG613255"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0000EFD01F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7B9"
FT                   /transl_table=1
FT                   /translation="MAKVDQKVALIVIDGWGVAGPNSPKDGDAIAAAETPFMSGFAEAD
FT                   SKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRIDQTLKKGELGKV
FT                   DNIVASFKRAKEGNGRLHLLGLVSDGGVHSNITHLVGLLKVAKEMEIPQVFIHFFGDGR
FT                   DTEPKSATKYMQQLLDQAKEIGVGEIATVVGRYWAMDRDKRWDRVEIAMKGIVTGEGEE
FT                   SSDPVKTINERYENKETDEFLKPIIVGGKDRRVQDGDTLFFFNYRSDRVREITQLLGDY
FT                   DRSPKPEFPYPKDIHITTMTRYKTDYTFPVAFPPQHMGNVLAEWLGKKDVKQCHVAETE
FT                   KYAHVTFFFNGGVEKQFPGEVRDMIPSPKVATYDLEPKMSAAAVGDKMAERLGEGNFEF
FT                   VMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGVIYEACKKHGYILFITADHGNAEEMLT
FT                   EKGTPKTSHTTNKVPFVMANAPEGWSLKKEEGVLGDVAPTVLAAMGIEQPEEMSGRSLL
FT                   VKA"
FT   CDS_pept        join(complement(651883..651943),complement(651529..651724),
FT                   complement(651387..651447),complement(651268..651321))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196242" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20659929"
FT                   /orf_name="An16g03000"
FT                   /product="Complex: the Gim complex is constituted by
FT                   GIM1/YKE2"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="CAK48609.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG559219"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI0000EFD020"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C0"
FT                   /transl_table=1
FT                   /translation="MADAQKQMQALTEEFQTLQTELDGLVEARQKLESQQQENVGVQKE
FT                   FNSLDDESNIYKLIGPVLLKQDKNEAMMAVNGRLEFIEKEIKRIEGQIQENQDKADKKR
FT                   AEIVQFQTQMQQAAAAASA"
FT   CDS_pept        join(652452..652750,652827..653159,653225..653675,
FT                   653732..653953)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900854"
FT                   /orf_name="An16g03010"
FT                   /product="Complex: nucleotide-free or ADP-bound form of
FT                   VPS4 exists as a dimer"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAK48610.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="UniParc:UPI0000EFD021"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C1"
FT                   /transl_table=1
FT                   /translation="MSNTDFLGRAIDTVKKAIEHDNEGEYEKAYQLYYSALELFMLALK
FT                   WEKNPKSKEMIRAKAGEYMDRAEKLKNHLATLDNRKKPSAVGANGKVAQGSGKGGNQDE
FT                   DGEDADSKKLRSALAGAILSDKPNVQWEDVAGLESAKEALKEAVILPIKFPHLFTGKRQ
FT                   PWKGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESERLVKQLFNMARE
FT                   NKPAIIFIDEVDALCGPRGEGESEASRRIKTELLVQMDGVGKDSKGVLILGATNIPWQL
FT                   DAAIRRRFQRRVHISLPDINARMKMFMLAVGSTPCELTQADYRTLAEMSEGYSGSDISI
FT                   AVQDALMQPIRKIQTATHYKKVILDGAEKLTPCSPGDQGAMEMSWTTVEADQLLEPPLV
FT                   LKDFIKAVRNSRPTVSQEDLQRNSEWTKEFGSEGA"
FT   CDS_pept        join(complement(658163..658753),complement(655264..658115),
FT                   complement(654964..655195))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196243" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900855"
FT                   /orf_name="An16g03020"
FT                   /protein_id="CAK48611.1"
FT                   /db_xref="HOGENOM:HBG328430"
FT                   /db_xref="InterPro:IPR012943"
FT                   /db_xref="InterPro:IPR019528"
FT                   /db_xref="UniParc:UPI0000EFD022"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C2"
FT                   /transl_table=1
FT                   /translation="MAYPYIDTPRTEVDGNATYMTGYRSVGRPNLTALDSVENSFATPS
FT                   KDDDLLKGLGDGRRRTSGSFKINTPRAGAASKSARSALNSRHQLPTAAPPKGEFTPLMR
FT                   SATKNNYLRNMSTTRGPKTPGHIGRSYLSNGNTPGLPGMEMTDIDEEDATDDQPTPIPQ
FT                   VASSSVQSTPLPGLSRNGGVLNEGNNMTLKEQEKMIDQLDKDNFGLKLKIHFLQEQLEK
FT                   AGPAYNQAALKENTELKVSKLTMQRDISRYKKSLQQAERDLESYRIQFQELREKARGRP
FT                   SDDTIQREMDLMREEIEARDNQIRELQEDLRDAKDSQTEEMEKLRDEVEDLEASVRERD
FT                   RVIEEREEEIEELKDRDGKERDALTELESELQRAKEQMEELQESLDQAKSDAREARDAA
FT                   SQAVMEKDQAQKDLQELHDEMANKSISTSGLTRQLEEKASKLEEELRELQQENSALKKD
FT                   IETRSDHEARIEERYRESQQQMNDKERKLQDEAAQARRERDLTQQEYDRISAQLQEALD
FT                   EVQRKADEKELLQTRHHALTDESGSLQQELARAQSKIKELQQTLEEEHHHALDNTNTVR
FT                   THYKEEVERLQEEIEALHHEIEDKEGQFALEQDRWESARRALQLQKDRAEDQAAGFKRT
FT                   IEKLEQVEHTLSGKEMKLQEVIDSEKTRHFNSEAVLSRQVKELNDDLTSKREIIDEQRN
FT                   EILSLKEDLRIVRRSEAALQEKIQALEDEIVVLQSSLEEEQEYTKGRTQKGSAEHDSQI
FT                   QKLINEKQRLRDQLANAHVELHDLRTSAAEIETERDELQVQLDQAQNQVDDTTRFDKEK
FT                   VDLRKSVLRLEGEVRRLKEDRSSLLEAKETLEKQLSAEIERAALEENRLSAEIDQLHDK
FT                   LHTTSGGRDRELALTKSKAQRYERRIQELENLLQQQPHAENEHSTANGDLSMLRHSLDE
FT                   ARKREKTLLQREADQKSSVRNYKARLAELERELHDAMMKKYESHSPSSSPSNKLHDELR
FT                   NLRKQLSEAHRTLREVKSKNRDLERAAMREEDQRDLHELLKSSTLEAESLALKVSEREA
FT                   RMNELKAQMRRIRDERSFCARKAESALKELESLQERYDHLVEKMGTKSESSKTRHEKEI
FT                   LGLGKEIIWLRARLKREEKFRRDLAWSKGLMELGERVRVACNEADLRMISDMGVKSRDR
FT                   NKTRTPQSKLKTAVSMVRAVVRMQRMCQDWKKTKKLGEGLRRAKNEVLKRRDASYSKA"
FT   CDS_pept        join(659172..659436,659478..659695,659751..661124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196254" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15900856"
FT                   /orf_name="An16g03030"
FT                   /product="Similarity to hypothetical suppressor of S.
FT                   cerevisiae gcr2 - Homo sapiens"
FT                   /protein_id="CAK48612.1"
FT                   /db_xref="HOGENOM:HBG328431"
FT                   /db_xref="InterPro:IPR010770"
FT                   /db_xref="UniParc:UPI0000EFD023"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C3"
FT                   /transl_table=1
FT                   /translation="MAPMSEEDLEWFKSTFHPIPKPEIPDDSVDYSLYYIPSSPAPAVV
FT                   DEVAETRARLVEVQRTSAELVKDLLKDYIWQRESFRLEITKDNATDGYLGVTSLHGRTN
FT                   FGDSIEDEWVIVYLLRELTKKHKNVWAKAVDGDGQFLLVEAAATLPAWLEPEVADNRVW
FT                   INQGQLVIIKPKNDKKDRVTEKISLSDAKKIIMEEPGRLMRSTMIQEEAFYRLRNYPQQ
FT                   INENLHSAFVTIPRKIAFLLHQKPAYISAAVEAFYLRDPIALRPLRSKDADSFIFKPED
FT                   FVTVSVRFTRVGYAQLKSQDFPVPKSWNDKLPTTDDQKAYDRAEIGMKLACGFEMLLTD
FT                   PQNQDKTAVREMKLILEDLDTGDEQLPTDKDIEAWDKRQDDEKWLDISFEDLDRELKGK
FT                   GKDKDGRPLAEGTFGDANAQENLQRIVAQFEKFLNDDSAGFEGAEFFDDYGTDTDNEDE
FT                   DEDEDEMSSDGEDKEASFDEEEFSRMMKEMMGMPSGGSGLPGSSRPSKPRGRVEELDSE
FT                   SEDDTEQIKELSKQMEAELKGTGVLDLNRKPKTAGDKQALADTKSGEAEDDDLPELDED
FT                   DIDINFAKNLLESLQGQCGAAGPAGNMLSMMNLAMPKDDRHR"
FT   CDS_pept        join(661724..661729,661820..661860,662022..662075,
FT                   662331..662834,662918..663188,663264..663386)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901843"
FT                   /orf_name="An16g03040"
FT                   /protein_id="CAK48613.1"
FT                   /db_xref="HOGENOM:HBG328432"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="UniParc:UPI0000EFD024"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C4"
FT                   /transl_table=1
FT                   /translation="MNLLPPDVAITIIMMLCCLFRGLSPSGRIPGTGLMATPAQCYYCF
FT                   ETLAASYRRREPISLASVEELWEQHEQYKKLAALDEDDDSQFVDEDENTAPLSGKSSRS
FT                   QKIKVPRVSRLQSGSSSSTTQSLASTNSSQSVLSSSTTVTTPSSSSDTAGGKPREDKYP
FT                   LFVTWNTVSKHGHKSLRGCIGTFEAQELAEGLKSYALTSAFDDTRFSPIPESLLPSLSC
FT                   SLTLLGSFEPCTNALDWILGVHGLRISFIHRGRRYGATYLPDVAVEQGWTKEETVNSLM
FT                   HKAGWDGPSESVSDFRAVKYQGLKASSSYAEWQEWRQWVLSLDDGSQQLLS"
FT   sig_peptide     join(661724..661729,661820..661860,662022..662075,
FT                   662331..662352)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C4 "
FT   mat_peptide     join(662353..662834,662918..663188,663264..663383)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C4 "
FT   CDS_pept        join(complement(665489..665668),complement(665305..665395),
FT                   complement(664901..665231),complement(664241..664832))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901844"
FT                   /orf_name="An16g03050"
FT                   /product="Function: Ca2+/calmodulin-dependent protein
FT                   kinases"
FT                   /EC_number="2.7.11.17"
FT                   /function="ATP binding"
FT                   /function="calmodulin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK48614.1"
FT                   /db_xref="GO:0004683"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015733"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000EFD025"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C5"
FT                   /transl_table=1
FT                   /translation="MASQPQAGQRPKVQPCRYKTGKTLGAGSYSVVKECVHIDTGRYYA
FT                   AKVINKRLMAGREHMVRNEIAVLKRVSMGHQNILTLVDYFETMNNLYLVTDLALGGELF
FT                   DRICRKGSYYESDAADLIRAILSAVAYLHDHGIVHRDLKPENLLFRTPEDNADLLIADF
FT                   GLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKSGHGKPVDIWAIGVITYFLLCGYTPFDR
FT                   DSNLEEMQAILAADYSFTPIEYWRGVSHDARDFIKRCLTIDPSARMTAHDALQHAWVNP
FT                   PYDTSADKFGSGEDLLPTVKKNFNARRTLHKAIDTVRAINKLREGGGLMMDGMMSVDPK
FT                   PERVNGNDVIEERRDHDGDMEIDGRANARGQTEEQIRAQERKVQEMVAGLWSRTGKK"
FT   CDS_pept        join(complement(672923..673530),complement(672726..672790),
FT                   complement(666722..672675))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196287" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901845"
FT                   /orf_name="An16g03060"
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK48615.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG314239"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013697"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniParc:UPI0000EFD026"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C6"
FT                   /transl_table=1
FT                   /translation="MPSRKPSKFGNKFRSSAASFNPKRTKTIEFSSLRSTEATSQDEKF
FT                   EAIRLANSIDESLGFPRYESGEKRVGWLINMHSTSIEDPNVPGGRAGVDYYFLEDGGGS
FT                   FKATVEYDPYFLIAVKKGRETEVEDWCRRTFEGLIKKVLRVEKEDLKLPNHLLGYKRTF
FT                   LQLNFASVSHLLEVRKTLLPLAEKNKKNVNVMDTYMEISSDFIIDIREYDVPYHVRVSI
FT                   DKDIRIGKWYTVEAKHGVISLTCIEERLTRADPVVLAFDIETTKLPLKFPDSVIDQIMM
FT                   ISYMIDGQGFLITNREIVSEDINDFEYTPKPEYSGPFMIFNEPDERGVLERFFEHIKEA
FT                   KPTVIATYNGDFFDWPFVEARASVLGIDMYREIGFRKNSEDIYQSDHCVHMDCFAWVNR
FT                   DSYLPQGSRGLKAVTVAKLGYDPDELDPELMTPYASERPQTLAEYSVSDAVATYYLYMK
FT                   YVHPFIFSLCTILPINPDDTLRKGTGTLCEMLLMVQAYQGNIVLPNKHKDPPESFYEGH
FT                   LLESETYVGGHVESIEAGVFRSDIPVTFNVQPAAIDELLRDLDAALKFSIEVEEKKSMD
FT                   DVTNYEEVKKQIADKLIDLKERPHRDEVPFIYHLDVASMYPNIMITNRLQPDSMIQESN
FT                   CAACDFNRPGKTCDRRLPWAWRGEFLPAKRDEYNMIRQAVANERFPGKHKNSPMRSFGD
FT                   MSIEEQAGIIKKRLQDYSKKIYHKIHDSKTMVREAIICQRENPFYVDTVRSFRDRRYDF
FT                   KGKQKVWKGKTDALKSSGASAAEVEEAKKMIVLYDSLQLAHKVILNSFYGYVMRKGSRW
FT                   YSMEMAGVTCLTGARIIQMARELVERIGRPLELDTDGIWCMLPGSFPENFSFTLKNGKK
FT                   LGISYPCVMLNHLVHGSYTNHQYQTLVDQATFRYEQNSENSIFFEVDGPYKAMILPTSK
FT                   EEDKNLKKRYAVFNHDGSLAELKGFEVKRRGELKLIKIFQTQIFRFFLEGTTLTETYAA
FT                   VAKVADRWLDVLYEHGATLADEELIDLISENRSMTKTLEEYGNQKSTSITTARRLAEFL
FT                   GEQMVKDKGLNCKYIISSKPRNTPVTERAIPVAIFSAEENVKRFFLRKWLKDDPGDMDP
FT                   RTVIDWDYYLERLGSVVQKLITIPAALQKIRNPVPRVAHPDWLQRRINTKDDRFKQTKM
FT                   TDMFIKSDKPEKNPLTDISTNILDHRVQHTGDLDEAIANSTQKLKPSSETKVSQKRKHP
FT                   EGLSKTSLDPFATLPAQMPSMADDYVGFLKYQKQKWKIQKQARIRRRQLFGERANAGGD
FT                   SLSNLFRNQAELLYINTWQILQLSETGRPGIVRAFVLIDRKIHALTVKVPRQIYVNLKQ
FT                   DSLPDVDVPDCEVEKVTHTLPNGHPSVHLFKLTLSEETYLREAEKIDVLFQHPSVEGVY
FT                   EKNIPLNIRAVLKLGSICTFDEEQRGVLGEGLDRGFDLSTLCRTTTEQPYLLDSPLAFH
FT                   YLYHVASGDRQIFALFSSTKNEAHVVILNRTRDVQGLPNLDKIYSELLARRMQTMEGDQ
FT                   SQAAFEYQEKIHFRTTQVTTRRKAHLEVGDLIKKFKSEETMPAVMVIQSQQRKRLCHDI
FT                   PILREYPTLPVKPEVSDMDLPPLGWQSFIARRLVTHYLYLSAWVQHLTLLARYGDVPLC
FT                   NLENDDPRFLIDISYARRLQQNNVVLWWSSNPRPDHAGYEKDDISGPLEKVSMPSVNVP
FT                   SAYTTVCIELEVRNLAINTILTSSIINEMEGADTLLASSGQSADPNGGGVLYSEKAFAS
FT                   AGAVVLREMVKHWWTEACDGNSMADIMVQHLIRWVESPVSCLYDRSLHHYVRMLSRKSF
FT                   QRLMAEFRRVGSNVIFASSTRLLLQTSKTEVGNAYAYSQYVLKSIRANPSFHFIDLEIK
FT                   EYWDYLLWYDEYNYGGKGCQEVVESDEQELETVMHWQLNRTLPTPMQTIFHDWVVEYIE
FT                   LMHGLKRPDTNDSTPRLTQIPIGRPSDEDSQEVSAALAEKFSKPLKKQITGLIRRQRDE
FT                   LLHPELASDYIFPVLPGVLSDPNEEKRNPVLELVKLLMQVLSLSKITTMETRLLRRELL
FT                   ALFEVREFSKEGRFENPGASLKIPELTCGSCCLIRDLDLCRDEDVLPEPGVDASKTSTK
FT                   PWRCPFCQTEYDRLAQEEILIGQIQGYIVGWQTQDLKCSKCGTLKVSDFMEHCSCSGVW
FT                   VETMDRKEIERKLHILNSVAKFHGLKLLESVVGEVLAQM"
FT   CDS_pept        join(674009..674342,674407..674663)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812976"
FT                   /orf_name="An16g03070"
FT                   /product="Remark: the systematic gene name of COX20 is
FT                   YDR231c"
FT                   /protein_id="CAK48616.1"
FT                   /db_xref="HOGENOM:HBG328433"
FT                   /db_xref="InterPro:IPR016529"
FT                   /db_xref="InterPro:IPR022533"
FT                   /db_xref="UniParc:UPI0000EFD027"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C7"
FT                   /transl_table=1
FT                   /translation="MADDARDPTTPTQEVREPEQQGVRKPKHEFPKSQVGKLWDAFGNP
FT                   EEPVNMLPTATTKSGQKAKEITVTEAMKTMSLDNAMSFHKAPCARDSLLLGIGAGFGVG
FT                   GIRGVVGGLRSMWTACNWAVGAFAITALAAHEFCQRRRVEELDGMKQAVELMKALKDKK
FT                   QREKEQKIEEAARLAEEERKRKSWTNLSNYKFW"
FT   CDS_pept        join(complement(676260..676277),complement(674961..676103))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217192" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966142"
FT                   /orf_name="An16g03080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48617.1"
FT                   /db_xref="HOGENOM:HBG328434"
FT                   /db_xref="UniParc:UPI0000EFCCC5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C8"
FT                   /transl_table=1
FT                   /translation="MTWQLAGRPCLFTGRRKGPTTTQTSFPLLTPPARIQPHCAFPSFS
FT                   HSYGYISWPKHQCSPHLLGYNGFVYDSGPDTKKLAYYLAHTFCVILYHSRRGRCDAPTF
FT                   AMNPSPAMMPTTLPTMSSESPKRKRASSEESDYCSPSASPTSSGSIPNPQESRIRDAED
FT                   WGRYSPRALVAGRLGRLAIRGDQLSTSPVPYGVDQGIVAHTAQSGNWSTSDDDFHEPHA
FT                   LSEANSSMEISPSPEEQSEFAEATQSPDIARTGSPSPRKRRSTPSPRKKKLPTTSSKMR
FT                   SRSASPPLMTDTAESPLTWHDSEITGHNPTDPTDDGYGLNGIGFKPTAAMAWARSERRK
FT                   KQVADWRSREAREAREKRRERRDGADFERIRSIQSGAIQKRVKFDV"
FT   CDS_pept        join(complement(678027..678190),complement(676848..677967),
FT                   complement(676485..676760))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812977"
FT                   /orf_name="An16g03090"
FT                   /protein_id="CAK48618.1"
FT                   /db_xref="HOGENOM:HBG611715"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012974"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="UniParc:UPI0000EFCCC6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7C9"
FT                   /transl_table=1
FT                   /translation="MADYLLFEGPMGYSLFKVAHQGDSVGNRLKEVQEGVNDLASFGKM
FT                   VELSSFLPFENNKQALSEINDVSEGVASDTLISFLELNLPKPNKKKKVVLGLADKALAG
FT                   SIKSAFSFVDCETGDTSEVVQDMLRGVRLHATKLLKQLREGDMDTAQLGLGHAYSRAKV
FT                   KFSVQRDDNHIIQAIAILDQLDKAINTFSMRVREWYSWHFPELYKIVSDNQRYAQIALF
FT                   VQDKKSLNDEKLHDIAALVEDDEGVAQSIIDAAKHSMGQEISETDMENVISFAQRVVSL
FT                   SKYRKSLHQYLISKMSVVAPNLAALIGEIVGARLISHAGSLTNLSKYPASTVQILGAEK
FT                   ALFRALKTKGNTPKYGLLYHSSFIGRAGPKNKGRISRFLANKCSIASRIDNFSEEPSTK
FT                   FGEALKKQVEERLDFYATGAAPTKNEVAMKNAMDAVLADMDIDGAESDAEMQDADEKAE
FT                   KKDKKEKKEKKDKKEKKEKKEKGEKEEKKKKRKSDVGEGESEKKKRKHDSDAEPSKKKK
FT                   KV"
FT   CDS_pept        join(678568..678609,678692..678786,678840..678861,
FT                   678922..678963,679016..679036,679092..679265,6
FT                   79328..680554)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226733" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901846"
FT                   /orf_name="An16g03100"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK48619.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG497503"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012722"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI0000EFCCC7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7D0"
FT                   /transl_table=1
FT                   /translation="MSATQLLNPKAESRRRAEALKVNISAGEGLQDVLKSNLGPSGTLK
FT                   MLVDGAGGIKLTKDGNVLLREMQIQNPTAVMIARAATAQDDITGDGTTSVVLLVGELLK
FT                   QANRHISEGLHPRVITDGYEIAKNESLKFLEQFKLERKIDRELLLSVARTSLSTKLNSA
FT                   LAEKLTPDIVDAVLAIHRAPEKPDLHMIEIMTMQHRTSSDTRLIRGLALDHGARHPDMP
FT                   KRVENAFILTLNVSLEYEKSEINSGFYYSSAEQRDKLVESERKFVDAKLKKIVELKQQV
FT                   CGTDPNKSFVVINQKGIDPLSLDVLVKNGILALRRAKRRNMERLQLICGGTAQNSVEDL
FT                   TPDVLGWAGLVYEHQLGEEKFTFVEEVKDPKSVTILIKGPNQHTIAQVKDAVRDGLRSV
FT                   YNTIVDNCVIPGAGSFQVACAAHLSSEAFRKSVKGKAKWGVQAFADALLVIPKTLAANS
FT                   GHDVQDSLAALQDEQSNGNTVGLDLTTGEPMDPIQEGVFDSFRVLRNCVASSTGIASNL
FT                   LLCDELLKARQMGRQGGPGGMDE"
FT   CDS_pept        join(complement(683234..683356),complement(683113..683161),
FT                   complement(683068..683084),complement(682941..682978),
FT                   complement(682732..682750),complement(682409..682478),
FT                   complement(682335..682374),complement(681652..682296),
FT                   complement(681610..681613),complement(681225..681584))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196311" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660186"
FT                   /orf_name="An16g03110"
FT                   /product="Catalytic activity: Acetyl-CoA + histone  "
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK48620.1"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG328435"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000EFCCC8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7D1"
FT                   /transl_table=1
FT                   /translation="MLAGDHHERKGIKLDRNLGRQDKGLNPGGAIRRGNTGWQAAFRQQ
FT                   DSARGSRPSSYEGTGKEGFADEEKSSSNQPNDGKESARKVKKEIQDLRQTAVPNGISAE
FT                   TRGRNKPRIDAIRSYDPVSRTEPSTDRNVKHVVLGDLLFPTWYQSIYPEDLVNKDTDRL
FT                   YVCRWCFRYSCDVHAYAQHTRLCQHRITPPGTKVYDHGGYSVWELDGESHKLYAQNLSL
FT                   FAKLFLDHKSVFYDVVSFLYYLLVFTDPNDPENYYVLGFFSKEKLSWDANNLACILVFP
FT                   PYQHKQLGKLLMGVSYKISSWESDSGLIGGPERPLSEMGHRSYTRFWQERIARRKSPKT
FT                   SKRKHTHELMTVQDIGLATGMLPEDVVTALQGLGAVEPATPAKKRRTKDSSGEAGSGAD
FT                   EALLIRKSKILEWAKSHHMALQDPVRDEGFLGKWAAVDSTEASDVDSDDVDEDAG"
FT   CDS_pept        684507..686585
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966143"
FT                   /orf_name="An16g03120"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK48621.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EFCCC9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7D2"
FT                   /transl_table=1
FT                   /translation="MASELGNVGHTLFEAFESEFGCTRTGGQPQSSSEQCPDGLRPDHA
FT                   EPPRPSDATAVNSVVPDVVDQSTQDRDLGSHETQSGEKELGSESDSKNGTKKAAEADGP
FT                   ARPGGPNQAQPDASSYVPHAPRGRHGPFPFTPYFQPPPPPPPHPHPHHHYPPPPPPPPH
FT                   HPPFFGPPPHHFHQPFPVPHPPPFWPTPESLSHPHFPAGPQVHHPQPTSTHAHPSQHAA
FT                   RHYNQCRRSRGPTSHQHVHEQGRGGTNDVPSSGRDATSTETQSPTNTSLFVGNVGFNVS
FT                   EKMIRDVFASRGFLVDVHLPLDVGTEKHAGFGYLFFPSVPAAKAALEALQGTHIDGHAI
FT                   NLEFSDQTPVIKLHPEEPSPQATSDSPMPVVSDRKSNPYELQGSTATPAKLEKASLGSQ
FT                   DGSKSPSGKRAAPLTVADLCSNDNRNPGNAASANSLEDSSLGDSTRLNSLYPSLLPEGV
FT                   PKSGPSEPVSPAFDRIPELTRELEECRFPPVSQLEAHFLAEQQKEAASSNVQTRSVGKA
FT                   PEAKNLNGNAALQGLPGAYPQEVRGDSSTRPGQFSGTRNLHGAHDNGESSFGPRRHVRR
FT                   WKSQRPRSAWQDDFLGWDAPRGMFGGRPEGRHRHRGGRRNSFESPLSETQVANPNVRQR
FT                   EIDDCVSTLVSLGYGGASDGGHQRIAIYAAAADGRVSDAIEMIEEERKAYEQQGSTM"
FT   CDS_pept        join(686986..687251,687324..687444,687501..688479,
FT                   688582..688745)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117174"
FT                   /orf_name="An16g03130"
FT                   /EC_number="6.1.1.22"
FT                   /function="ATP binding"
FT                   /function="asparagine-tRNA ligase activity"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="asparaginyl-tRNA aminoacylation "
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK48622.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0004816"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006421"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG745843"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI0000EFCCCA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7D3"
FT                   /transl_table=1
FT                   /translation="MLTWRRTFATSVARLNNRPAARSAGSTLLRCAQVLEQSQKGSSLE
FT                   DQEIQLNGFIRSVRKQKRFAFAEISDGSTVKPLQAILNPSQAAELSTGTAVEISGVWKA
FT                   CPPGKEQTHELQATSVNIVGKTDPETYPIQKKYHSPEFLRQIPHLRIRTPFNSLLSRFR
FT                   SECLYQLGNVFRHAPNGGFVQVHPPLITSSDCEGAGETFTVLPREAVGTTPADGDHFFR
FT                   APKYLTVSSQLHLEAYAAELGNVWTMSPMFRAEKSDTPRHLSEFYMLEAEANFMDNLDT
FT                   LTDLVEYLLRDLTRRLYDTPIGQEILTTKRPGESNSEELATATDPADLRQRWQDMIDGP
FT                   KWRRMTYTEAIELLQDAVAKDSATFEYPPTWEGGLQLEHEKYIVDVLNHGHPVFVTDYP
FT                   KPIKPFYMAPSHASAATTHGETVACFDLLLPEVSEVAGGSLREHRLPEIIQNMRQHDLG
FT                   HLQWYADLRRWGTAPHGGFGLGFDRFLGYLAGVSSVRDIVAFPRYFGRADC"
FT   CDS_pept        join(complement(691988..692182),complement(690209..691846))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812978"
FT                   /orf_name="An16g03140"
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAK48623.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI0000EFCCCB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7D4"
FT                   /transl_table=1
FT                   /translation="MTGIYTDGLISTYSVSLSGTTYTIWRSLAMSHNDAVLYSHEGTGR
FT                   YEKHAAPLHLHIGLVLAVSQEANSDRIDALSLLDATTVDFSDASAVWLFECEQQNRGNL
FT                   VNQLRQSLRVTLDAYPQWCGLIKAVDSVDGPAFADRDRLAPHARRFGRVYVQYGTRADP
FT                   GVEFVTARAFDTLNDLCPSSRTTSQPLWNQEKVALSKFVPKTCLANPLKQPVVDNADIP
FT                   PPVMAVQVTELACGGFALAVKIAHPLADAQSLVYFVKDWASVSRSALLSEPPPVLKPLF
FT                   EPARLDGAAAGDINAATPDESIIEQTESLPFHRYDWWNVPSDSSLKTRIPEAFRNQDIP
FT                   PAGKPIPWSEWDTKASVSHYIVHLSREQVKKIWKQANNASSTTTQTSQLSRHDAILAHI
FT                   WSSINRARKMQHELGPVHCDLAYGCRPAFHLSDAFMGSLSVMVNVEMAGAELTTTANSD
FT                   GNETAVLPPIAHRIRQTLLQLKNHPARLAAHLHRLAYETSPQRIWQGFLGSRHVMVTTW
FT                   ACAGLYDVDFGLGPLSSSSARYADGILANLDGLVLIKEAPPPPSPSPSGRESEVRDCRA
FT                   PSAWTEHGVDVQIHLRSEDMLRLLRDPLLLPDTT"
FT   CDS_pept        join(692435..692546,692617..692704,692771..692853,
FT                   692916..693035,693206..693295,693398..693522,6
FT                   93658..694023)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901847"
FT                   /orf_name="An16g03150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48624.1"
FT                   /db_xref="UniParc:UPI0000EFCCCC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7D5"
FT                   /transl_table=1
FT                   /translation="MVIALSQLCDKSNDHILFSSYWMACMECITKIDCLFVAVRYCHGW
FT                   LGWCDLTCQAYNTTAYCHILRRHHRQRRGAKQPWPHLMDHGTTDYLSVYGWAQLDIICA
FT                   KWISIGLSGRYMFFSAQKFIPSSSMIRFLEGGGSLTNRPTWALDSGWGPHRTDTLFPPS
FT                   CGGSFIGLNRRNDWMGRLISARDSAEQGQHPSWGGSVRIKGAPVAVFFPVVKLRRNTTR
FT                   GGECQVANLTGVKHILSAFVRRQTSRALFRSMSVKTDMDGTTDDRSYGPSCLDWGPWIA
FT                   YATFARIGWLARQLDSDEDTCTSSSSSLFLWFYALKPDAHQSVPIT"
FT   gap             695225..695324
FT                   /estimated_length="unknown"
FT   CDS_pept        join(696100..696102,696212..696250,696388..696438,
FT                   696587..696730)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117175"
FT                   /orf_name="An16g03160"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK42814.1"
FT                   /db_xref="UniParc:UPI0000EFCCCD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7D6"
FT                   /transl_table=1
FT                   /translation="MVRKGRLPITQATTCGFQVDPNHVTDCLACLSSSAESTDGVTKTP
FT                   LARTADSRLIRKADTQSRSLRASSVRKLWNQSQ"
FT   CDS_pept        join(complement(700746..700912),complement(700589..700630),
FT                   complement(700262..700320),complement(699943..700056),
FT                   complement(699676..699842),complement(699536..699599),
FT                   complement(699401..699470),complement(699151..699301))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901848"
FT                   /orf_name="An16g03170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42815.1"
FT                   /db_xref="UniParc:UPI0000EFCCCE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7D7"
FT                   /transl_table=1
FT                   /translation="MGDTNSCLQGWRIPTYQMSIPQQACCTLIELPVRIMTTEGYHDSR
FT                   GGPPYAVWLLRESPKYYRITLGRYHSIRTCVWIWTPTRSPIMHLAVPPESDPFGPKLTT
FT                   FSPLYARLPLPFCRYLGFVTGFSDDNSHCGDSYSYRGEHLIPQREFLSPLISSFFVAAV
FT                   KPVLLQVEDGCKIGPILVGHAFLSMRLNTYPGLKQGSTELTTENLSAGPNIKSFSVKKL
FT                   DNSYPGSSALGAKVKPSQKQNKGTPTGKEKNEELKKASLGSVICKSIGHVRPEHS"
FT   CDS_pept        join(complement(702654..702800),complement(702514..702566),
FT                   complement(702334..702432),complement(702085..702214))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901849"
FT                   /orf_name="An16g03180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42816.1"
FT                   /db_xref="UniParc:UPI0000EFCCCF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7D8"
FT                   /transl_table=1
FT                   /translation="MCRNAGNLDEVGSQTTAVQKPFKKHRSSVRYSRNRKQKAKLQEKV
FT                   RDEQGGGVELEGRGGEDRGDGMQAEVERYTNAAETRGATTCKGRAGTGKTYRGGRSSRW
FT                   GMVEGRKSQQVAVEREEGERDRGSNNKNNNSATLLLLN"
FT   CDS_pept        join(702890..703632,703731..703761)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901850"
FT                   /orf_name="An16g03190"
FT                   /protein_id="CAK42817.1"
FT                   /db_xref="HOGENOM:HBG328443"
FT                   /db_xref="InterPro:IPR018608"
FT                   /db_xref="UniParc:UPI0000EFCCD0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7D9"
FT                   /transl_table=1
FT                   /translation="METYHGHVRTPADAIILFEACRIGLLPRVQRRLSEKERQLIRSGS
FT                   VFVWDEREAGMRRWTDGKSWSASRVSGSFLTYREMEGKRGGTGVAQTTMSRAGKTPEST
FT                   RGSDDDRGDGADEGPDGYRYKPDGLMKQSFSITTSTGQHLHLISYYSRSHPSAANLQQP
FT                   STDPNLRHVRPQKGLYPESTVNDQQNLPVVTRGPMAGAAYVPPHPMAPYGRSPAAHAAP
FT                   YTPSYTWPPTPLATPPVPVHYPSYLPTPRAAGTCS"
FT   CDS_pept        complement(703927..704262)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117176"
FT                   /orf_name="An16g03195"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42818.1"
FT                   /db_xref="UniParc:UPI0000EFCCD1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E0"
FT                   /transl_table=1
FT                   /translation="MPPARYAVKTRSSCRSARMSSPPNPIFSLGMSRGPSARPAAGAGG
FT                   AAIDGNPPEGAPFISAPMLGTVVPVLASSGLGAIVLGGGICTLVDGGWLISWGLRAIDG
FT                   MPLLCGI"
FT   CDS_pept        join(complement(706680..706772),complement(706537..706615),
FT                   complement(706478..706501),complement(706239..706443),
FT                   complement(705917..705939),complement(705298..705652),
FT                   complement(705128..705164))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966144"
FT                   /orf_name="An16g03200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42819.1"
FT                   /db_xref="UniParc:UPI0000EFCCD2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E1"
FT                   /transl_table=1
FT                   /translation="MERCHPLPQLEEQFLTRVWLEKSKKLADIKILFPGHKGFQAFSHS
FT                   NSCLWVHTGRTMNTTILYSTNHGDISSTPRRKTATDILYFGGLCPGFSPSGRPWHNIKM
FT                   EVHTHHTSITIPQCQSRSYSPLETTLFRSRHQGKPQTATNPTLSYHQPNQPTPPPAEAK
FT                   ERITKSKDTRTHTSLRLRTPWPRCQPTPAHHLPNSCHLHFRSSSTYKSSQPINAYEQNN
FT                   QTSQHQDKLLGWKLLSHSQLQARSDHHTYDKEHCIACIIFPLCYGSTVS"
FT   CDS_pept        join(707275..707578,707639..707755,707986..708059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966145"
FT                   /orf_name="An16g03210"
FT                   /product="Similarity to hypothetical transcriptional
FT                   regulator - Clostridium acetobutylicum "
FT                   /protein_id="CAK42820.1"
FT                   /db_xref="UniParc:UPI0000EFCCD3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E2"
FT                   /transl_table=1
FT                   /translation="MATPFFTNQNTDFKEYSRLLLHNTPIPLDQNPEQLASNQKHLLSI
FT                   KYFQKHSSPQTISKATSATRMRTLPRQLMVRRMMASVIPIRSDCTIGQDIPPVVKTEPQ
FT                   SSDPRQHRSSRSEFPMGHAEPAEVGVGRTSLIEKLSKSGRGQSTAAQRGNLKLKQSKQS
FT                   I"
FT   CDS_pept        join(708636..708794,708874..708996,709042..709092,
FT                   709169..709300)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812979"
FT                   /orf_name="An16g03220"
FT                   /product="Remark: CAB11213. 1 is encoded by SPAC17H9. 04c
FT                   from S. pombe"
FT                   /protein_id="CAK42821.1"
FT                   /db_xref="UniParc:UPI0000EFCCD4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E3"
FT                   /transl_table=1
FT                   /translation="MATRVCPSSCRQPRNETFLSSSTVSDARVYCKVLAGIFHCLKPVE
FT                   NIQWHGLVGRPQAFINQICPEMEHLSRIWIFQDPNVPSQQQMGNCKISNDQTPTYKLVG
FT                   SDDINSKTLSHGVCCSNLFAQAVMYTDHSIRKRDTVTRRPKTMLTSKGRE"
FT   CDS_pept        join(710204..710771,711023..711163,711355..711542)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660187"
FT                   /orf_name="An16g03230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42822.1"
FT                   /db_xref="UniParc:UPI0000EFCCD5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E4"
FT                   /transl_table=1
FT                   /translation="MEWEEAYEYRESTETNELLEFNTAIQTIEPVWPILPLNLKRYFPT
FT                   SESESYEFENFEVSPDPEEENELFQAQKLYFRDVANRTKRYLCLIIIYGHSSHEEACKE
FT                   ALRISWHRNWKKTSSKAIMGLIIDEEKQAWFRGSHTDETNIKKMGSNWVANNECMLRTY
FT                   FRTFRRALRRHAPSPGYDPAFESGSERNHKDISDSRKQLSDKSSLLLALRPRRQPARPN
FT                   KARSILGAKEHLNDARWIDIETEAQTNISRDTIPITHHRDIQRRNALFHYNTPKNPIPV
FT                   QTQSSENSPFQILHHHH"
FT   CDS_pept        join(711963..712008,712041..712071,712253..712365,
FT                   712397..712491)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660188"
FT                   /orf_name="An16g03240"
FT                   /product="Similarity to hypothetical membrane lipoprotein
FT                   CAC13380.1 - Mycoplasma pulmonis"
FT                   /protein_id="CAK42823.1"
FT                   /db_xref="UniParc:UPI0000EFCCD6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E5"
FT                   /transl_table=1
FT                   /translation="MEGMMVGEEERKCGVGDDDYTLLTTDYLLTHVSLINNYTVTSSDL
FT                   LWNSPSVPNRATHNTPTHKTTTLTHTRSVNRPTGRPSGASENQIRSYIH"
FT   CDS_pept        join(complement(713467..713521),complement(713387..713420),
FT                   complement(713283..713349))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901851"
FT                   /orf_name="An16g03250"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK42824.1"
FT                   /db_xref="UniParc:UPI0000EFCCD7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E6"
FT                   /transl_table=1
FT                   /translation="MRSESGSRKFGGILHPLHLSMCMQNGSIPWALVSFTQHSHFYYFK
FT                   QCVKPG"
FT   CDS_pept        join(complement(715304..715502),complement(715191..715236),
FT                   complement(714918..715150),complement(714642..714835),
FT                   complement(714168..714602))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660189"
FT                   /orf_name="An16g03260"
FT                   /protein_id="CAK42825.1"
FT                   /db_xref="UniParc:UPI0000EFCCD8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E7"
FT                   /transl_table=1
FT                   /translation="MFPRAWTSRLTVIRNGWRRVVVRAICQTTNSEVELELRLAGARAR
FT                   SLRGSGAVFFFPLLTKWTRLLALVWFALAIKLDDHGCQGHEWILSLALARETAKERASW
FT                   EKADRPMGKSVTKITVPRMYPAPVRVLLKLESLRYALPAHEFSFFYESSRSWGQAGADA
FT                   ASALLTINLLQQGIGVSQLGKNKHSRWSDDAWVETRPTHNRNGRDKSLLHSIFYRIGYT
FT                   YMKASTASGRTRAQPLHERRLTAPSQPEESVNGTSGSTEGCSRRIPVERDKERTAGPGH
FT                   LNSSSSSFCSDQQGVHLRDGCTIEFPCLMPACPRKLYNLPTPPFLSLRSLVPSTMSRSL
FT                   DSQSVHPHPLQSSSPRYSLRECGGDTET"
FT   CDS_pept        join(715533..715692,715740..715882)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966146"
FT                   /orf_name="An16g03270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42826.1"
FT                   /db_xref="UniParc:UPI0000EFCD07"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E8"
FT                   /transl_table=1
FT                   /translation="MSGKAEHLMRGERQSGRERSSEETTCDGGQTVDQDPQHGDPSVAI
FT                   SFVYCLEVKQLVVVPSPTTESFSGCLCLFCTEPFRSAVSINREPVVHDKITDLPD"
FT   CDS_pept        join(716849..717035,717119..717160,717205..717438,
FT                   717518..717583,717662..717765,717851..717940,7
FT                   18053..718079)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901852"
FT                   /orf_name="An16g03280"
FT                   /product="Similarity to Deltex1 - Mus musculus "
FT                   /protein_id="CAK42827.1"
FT                   /db_xref="UniParc:UPI0000EFCD08"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E9"
FT                   /transl_table=1
FT                   /translation="MITVSRLLVPTAIQAAAPPPPSPPLPPAAHTDARLLHDLDLLPAG
FT                   IVSSGRIRGFPAAVRNQASPDGADPPRKPVASCRAPGREQRGGEDHPLHFGRVWGITHT
FT                   GRSPTERCAQQDLVVSDEDHPSGDLSQGAPSMRREGLFWMGTLPAGAVLLGTGTRHSAL
FT                   GKTTKIRTPKRIAVQMRTGLAFLDPPASMLEFKKSAARDGMDGCPTDPMIAVHLPAMLE
FT                   DTIRGNRPRILKAVLVKLPEALITKFA"
FT   sig_peptide     716849..716899
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E9 "
FT   mat_peptide     join(716900..717035,717119..717160,717205..717438,
FT                   717518..717583,717662..717765,717851..717940,7
FT                   18053..718076)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7E9 "
FT   CDS_pept        join(719434..720107,720188..720276,720414..721600)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812980"
FT                   /orf_name="An16g03290"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42828.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG328454"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI0000EFCD09"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F0"
FT                   /transl_table=1
FT                   /translation="MLSMQKSHTYVLPPSTTYNNVTGLPHTMPSANPPAERRDSTRSVM
FT                   LTDVPALGDCPLVDDSSLSHRNSISTTDGISNDSPASWDGDAPSDNSPSAEVDVKIQDG
FT                   LHHPFPTTADTSPKTFRFNVIASHGMDASMDEVTPKIEEIDDVDELQSIKPVGVETSMA
FT                   NASSTHPDSTAAPVNVPRKRGRPRKHPLPAPGNQIKITKGRSKTGCITCRRRKKKCDET
FT                   KPACLNCQKNAVVCEGYPPKEIWKSGKQKLEDVRTQNMVARSLPLLIDGIETEIDRRFL
FT                   DHFVYGFSRVLTLINDDSNPFKEILLPMATQHRGLMHSLMCLSGSHLSGLHHVPMLEER
FT                   KFYHYHRAIRDLKDNITASSGNSEQDPELLIEDPIIASTIALSLNTICEGETKGEYRPH
FT                   MDAARYLLSTQQPRNEKFRQFIVEFFQYHDVSNSITSLDRRPAHLQGGLRLPDFVPHAQ
FT                   AGMFLGVFDGLFNYISEVTRIRDRIRQRSNEGYEPAVDYQILGDAVSIDSAIRAWETSY
FT                   TPNTPNYYLAQLYRQSTWVYLYRTIRPSRPSEKIAQVVDDGLSFLDQLPQDAGAYSIVL
FT                   MPLFLLGCSAFLPRQRERIKKGFETLKGYSNLRNIEPAFKVVERVWEVMDTKMEESWDW
FT                   EKIISDMNMDFLIT"
FT   CDS_pept        join(complement(724895..724951),complement(724447..724847),
FT                   complement(724284..724399),complement(724062..724251),
FT                   complement(723692..724006),complement(723294..723623),
FT                   complement(723170..723241),complement(723018..723102))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901853"
FT                   /orf_name="An16g03300"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK42829.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG328455"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EFCD0A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F1"
FT                   /transl_table=1
FT                   /translation="MATIHDNDELLLARIGYKQELKREFSKWSTVSYAISILGILGSVP
FT                   ATFGAPLSAGGPATATWCWFVGSCMALCIGSSVAELVSAYPTAGGMYFVTKHVVPDEHV
FT                   PIFSWVQGWCNLLGQTAGVSSVAYTVSQMLLACASMNSELVDGKYSYSPSALDTVLLSV
FT                   ILLCVLGVICSMTTKSLHQIFLWFAPINTDQLVAATFCICFALLWFTPNKQPAIWVFTH
FT                   FTDGSGWGSKVFSFLLGFISVAWTMTDYDGTTHMSEETHNAAALGPLAIQSAVIVSGIL
FT                   GWILTISMCFCLTDFDDILNTPTGLPAAQIFLNAGGKVGGSAMWGLAILVQFFTGCSAM
FT                   LADTRMAYAFARDEALPFSSFLSQVNPYTQTPVNAVWFVVFFSICLNCIAIGSTHTATA
FT                   IFSITAPALDLSYVSVILAHQIYRKQVKFIEGPFTLGRWGPYINWISVIWVVFISSVLF
FT                   FPPTVPVTVSNMNYGICVGISIAAFSLVWWWVAARGRYTGPRTTEHMQPVPTEEPGLDY
FT                   GTMQ"
FT   CDS_pept        join(complement(727978..728071),complement(727810..727896),
FT                   complement(725913..727759))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235042" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901854"
FT                   /orf_name="An16g03310"
FT                   /protein_id="CAK42830.1"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniParc:UPI0000EFCD0B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F2"
FT                   /transl_table=1
FT                   /translation="MVWAHHCHFWSQNSDIKYCTDAETHERDDCAFMPDDNGERDPNIC
FT                   KDVGVMAKLNICTAKGAELPKRDAHLLKDIGRDELPFDLHSEMCLSLAASWLDKCCRKH
FT                   AKCEGYKDGAHSLPTRVIDVGDSLTQPHLHVSADGETGKWAALSYCWGGDSNFTLNASS
FT                   FDDLRSGQSLATFPATLRDAVLVTRALGFRYLWIDSLCIFQDNINDWAVEASRMSRIYR
FT                   HAAVTIAATSAETADAGFLDKRAPYYSCPFPWRRRSHQGSVNDASRAYPVVLRSYTDTF
FT                   NKEPARSSRWATRGWTFQEELLSKRILYYTKEEMVWKCRAVTFREPELKPTTTSYIEIP
FT                   PPLPVPLPKPEQLYADSMSDPYRIWYLLLEIYVSRDLKFDRDRLPAIEALAEFFHAQFR
FT                   EQYCAGLWREDLRFGLLWSIHRNGHYPGPHADTAKRSEVRNLSYQYKHNKERYAPVGVS
FT                   SKQRKPSWSWIGADNYVDLKWPQLGQLRWLQDYTYFAFILDFKVHGQLQGVFGHVEGAE
FT                   LTLEAPYRHLHLKLDGYSKSQWNPVRVAQRALMRPSPLPSLRELAQVALVRPGYLAGTE
FT                   TSGSVIVPSSSTDFTFIRIAEETRTVPPALYLLILQPQPRNATNNRGPHHYRRVGLLRL
FT                   SPHRYYGSDSVRVAVTKRLESDAYKEVTSEKWPVGTFVID"
FT   CDS_pept        join(728965..730290,730337..730434,730484..730824,
FT                   730873..731310,731360..731551,731620..732254)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117177"
FT                   /orf_name="An16g03320"
FT                   /product="Complex: human Sec24a co-immunoprecipitate with
FT                   human Sec23aa"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="CAK42831.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG328458"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0000EFCD0C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F3"
FT                   /transl_table=1
FT                   /translation="MADPNMYHTYGQAPVPGENPSDPNQMAYQVPPQGYPAAGIPPGPS
FT                   PPQPGAAYGVPAPNQQWPAYGSPPPAQQPLQQPPSQFAHQADPQAAMGAPVDPGMAGLA
FT                   SQMSGLGIMGGEGGAARSSKKKHRHAHHEIAGASASVAQPFAAAPQDPMQPTSQFLNTG
FT                   LNQAPRPISPAASIPAPVNPAFGGGAGAVPTQGKVDPEQIPSIPRSRDLPAQYYFNHVY
FT                   PTMERHLPPPAAVPFVAHDQGNSSPKYARLTLNNIPSTSDFLSSTGLPLGMVLQPLARL
FT                   DGEQPIPVLDFGDAGPPRCRRCRAYINPFMSFRSGGNKFVCNMCTFPNDVPPEYFAPLD
FT                   PSGSRIDRMQRPELMMGTVEFLVPKDYWNKEPVGLQWLLLIDVSQESVNKGFLKGVCKG
FT                   IMEALYSEETENPEDEAPARRIPEGAKIGIVTYDKEVHFYNLSAQLDQAQMMVMTDLEE
FT                   PFVPLSEGLFVDPYESKDVITSLLQRIPSIFSHVKNPQPALLPALNAALSALRPTGGKI
FT                   VGTIASLPTWGPGALSLRDDPKVHGTDAERKLFTTEHAGWRETAGHLAEAGIGLDMFIA
FT                   APSGTYMDVATIGHIPEVTGGETFFYPNFHAPRDIRKLSKELAHAITRETGYQALMKVR
FT                   CSNGLQVSGYHGNFVQHTFGADLEIGAIDADKAIGVVFSYDGKLDPKLDAHFQAALLYT
FT                   SANGQRRVRCINTVAAVNEGGMETMKFVDQDAVVAMVAKDAASKTLDKSLKDIRAGVSE
FT                   KTVDIFSGYRKIFSGSHPPGQLVLPENLKEFSMYMLSLIKSRAIKGGQEASDRRIHDMR
FT                   MLRSIGCTELSLYLYPRIIPIHNMQPTDGFPNEQGQLQVPPSLRASFSKIEEGGAYLVD
FT                   NGQQCLLWLHSHVSPNLLEDLFGEGQTSLQGLSPQISTIPVLETHLNAQVRNLLQYFST
FT                   IRGSKAVTIQLARQGLDGAEYEFARMLVEDRNNEAQSSVDWLVHIHRQINLELAGHRKR
FT                   EDTAGEGGLTSLAGLRAPYW"
FT   CDS_pept        734469..735011
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660190"
FT                   /orf_name="An16g03330"
FT                   /product="Similarity to the Aspergillus niger EST seq id
FT                   no:4367 of patent WO200056762-A2. "
FT                   /protein_id="CAK42832.1"
FT                   /db_xref="HOGENOM:HBG325538"
FT                   /db_xref="UniParc:UPI0000EFCD0D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F4"
FT                   /transl_table=1
FT                   /translation="MFFKTILTAALATAATALPHSVNNNMVRRNGTSSGSGGVSISNNM
FT                   SNTTVYAWSVSDRVSNMHTLSAGGGSYSESWQTNDNGGGISIKLSTTESQSDVLQFEYT
FT                   QDGDTIYWDMSCINLGSDSAFTKYGFSVTPSEEGDNCPSVNCEAGDTACAEAYLQPDDN
FT                   EATHGCPIDTQFTLTLG"
FT   sig_peptide     734469..734519
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F4 "
FT   mat_peptide     734520..735008
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F4 "
FT   gap             737272..737371
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(741424..741572),complement(741157..741357),
FT                   complement(740414..741084),complement(740010..740344),
FT                   complement(739585..739874),complement(738459..739410))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196366" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901855"
FT                   /orf_name="An16g03340"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK42833.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG328459"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniParc:UPI0000EFCD0E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F5"
FT                   /transl_table=1
FT                   /translation="MFTFTPLLGAQSASSKASQSILELDGGIKILVDVGWDDTFDPLDL
FT                   QELEKHVPTLSLILLTHATPAHIGAFAHCCKTFPLFTQIPVYATSPVIALGRTLLQDLY
FT                   ASSPLAATFLPKATEATHAGRILLQPPTAEEIARYFSLIHPLKYSQPHQPLPSPFSPPL
FT                   NGLTLTAYNAGHTVGGTIWHIQHGMESIVYAVDWNQARESVVAGAAWFGGSGASGTEVI
FT                   EQLRKPTALVCSTRGGERFALPGGRKKRDDLLLDMIRSTIAKGGTVLIPTDTSARVLEL
FT                   AYALEHAWRDAAGSGQGDDVLKGAGLYLAGRKANTTMRLARSMLEWMDENIVREFEAAE
FT                   EGKGVGPFTFKHLRILERKKRLEKILSDQKPKVILASDTSLDWGFAKDSLRLVAEGANN
FT                   LLLLTEPLHKERITEGQESTHRKTLGSMIWQWYEERKDGVALEKASDGEMLEQENLDNA
FT                   ADALDDRSSSTSEDSETEQQGRVLNFSTSLAHSNRNKLGLSDEDLGVNILLRRKNVYDY
FT                   DVRGKKGRERMFPYVAPRKKGDEFGEFIRPEDTADELSLAEDGEVDAAVSSEDEVEGQS
FT                   FEGPAKAVYEKATLTINARLAYVDFTGLHDKRSLEMLIPLIQPRKLILVGGMKQETTAL
FT                   ATECQKLLAAKSGMDVSAADSAVIFTPVNGEVVDASVDTNAWMVKLSNNLVRRLKWQHV
FT                   RSLGVVTLTAQLRGPEQAVLEDSTEENPSKKPKLLEEEKKEEGGSTEVATNAPPEGAKP
FT                   SADKSEVYPLLDVLPVNMAAGTRSMTRPLHVGDLRLADLRKIMQGAGHTAEFRGEGTLL
FT                   IDGMVAVRKSATGRIEIEASAQSAAATNLGRGGGSFLAVKQKIYEGLAVVSGS"
FT   mat_peptide     join(complement(741424..741527),complement(741157..741357),
FT                   complement(740414..741084),complement(740010..740344),
FT                   complement(739585..739874),complement(738462..739410))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F5 "
FT   sig_peptide     complement(741528..741572)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F5 "
FT   CDS_pept        742061..742597
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966147"
FT                   /orf_name="An16g03350"
FT                   /product="Similarity: the similarities are based on
FT                   repetetive structures"
FT                   /protein_id="CAK42834.1"
FT                   /db_xref="UniParc:UPI0000EFCD0F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F6"
FT                   /transl_table=1
FT                   /translation="MARVCIRRGGDAGSASPATGGAERFGAAEPFGAAEPFGAAEPFGA
FT                   AEPFGAAEPFGAAEPFGAAEPFGAAEPFGAAELFGAAEHAGAAEPFGAAELFGAAEHAG
FT                   AASPTAGPADVGDRAERTGGAERFGDAERAGVSDSSGSVALFLFEPFASPFFAGSTCAG
FT                   AVWCSKGGALGIRSS"
FT   CDS_pept        join(complement(743545..744172),complement(743140..743270))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901856"
FT                   /orf_name="An16g03360"
FT                   /product="Similarity: the similarities are mainly based on
FT                   repetetive structures"
FT                   /protein_id="CAK42835.1"
FT                   /db_xref="UniParc:UPI0000EFCD10"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F7"
FT                   /transl_table=1
FT                   /translation="MSGEPGKRPKAASRKTSLDSNPPGDQHVEFVNAENETPSSGVGRL
FT                   SAGRGAILANAARELQDVAARQSVGHTSNRPQPPHLGTRRSRQYEEPAVPQTWAIGSKG
FT                   KQHHRQMPAPKMVAPTQSGTGDGYTYSSYKRPPLFTQAPKNKVHRPKSPTDGHSQFLTR
FT                   TLDMFNSRNEPPAVEIDPSHEIDMPPTQYMAQEPPFSVDDGGISNHGHGGGLAVYEPYN
FT                   PALHPYPPPDPQGYGSGVPHRGKGTIDFSF"
FT   CDS_pept        join(complement(748575..749046),complement(748395..748521),
FT                   complement(748246..748284),complement(748104..748188),
FT                   complement(748003..748048),complement(746145..747952),
FT                   complement(745924..746082))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196377" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660191"
FT                   /orf_name="An16g03370"
FT                   /product="Localization: Cwh43 from S. cerevisiae is
FT                   localized at the plasma membrane"
FT                   /protein_id="CAK42836.1"
FT                   /db_xref="HOGENOM:HBG328462"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="UniParc:UPI0000EFCD11"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F8"
FT                   /transl_table=1
FT                   /translation="MSLHFHKIVQNEHYGYPDEWFPSVSATIGDRYPERSFFQVFIAIT
FT                   SGPRFALVFLWYLLTARPNSALPKLVAGVGLFRTFTCGGWTYVTSTDDHDWHDIFMISY
FT                   LVATLPWTLGCLALSPNNRRAVKYRKILASLFFGTLVPLIYYFIQHKVHKVPGAYTRYA
FT                   FFEWSLILFDVGFDAVTAFDFDAFEIVVRDVKGVSRGQLKTTADSVLEKEKGKPVGNTF
FT                   GEGFFWSEIIDAAADVYNGFVFWTLCTALPVLVWYFPLWHMGISGYEAAIVCYLSPLLL
FT                   GIPAIKSAAIKNPRLFHLLSLSGLLAYKVQDPANRLFVMGFAVICSCVTWSASLYAERA
FT                   NNVRLESRILSWSIGLIMSSVAKFACATNNPLWPIMHAQNGGWNKIGLLLAVLAVLRSY
FT                   RRPATSGGDYLPSSGKKGSPFLAGLGVGGVMFAMHYLLSDSSTMMSWVWDGYPVRGPIA
FT                   APHGAVTIFTMGAGLVYGLFYPSVAGSWTAFGLGSLGATFLTCYSHWTGYYGGLVLAFY
FT                   LLAVTPVLLSSAVRHSPASTFGVGCILYIFLILFHVWVVAYAFVPGGYLVREHTDWVVI
FT                   TIMLSIGAGVFSAGVSNASSPKPKAVSPNGRRQRSYFIYVLAVLQLLSVSIAYLRFPTN
FT                   DYTPYHKDDKVATLGIWTIHFGLDNDMWASERRMRDVIQELELDVIGLLESDNQRIIMG
FT                   NRDVTQFLADDLGMYADFGPGPNKHTWGSALLSKFPIVNSTHHLLPSPVGELAPAIHAT
FT                   LDMYGELVDVVVFHSGQEEDPEDRRLQTEYLSNLMGSSSRPMVLLSYLVTKPLEGNYNT
FT                   YVSDISGMKDIDPTDWDRWCEYILYKKLKRTGYARVSRDSITDTEIQVGKFVIGEPEPE
FT                   NEMRIPEEMVPEGRRFPTLFRGQGVRGHRYHVFDEPRYWQ"
FT   CDS_pept        join(749622..749711,749790..750881)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196389" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117178"
FT                   /orf_name="An16g03380"
FT                   /product="Similarity to diagnostic protein #23219 from
FT                   patent WO200175067-A2 - Homo sapiens "
FT                   /function="binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK42837.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG328463"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013949"
FT                   /db_xref="UniParc:UPI0000EFCD12"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7F9"
FT                   /transl_table=1
FT                   /translation="MSAATDKARFFLEKSVPELKEFERKKIFSKEEITAIIKKRSDFEH
FT                   KLNARGALPVDFVRYAQYEMNLDTLRRKRVKRLGIRSAGYTGQRRIFFILDRATRKFHG
FT                   DVGLWVQYLEYAKQQKAYKKVSTILTDALRLHPANVDLWLYAAQYSVDEHADMTQSRGY
FT                   MQRGLRFCKSSKKLWLHYAKLELIYIAKLVARQRILGLDKPIEAPKPAQEDDLDADMIA
FT                   MPKITGEDINPGAGEDGGVDQVALDNLANTPALSGAIPLAIFDTAMKNFENDDRFGHEF
FT                   YDMAVEFDDLPCLHKILGHVVDVMQQTKPNSPHTQICYIKFPTAGLRVTSPEFPRAFSA
FT                   SFARLKEYRNNPNVAKEIVSWLQPLEKTEGVDASLQKAISATIRNAERTVQEA"
FT   CDS_pept        join(complement(751511..751977),complement(751169..751429),
FT                   complement(751008..751095))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117179"
FT                   /orf_name="An16g03390"
FT                   /product="Remark: about the patent EP1033405-A2 is no
FT                   further information available."
FT                   /function="translation release factor activity "
FT                   /protein_id="CAK42838.1"
FT                   /db_xref="GO:0003747"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniParc:UPI0000EFCD13"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G0"
FT                   /transl_table=1
FT                   /translation="MSLFLSVLPAAARHLPSPRAATATTTATTTATTTATTTATTTATA
FT                   TAANMLRANHVSRGLESIMAHARLSLPRNFHRVSLACYYPPSSRPTVATRTFASRRAAA
FT                   ISTPSGLDSDHHLSAAREWAARLNSKAITIPRDICEISFSRSSGPGGQNVNKVNSKATL
FT                   RVPLKSLLPFVPQLLHAPLQASRYVAAKSQILVIQSDESRRQTANVEACYDKLHQVLKS
FT                   IAEDTIPGETSQEQRDKVQKLKKAANEARIKSKKLHSSKKSSRRGSYDD"
FT   mat_peptide     join(complement(751511..751908),complement(751169..751429),
FT                   complement(751011..751095))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G0 "
FT   sig_peptide     complement(751909..751977)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G0 "
FT   gap             753629..753728
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<753746..754553,754615..754794,754854..755346,
FT                   755417..755637,755702..756249)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196411" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117180"
FT                   /orf_name="An16g03400"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="translation"
FT                   /protein_id="CAK42839.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG023597"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EFCD33"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G1"
FT                   /transl_table=1
FT                   /translation="PASLLAPPPPDVPPSSSHAAQDTPSASEVDHAVASWTAQPAPQTR
FT                   LEPQSKADDNTGEDGVDFQNLLDNLPPSSTAPSAPAVSETAPLSADVSALPQAGTDDEA
FT                   LQSSLGLPPRPPPQEKPSIHPNYNASDDIRSYHQLPPNTSNAQSSPSSTYTAQQSNYQS
FT                   NLGLPSLAAAGAPGTSSGASALPPPPVPSFQQSTSTTSESQGSPGPVNNRKAGSERVVA
FT                   RQNKGSDEDTPWGPEVQKKYDEFLHDERIYVTEGLWDRFPPGSRLFVGNLPTERVTKRD
FT                   LFHIFHKFGKLAQISIKQAYGFIQFLESSACKQALDAEQGAVVRGRKVHLEISKPQRST
FT                   RPGAAPAEPSRAPPRRSRSPEFSRSGPSGSRSTRAPADRYDRPYESGRVPFSDFRDEPG
FT                   HRRRDDYRPPPPPRSPSPRAFRARDGYRSRDRTPERYDRRERRRSRSPYTRDRRYRSPS
FT                   PRGRGSYESDADLPVPRRAPRDVPEVQILVLEELDRNFIFFVENSFRNRGLRVDVLVLG
FT                   PRIPLNAAVQRQIQEGVLAVVRLSRPSQFSRKIPLQVFDRSGGPDNVRSNEYPDVEPSI
FT                   AAEIVFHAQSMQRGAPPAPFPPNPAFGIPPLPAPAATVPPQAPLPTVANQPSIANLITS
FT                   LDAPTLQSLLGVLQQRPPAVPTAQQPFPSASTPHGAADLASLLNAATRQPVAANPQQPL
FT                   PPQPFPLQAPNAPLVSDPNLISLLAKGLGGQQPQNQAAVGPQVQNIMNQLGKWKQ"
FT   CDS_pept        join(complement(757076..757300),complement(756811..756933))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196422" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901857"
FT                   /orf_name="An16g03410"
FT                   /function="cytochrome-c oxidase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAK42840.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG324232"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="UniParc:UPI0000EFCD34"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G2"
FT                   /transl_table=1
FT                   /translation="MGWLPWSSDSSNTASDGGRIAPDRTSRQRCYEGRDMFFSCLDRND
FT                   ILDAIKDDKEARRKCGKEIAEFETACSRAWVKYFKEKRVMEYNRDKTIERIKKEDAAQV
FT                   QELKAQGWNSR"
FT   CDS_pept        join(757740..757987,758054..758468)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196433" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812981"
FT                   /orf_name="An16g03420"
FT                   /protein_id="CAK42841.1"
FT                   /db_xref="HOGENOM:HBG446678"
FT                   /db_xref="InterPro:IPR019185"
FT                   /db_xref="UniParc:UPI0000EFCD35"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G3"
FT                   /transl_table=1
FT                   /translation="MPPRRRAPRAGSRTDLPPLKIVRKILLLQVAYYVTATALILFTTV
FT                   VYGTPFSLDLVFSWNALRGDTTIGWMLGLVWLLTSGIGVIFLLLLVARSKLIPDFALTL
FT                   HFLHLIATTLYTHSVPANWLWWGLQGASAAFMTFLGIWACRWRELQPISFGGIGGGSSS
FT                   GGGISAGASGGGEAQSGAGGEESFSLSRGRGRGRGLRDSSSGGDEYEMVEMKGDAAV"
FT   CDS_pept        join(759723..760008,760085..760345,760409..760541,
FT                   760599..760767,760821..760895)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901858"
FT                   /orf_name="An16g03430"
FT                   /function="metal ion binding"
FT                   /protein_id="CAK42842.1"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG289811"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniParc:UPI0000EFCD36"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G4"
FT                   /transl_table=1
FT                   /translation="MSATVTETTTNPVPVVVAADNNTTSKTHIEDAANDKDFQSVARGN
FT                   RAGTLKLRGIPTFSDPAAKRQWMKEHMAAAFRFFGKKGYGEGVSGHISMRDPILKDHFW
FT                   MNPFAKHFSTIKASDLVLVDAEGYVTEGGAQLPINEAGFMIHSEIHKARPDVIAAAHTH
FT                   SIYGKTWSAFGKPIEMLTQDACNLYGKVGVYEDHGGIALAQEEGEQIARALGKDNIACI
FT                   LQNHGLLTVGRTVDEAAFLYFSLDNACHTQLLAEAAAANGVPKRIISNEVAKYTADVAQ
FT                   NHHNFYTEFQPEYELIVEETNGRVLQ"
FT   tRNA            complement(761166..761277)
FT                   /gene_name="tRNA-Leu (AAG)"
FT   CDS_pept        761977..763404
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901859"
FT                   /orf_name="An16g03450"
FT                   /protein_id="CAK42843.1"
FT                   /db_xref="HOGENOM:HBG328466"
FT                   /db_xref="InterPro:IPR019465"
FT                   /db_xref="UniParc:UPI0000EFCD37"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G5"
FT                   /transl_table=1
FT                   /translation="MADGEPSYIDYEAFLDPEFSPASFANTLVVATNNATDTPLDLSTP
FT                   LSRVLFDLQEIDTHIHALTTKSALPLLTHTRDQTAAAGRILKEAEEQIASVTQGYERLE
FT                   REVLRKWEAADEARVAAEKSLATVRLARAVARCLSLGRQLESQLAEIGGLDATAPAKDD
FT                   YRTLERAASTIVSLRRMFSETAVGEEGHGLDRVKVIRTLRSELVIPAENMVKTRAQQAI
FT                   GRFTMSTIASAGSGSQSQMSYKQARDARARLVSAVNILYLLSPVPKNVTSAATFQPDLL
FT                   LSTLQGYMQTAISSSLSNLTRALSMLPTLERTLSDLSARCQDIFALEAILSNLRPPSHP
FT                   LFPPTAPAAAAGTRNGEQPEPQAQATGKNNLLQPLLNALDTSSLPSYFWRSLASYLAAR
FT                   VQEIINRGGVSARTLRSNRDRIKREVKDCVLRGSQLPSSILGTEKRLGVDSGLERSWER
FT                   EAAVMVSSIANVLDRQA"
FT   CDS_pept        join(764363..764467,764526..764566,764703..764721,
FT                   764819..764890)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660192"
FT                   /orf_name="An16g03460"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK42844.1"
FT                   /db_xref="UniParc:UPI0000EFCD38"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G6"
FT                   /transl_table=1
FT                   /translation="MFVYVFGRGDVKISSAERVKQLYILTYGGRIKGRKGGKCFAAGEK
FT                   NHIICQVYWRVHPSLATQVPALYSISQRVAQAD"
FT   CDS_pept        join(765148..765226,765453..765626,765696..765756,
FT                   765799..765809,765933..766110,766199..766364,
FT                   766434..766478,766533..766649)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901860"
FT                   /orf_name="An16g03470"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   12F11.190 - Neurospora crassa"
FT                   /protein_id="CAK42845.1"
FT                   /db_xref="UniParc:UPI0000EFCD39"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G7"
FT                   /transl_table=1
FT                   /translation="MDAQAVPVIADIDVSDTTGMGQTRVTCFRKMRGKAEEKDGGAMIN
FT                   GLGLLVGEAWYLYLCVRPCSCALPALGPVHWWIARLAVPHERFHPLFAFDPGNDGEIGL
FT                   GAEEARPGMDSLSAELEDFQKQLEIGCQSGLERRIHGSKTPTIPSIKPVRETNALFTSL
FT                   LITVKLRIPAHGDSRESCCQPVRCFFSNLHTGEHIITLACGVNCPRAPPDGLLFVPHQP
FT                   KEMRAAAGCPTLTLLQFKEEPYQCPERGHDGSCWGVNAVLFVNQEQASSQLVRA"
FT   CDS_pept        join(complement(769949..769998),complement(769850..769905),
FT                   complement(769630..769756),complement(769178..769232),
FT                   complement(769003..769036),complement(768840..768958),
FT                   complement(768692..768755),complement(768068..768250),
FT                   complement(767766..767944),complement(767538..767655),
FT                   complement(767375..767462),complement(767248..767281))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117181"
FT                   /orf_name="An16g03480"
FT                   /product="Similarity: the similarities are mainly based on
FT                   repetetive structures"
FT                   /protein_id="CAK42846.1"
FT                   /db_xref="UniParc:UPI0000EFCD3A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G8"
FT                   /transl_table=1
FT                   /translation="MAMTCLAECPTKMAKQGCEDASLTDRPGREEVGTAGKEAAATAED
FT                   EDVVVGGGGQRWLFGEIWRTQSSFPPTSSPGCGLEKEGWEEWKGKKDDGQRDEDDGNPP
FT                   PQTETLQEMEKQLEADRKQRSIRQRAAKRGAQTGKDEKKKSSEGERVKKETKQASRGGG
FT                   KTGGESTDDLVRTDGHESSIARPVEMLQLDEFMSQSRRRLEPWICLSDGKLTVGFCFIE
FT                   WSSVGTPEMRGWTPRIITARTRRYEPRIRNPALSNRQSRRRAQDGLAARAPSKGLNIFE
FT                   NPNPIPIRGPSWTVHKTEEARPRDGEAPGTAASGAPQREGIDRLLFPGADQKSSADGPR
FT                   AATRGDVNHSMLPRPFVWKRRPEPNVAV"
FT   CDS_pept        join(770431..772236,772293..772457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117182"
FT                   /orf_name="An16g03490"
FT                   /product="Phenotype: overexpression of RGM1 gene greatly
FT                   impairs cell growth"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK42847.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG324231"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EFCD3B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7G9"
FT                   /transl_table=1
FT                   /translation="MSSFLPVNNISSPPDRVMEEATTSSTPRPHAKPSAAPQDTTSSMI
FT                   AAHDESTPRNINSIEDSHHHADSQGSASLTSDDAVHGESDEGSEHEAENKGGAPPSKKK
FT                   KGQRFYCTDFPPCNLSFTRSEHLARHIRKHTGERPFQCHCSRRFSRLDNLRQHAQTVHV
FT                   NEEIPGDSLAATGTRFQRQIRTDRVRPQGRARAGTAGSQGTHSRGHSRNLSASSITSTA
FT                   STFSQPQELRRRPPPLMMANDRARLMEPMDAPSTPPARGIPGPAAGGSPYTPSHHIFSA
FT                   GGNGSPHVASPISTASQASGFWEGKTAARRLSVPTGANPFASQHVNAYPPNYVPTQAYG
FT                   PHGGVYASPVSSSYSLSRDETSHGATDADLRRRTWHPSTWSTVPRPATSGLSNYQTPEV
FT                   FKPSFGANGSAEQPPRLPGIESFDKVVAQRPLTPPVRRSSPMQIDNPNKPPPNYNIAGG
FT                   YNYTQPAKRPAPPISGPGHRRGHVSWDMSLHTNLTGLHIRDKPPQRDASNWSQQTIAEI
FT                   HNVGSRPSSSYQPQFHEYRGHGHAPSYSNATSSSQATRTSPEDSSSSEGVHTPSTASLE
FT                   YHPAIVHNNGYVEPHHPPFSSDTSHAACPPLPPQTDSYHGKHDPRSEFLPHTAREPGMG
FT                   RLEALVAVATSENKSAAKLFL"
FT   CDS_pept        join(773947..774058,774125..774225,774304..774474)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196466" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901861"
FT                   /orf_name="An16g03500"
FT                   /product="Similarity to slow myosin heavy chain myoHC-A4 -
FT                   Notothenia coriiceps"
FT                   /protein_id="CAK42848.1"
FT                   /db_xref="UniParc:UPI0000EFCD3C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H0"
FT                   /transl_table=1
FT                   /translation="MSKNPTALYLGIAALGAGGYYMYRAGGDPKVAKEEMRHDAHLARL
FT                   KAPTGDQAEKAGEKAAYETRLNVDEAIDTASKDAKDSMNRLEKIGRDTTAELRSGAEKL
FT                   EGKVEEKAAEAKGTVSGWFGGKK"
FT   sig_peptide     773947..774003
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H0 "
FT   mat_peptide     join(774004..774058,774125..774225,774304..774471)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H0 "
FT   CDS_pept        775533..777011
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966148"
FT                   /orf_name="An16g03510"
FT                   /product="Similarity to hypothetical protein CAD70874.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK42849.1"
FT                   /db_xref="HOGENOM:HBG328471"
FT                   /db_xref="UniParc:UPI0000EFCD3D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H1"
FT                   /transl_table=1
FT                   /translation="MPRSYSTRQAARGLQQQQQPGIQNFARATKPGVVAPSSLSDIKKP
FT                   STTTTTINVPVTPSKKRKLVELENVDCRGPQGPESTDAVTPSKTLRLGELTLNTPRSGH
FT                   YARSPVSVRRSGSAATAVTEQPPGTPSKRAGTRKTTKKPAPVNRRAASVEDFVNLHAAF
FT                   LKAVALHAMHNGVSAPADLRELLPTIERLWKKRKVVVKDLQRLVWVLDQEPSSTAFPGY
FT                   RIANYGLGRVCLERIAREGEERASENELQERFEQSVDLLWEKALDAVDGDESRVDFVNT
FT                   LGVAMIHESLTPFTTFRKGQQRLQDLKGGVIRLKTEKLRADGKDDAPEKPIDAASTRRK
FT                   GLLERIKDKQLRQAKLPPPPSKQELLRRAAAERVEEVAGVLALLRPAGYVGTGAKAVMA
FT                   AQRTPFRMEMIAQNVQDSARSPISQQEVEICLEILAREDVAGEWVNLVTVNQMKSVVLK
FT                   SCADVQPKEIGAKVAQLKLGWEGTEAQKTIISAA"
FT   CDS_pept        join(777435..777458,777530..780343)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196498" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660193"
FT                   /orf_name="An16g03520"
FT                   /product="Complex: heterodimer of MSH2 and MSH6 "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /cellular_component="MutSalpha complex"
FT                   /cellular_component="MutSbeta complex"
FT                   /protein_id="CAK42850.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="GO:0032301"
FT                   /db_xref="GO:0032302"
FT                   /db_xref="HOGENOM:HBG315065"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR011184"
FT                   /db_xref="UniParc:UPI0000EFCD3E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H2"
FT                   /transl_table=1
FT                   /translation="MSSRPDLKVDDEVGFIRFYRSISSSSDNDNNNNETIRVFDRGDWY
FT                   SAHGAEAEFIARTVYKTTSVIRNLGRSDTGGLPSVTMSVTVFRNFLREALFRLNRRVEI
FT                   WGSASGRGGQWKLIKQASPGNLQDVEEELGSVGGLNIEAGAPIILAVKISAKAGEARSV
FT                   GVCFADASVRELGVSEFLDNDVYSNLESLVIQLGVKECLVQMDAGRKDVELGKVRNIMD
FT                   SCGIAVSERHSGDFGVRDIEQDLTRLLRDERSAGTLPQTELKLAMGSAAALIKYLGVMT
FT                   DPSNFGQYRLYQHDLSQFMKLDSSALRALNLMPGPRDGSKSMSLFGLLNHCKTPVGSRL
FT                   LAQWLKQPLMDKAEIEKRQQLVESFVMDTELRQTMQEEHLRSIPDLYRLAKRFQRKQAT
FT                   LEDVVRVYQVAIRLPGFVASLENVMDEQYQTPLEAEYTSKLRSHSDNLAKLEEMVETTV
FT                   DLDALENHEFIIKPEFDESLRIIRKKLDKLRHDMDSEHRRVGGDLDQEVDKKLFLENHR
FT                   VHGWCFRLTRNEAGCIRNKREYQECSTQKNGVYFTTSTMQALRREHDQLSSNYNRTQTG
FT                   LVSEVVGVAASYCPVLEQLAGVLAHLDVIVSFAHCAVHAPTPYVRPKIHPRGTGNTVLK
FT                   EARHPCMEMQDDISFITNDVSLIRDESSFLIITGPNMGGKSTYIRQIGVIALMAQTGCF
FT                   VPCSEAELTIFDCILARVGASDSQLKGVSTFMAEMLETSNILKSATSESLIIIDELGRG
FT                   TSTYDGFGLAWAISEHIVTEIRCFGLFATHFHELTALADRYPKSAKNLHVVAFIGDGTG
FT                   NEEDSKDSKRDQVTLLYRVEPGICDQSFGIHVAELVRFPEKVVNMARQKADELEDFTSS
FT                   GAQEKESMSLDKYSQEEVEEGSALLKDMLLKWKEAIEAPGKDLTVEEKRQIMRDLVNSD
FT                   PKLQANKVFQGIKAL"
FT   CDS_pept        join(781276..781443,781473..782607,782663..783124,
FT                   783177..783262,783311..783611,783781..783824)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901862"
FT                   /orf_name="An16g03530"
FT                   /function="phosphatidylinositol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK42851.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017176"
FT                   /db_xref="HOGENOM:HBG328472"
FT                   /db_xref="InterPro:IPR007720"
FT                   /db_xref="UniParc:UPI0000EFCD3F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H3"
FT                   /transl_table=1
FT                   /translation="MLMSDGLLRVFWPYDLPRSSSPGVIVGWRNSEVDFFVLTVLEDVE
FT                   VISGYTAFMLRPRNVDNALRAGILFRNSPHPIVRIFALCGRSAMHVLGSTNSPDPPTAF
FT                   NPSHLYVTTSSSGKVPRIFCPPETNLSVQVIMFHRPHPTRMEYMSLEPISLALGDKVFG
FT                   SDKSDAVSNKIDTEEESDKAQAGMLVEKLKLHTVVKHVPSSKEQALPLIINQVNCAYEM
FT                   GKLMEKNSHLVGIRVKRSMSVGERVVESATTLWDLFVLGVSYVFWQWIWPVITRIFIVG
FT                   LVFHRTIAEIVLQILEWRARPDAAALKDISATAQQVDIRLQQFCYWPIQYVKLRQRKDN
FT                   WESVTTSHPDYIRFYNSLWLVANDVIIGIALGSYIIDNANWVAFQISFILTGYTVEGLQ
FT                   GTISWLMDWPAGLKLNNELAAFLGDLFLWVIENWAACIANLQPYLPHIIYVVGCSSFAG
FT                   ASMPIALFSDLISILTVHIYSFYIASARIFNWQLTIIISLFHLFRGKKRNVLRNRIDSC
FT                   DYDLDQLLLGTILFTVLFFLLPTVIVFYLAFASARMLIISLKAVLDTCLAFLNHFPLFA
FT                   LMLRVKDSRRLPGGIRFELREEHDKSSTSKSSVSVPYIHLESIPLTLRAMFDQYFQLGH
FT                   RLRKHYLSPQVIFCLVTGRFVPPIHRRNLYGMQYSMLPARRASMTEVWSMLTQPRKTSS
FT                   SSSSSSSMVGGMGTAANGILKVPDTTGMFDATVKLLP"
FT   CDS_pept        784882..787230
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901863"
FT                   /orf_name="An16g03540"
FT                   /EC_number="3.1.13.-"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="nuclear exosome (RNase complex) "
FT                   /protein_id="CAK42852.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0000176"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="HOGENOM:HBG328473"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012588"
FT                   /db_xref="UniParc:UPI0000EFCD40"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H4"
FT                   /transl_table=1
FT                   /translation="MDSTADFGSLQQRVQSSLMQVTRTAGQLSAEDLDFHRTSNAEVSD
FT                   SLDEQSNRLLSLTSSILKAATAGTDVSAPTLDDEDSLEDNWRGVVDVIDALLEKADACL
FT                   DEFTGVIKKLSPSQQDQAAAAAAKASKKQPAKFPTIYDYGPSKIPKPQLLFERKADNTD
FT                   TAPFKPLLKTKPHAVVPLKDSLKLSDSAVGYVNPYEKEIRAAKFPTSSYSVSPPVDYQP
FT                   WESTKATFVDTLEGVKEMLEELKAAKEIAIDLEHHDVHSYQGLVSLMQISTRDKDWVVD
FT                   TLKPWREELQVLNEVFTDPNILKVLHGSSMDIIWLQRDLGLYVVGMFDTYHAACALNYP
FT                   KRSLKFLLQKFVNFEADKRYQMADWRIRPIPEGMFDYARSDTHYLLHIYDHIRNELVEN
FT                   SLPDNNLIDYVLEQSKKEALQVYERPVYDAATGQGPGGWYDLLSRNSVVVNREQFAVFK
FT                   AVHQWRDEVAREEDEGVQCVFPKHVLFRVAHTMPLDLGTLFRTLSPVTPIVQNRAVDLL
FT                   EVIKKAKDEGADGPEWRDVYVKPTRGTPAAPATQPVDVPSPTPADEANLPTVSRYEVSQ
FT                   FWGSVLESQEPPTVPAYSAVASAEALRLSLPLPPMPKTVSEAREKLAPAQPQTPKPATS
FT                   APAVKEEKKEDENKYFTVKEMGGPRKRKAAPAETAEQLQSASSDFDTTDASSSLDTEDK
FT                   PSKKQRRKEKKNKPAAQPETAAEEDGEEEEEEAPFNYESAASVFNANPKATSGLPSRRR
FT                   YNPYAKVLDAPSGVRKQKRETAGKAFTFR"
FT   CDS_pept        join(complement(788231..788411),complement(787915..788131),
FT                   complement(787708..787841),complement(787537..787618),
FT                   complement(787431..787467))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190538" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966149"
FT                   /orf_name="An16g03550"
FT                   /protein_id="CAK42853.1"
FT                   /db_xref="HOGENOM:HBG736553"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="UniParc:UPI0000EFCD41"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H5"
FT                   /transl_table=1
FT                   /translation="MSSLRTTYLVTYNSINALLWLYIFSSIVVSPFQSPQTTYSTLEPW
FT                   TRWTQTIAILEILHASLTRSPIFTTFTQIFARSVQVWAINYAYPETTSPSPAYKYMLLA
FT                   WSFADAIRYSYFAVLSAGAPVPSLLRWLRYSLFLILYPVGIGSEWWLMFQALRVTNSIP
FT                   VQALFIFFLFLYGPGSPMMYSYMVKQRKKTLAGGKKERKENKVDVVVAGDMVS"
FT   CDS_pept        join(789365..790019,790080..790162,790305..790619)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901864"
FT                   /orf_name="An16g03560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42854.1"
FT                   /db_xref="UniParc:UPI0000EFCD77"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H6"
FT                   /transl_table=1
FT                   /translation="MASSHSAVNPEVTGPSLSDFPESIRNKIVLVNIPAVEVQALIEKE
FT                   CPPMLQRIAPYGVNWMRHVMYNTIPKEIRVYAYLHYDMAQPDWYKKYGPATLLSRYNTH
FT                   RIELEQEVSEEQARSMLRFYALVQYYAKELTEDTIRRQQGKNPEYVLRNTSRTEMLRVE
FT                   RAIYIHDILLQAMTTIPRHTMTRKEANAPWRSFLGNFTGWMLYQLITVTNLLHKYDEAR
FT                   CKADHVELQCALNTFSKENDRNYLKAAGNSILSYTWAKLENSDPEFNKQKFSPNTDPAI
FT                   KRMYDPFVFIEEDNGPHRLWYEIAEERPANPDTMMGQFYSGSGHPQYMLFMWDEARLRE
FT                   MGYLSGDDSP"
FT   CDS_pept        join(complement(795847..796024),complement(795571..795666),
FT                   complement(795348..795448),complement(795163..795237),
FT                   complement(794881..794931),complement(794438..794548))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901865"
FT                   /orf_name="An16g03570"
FT                   /product="Similarity to hypothetical protein pr1 -
FT                   Cytomegalovirus maastricht"
FT                   /protein_id="CAK42855.1"
FT                   /db_xref="UniParc:UPI0000EFCD78"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H7"
FT                   /transl_table=1
FT                   /translation="MRTIRAVVAKFMSLTTTDHLEQSKRVQRRNADVPKTPLSDVWEGC
FT                   SCRGERAIGASSVHGLTWRAAKIGGGNNSESERDGGVVEEIKEMGCGRRKDAGRMQRKI
FT                   NQGNLPRKQVTNQQGEGIGMTNAVGYQSGKLTMGEGDYDDDSRTKRGGVGFRDLQRTGW
FT                   RAKQRGGERKGKKGTEHRVAQRLNGLHEGPLSTQAAPETQ"
FT   CDS_pept        join(796150..796354,796422..796555,796605..798447,
FT                   798504..798664)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196536" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660194"
FT                   /orf_name="An16g03580"
FT                   /product="Function: sar1 of S. pombe encodes a product
FT                   capable of regulating ras1 function "
FT                   /function="Ras GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK42856.1"
FT                   /db_xref="GO:0005099"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG324230"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="UniParc:UPI0000EFCD79"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H8"
FT                   /transl_table=1
FT                   /translation="MSVATMLQPASRASTSSSSSFQPVTRQNTMSSHDTRSLRQSKRLS
FT                   VTALYMSMNAKDRDLDISDDLARAQIYLRELKAKISTQSKKNFVLEKDVRYLDSRIALL
FT                   IQNRMALEEQNEVASHLDDAIDPQEGFFPNDERTQKYGNLLFLLQSEPRHIAHLCRLVS
FT                   MSEIDSLLQTVMFTIYGNQYESREEHLLLTMFQSVLTYQFDNTPEYSSLLRQNTPVSRM
FT                   MTTYTRRGPGQSYLKQVLADQINALIELRDVDLEINPLKVYETMVKQIEEEQGSLPESL
FT                   QRSVTAEDAAANAQVQAIIEPRLKMLTDYANRFLNIIIESVEETPYGIRWICKQIRSLS
FT                   RRKYPDAQDQTICTLIGGFFFLRFINPAIVTPRSYMLIESTPTEKPRRTLTLIAKMLQN
FT                   LANKPSYAKEPYMAKLQPFIQQNKERVNKFMLDLCDVQDFYESLEMDNYVALSKRDLEL
FT                   QITLNEMYATHALLEKHSLALAQDQHSHLNELLQELGAAPPQVPRKENRTITVPLFSRW
FT                   ETSLDDLTAALDITQEEVFFMEAKSTFVQILRSLPPKHPAMRRPLRLYLIAESAATLKN
FT                   DAVMVRKGIRTIELLDQLMKLGVIERANDFSLLRDEVEQELEYLGGLKENVLKETKKLE
FT                   EVFATIRDHNAYLVGQLETYKSYLHNVRSQSEGKQRKQQKHQELGPYKFTHQQLEKEGV
FT                   IRKSNVPENRRANIYFMFKSPLPGTFVISLHYKGRARGLLELDLKLDDLLEMQKDNQED
FT                   LDLEYVQFNVSKVLLLLNKRFARKKGW"
FT   CDS_pept        join(800367..800587,800808..800931,801008..801631)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966150"
FT                   /orf_name="An16g03590"
FT                   /function="transporter activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK42857.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG328476"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI0000EFCD7A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7H9"
FT                   /transl_table=1
FT                   /translation="MAAPQSKYDDYDFPTTAPEAQPGHPGHTTPEQDAKVEQLRAELEQ
FT                   LGYTERLDTLTLLRFLRARKFDVAAAKTMFVDCEKWRKEFGTDELVRTFEYPEKAKVFE
FT                   YYPQYYHKTDKDGRPVYIEKLGKIDLNAMYKITTGERMLQNLVTEYEKLADPRLPACSR
FT                   KAGKLLETCCTIMDLKGVGITSVPSVYGYVKQASAISQNYYPERLGKLYLINAPWGFSS
FT                   VFSVVKGFLDPVTVNKIHVLGSNYKKELLAQVPAENLPVEFGGTCTCAGGCELSDMGPW
FT                   QESEWAKTPKWAAPKEPAAEAPAEAAAEAAAEKEAEAQATA"
FT   CDS_pept        join(complement(802989..803165),complement(802214..802900))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812982"
FT                   /orf_name="An16g03600"
FT                   /product="Similarity to hypothetical protein SPAC688.02c -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK42858.1"
FT                   /db_xref="HOGENOM:HBG328477"
FT                   /db_xref="InterPro:IPR013950"
FT                   /db_xref="UniParc:UPI0000EFCD7B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7I0"
FT                   /transl_table=1
FT                   /translation="MSTDHHRKIELQSPADFTYLYANTVALSRAKLDLHLPPSANPNDG
FT                   PDPMRERVRELVDEYINRTFNSASPSISINGLDSTSPEWPFPAAFTAPTEQVEYEAYDG
FT                   KLASRVTSLYAQLESLTTTVAQLRRDAPGRAAKAYAEQLRRALREDEQETEEEEEEEEE
FT                   EMKEEEDEEGQQQQGGDQDTEMTDAGSTTASTQRKGPMTRSRAKLEVSLGTENEAERWR
FT                   SGEMAEVYEDALRTLLRLQGEGVSGAEVDSSGDGADGNALSSTLGKAERAGRAVEVVEK
FT                   KKDKKK"
FT   CDS_pept        join(803847..805010,805105..805494)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901866"
FT                   /orf_name="An16g03610"
FT                   /product="Similarity to hypothetical protein SPAC1296.04 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK42859.1"
FT                   /db_xref="HOGENOM:HBG324229"
FT                   /db_xref="UniParc:UPI0000EFCD7C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7I1"
FT                   /transl_table=1
FT                   /translation="MDNNDQSNTSSSIALIDNTAPRRRHSETPTATTNGGSHVSRKWTK
FT                   RSIRGELKKRKYAKWQPDRLGLTTDDEDNDNYNYNNNEGEENIPSSSRRPSERPETDLF
FT                   TTETATTTSNPPSQYQSQSDSQSRSPSQQPSPPSHDISATDFAPESTLTNTTTTHSHGP
FT                   TKLTGLKPNTELDILYENQRGWFFFGIPLYSHSSLLNFDPSAWQTADLRDSPVDITNAQ
FT                   VPDPSWVWAWRSWYVDMSGDVDDQGWQYSFSFKSTAWHGSHPWFHSFVRRRRWVRVRTK
FT                   RLVDRHGRTGLEMAHRLNEDYFTIHSGKKKKRPVSEVGGGGYGATSLGRTTTATTAREE
FT                   EEVPIEEIADVPALMHALRVAIVDREKVDALDRFVEEGGEELFYLDEKIPEIMSMFVFQ
FT                   ASRWHFVIHLTDVVESLSQRLSSASGNEATELQRKLNHLQKATETARRHLTGPGVLRTE
FT                   NRKSSMEMLDLTPVSKRGSLLARYSGRFEFKSMDDGGEIKGIPKEAEVGREGHIFQYSS
FT                   "
FT   CDS_pept        805872..808343
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196580" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117183"
FT                   /orf_name="An16g03620"
FT                   /product="Similarity to hypothetical protein CAD37049.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK42860.1"
FT                   /db_xref="HOGENOM:HBG324228"
FT                   /db_xref="UniParc:UPI0000EFCD7D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7I2"
FT                   /transl_table=1
FT                   /translation="MLSRGRPCLKRRSLSTVLDTVAASPEEPLLFLYPRWVGSAVRQRR
FT                   LVSSASQCGNGKANAYNAGRRTVARQPPPPPPAGRKLSFGSSSRRWVSTTAAEAAVKTE
FT                   VKGEDVPPEQGKSADVNTPQKGKRGEENTDTGSASIYNELDNDPQTEVKSERHVFNIFS
FT                   DLQTRPVQPTAGRKGMRSSGEPTPAIALKRLSHRDRRKLRYRLFLTKQSQGRDKAKNNQ
FT                   WNKWTKIREMLEKMHEDTHVWAKKGVKQKELLVPEETIALLAGVTDMALKENVWYVPVH
FT                   NGCKVHVLRPLQSQGQFRRVILSGSERVVELVSDRIAQARRLQEQSDPLVDIQIPLAPI
FT                   IPSIEAMKRQGAPVPLVRGVWDIQSAVKQAAKLHMVLPAGKNLSGIRDFAEHVEELTRS
FT                   KPSYNSKIPYSHQKQVAKALVQLFRNETYSSFMSTAALNRALSYLLDHEFLNAARDIFL
FT                   KSEHLATVDTFNILLKSAAKRQDLRFFRQFLLAMSRLSIRPDPNTWLTLLDCLVAPKAK
FT                   ADLVTYMLQRGYLENMGAMRTALHLTLPNTFRAHLESGKSVDSFIRQTADSCGDSCFVP
FT                   SLISQMFGVIVRLKDFAALDRLFEICKQNDLTFNSATITQILSLFRADMPTALRYLFRC
FT                   LERPETKLERHAWERLFLVAFKGQYYNICRVLWRYACMSGNVTYKMKRTVVTSLIRNVP
FT                   RKPETNVHTIWDVSAGKVIVGLDLHRPDHKLQTTVLDKLPREYRSNPIAYLSSGYKPSG
FT                   EEREQQIQVASALTQHDIEIGSWHRPQFPLLIMLEAASVLDQEWRKVPRPVHWLVQNAI
FT                   RVPVRKSMYPA"
FT   CDS_pept        join(complement(809063..809476),complement(808703..808978))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901867"
FT                   /orf_name="An16g03630"
FT                   /EC_number="2.3.1.-"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAK42861.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000EFCD7E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7I3"
FT                   /transl_table=1
FT                   /translation="MTSNPSTTDTTTPTSTNNTTTPLRYIRYNAAHEDTYVPAMRQLIS
FT                   KDLSEPYSIYVYRYFLYQWGDLCFMAMDDNNSELQSSSPMVGVVVSKLEPHRGGPLRGY
FT                   IAMLAVREEYRGQGIATKLARMAIDAMVERGADEIVLETETTNTAAIKLYERLGFLRSK
FT                   RLHRYYLNGNSAYRLVLYLKEGVGSMRTNMDPYAQQTGPPYPLIEDRTDTVVTAPEPAL
FT                   LHENGKW"
FT   CDS_pept        join(809759..810073,810146..811553,811619..811706,
FT                   811747..811785,812132..812168)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196602" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812983"
FT                   /orf_name="An16g03640"
FT                   /EC_number="2.3.1.43"
FT                   /function="phosphatidylcholine-sterol O-acyltransferase
FT                   activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAK42862.1"
FT                   /db_xref="GO:0004607"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG328479"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="UniParc:UPI0000EFCD7F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7I4"
FT                   /transl_table=1
FT                   /translation="MLRRRVAKDKDGVSASPSPSDSRDIPDSNSSAPQKPKAESFVTKP
FT                   RSKRRNGLIFVLGGLFGVLVAVLFANQQDVISLDSIMDLNLESLMDVMPQGLLSDVKEF
FT                   TQHERDTVNYDSFSVGLQLQAEGVHAKHPVVMIPGVISTGLESWGTDANSRQYFRRRLW
FT                   GSWSMMRALVLDKTEWKNHIMLDKETGLDPPGIKLRAAQGFDATDFFITGYWIWNKILE
FT                   NLATIGYDPTNAFTAAYDWRLSYPNLERRDQYFSRLKSYIETAVLVGGEKVTLASHSMG
FT                   SQVVLYFLKWVEHPDHGAGGRDWVNNHIANWINISGCMLGAVKGLTAVLSGEMRDTAQL
FT                   NAFAVYGLEKFLSKEERAEIFRAMPGISSMLPKGGEAVWGNATWAPDDQPNQSQSFGTV
FT                   LNFRETNSSHSSKNMTVAESLNYLFDESETWYRNQVLSSYSHGVAHTAREVEENENNPR
FT                   TWLNPLEARLPLAPDLKIYCFYGVGKPTERSYYYQEERDPLVNLNVSIDTTVTNNDGVD
FT                   HGVLMGEGDGTVNLLSTGYMCAKGWRMKRYNPAGVQVKVFEMPHEPDRFSPRGGPNTGD
FT                   HVDILGRASLNDLILRVAGGQGDQIEETFLMMNGRDRCIVILKKTQILPIGA"
FT   CDS_pept        join(complement(814462..814883),complement(813488..814385))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901868"
FT                   /orf_name="An16g03650"
FT                   /product="Function: aurA gene product is necessary for
FT                   inositol phosphorylceramide"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK42863.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG397262"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI0000EFCD80"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7I5"
FT                   /transl_table=1
FT                   /translation="MNSTLPSWKDRTQNQFGKLQIQVPWRSIQLLVPHRMRRKIRSKLR
FT                   SRLSPTSSISSLQTSFSPMDTLRSLQSHRWTLYDFQYLLLLILLIFSLSVMGSPGPLGK
FT                   TAMFTLLLLSLLLPITRQFFLPFLPIAGWLIFFYACQFVPSDWRPAIWVRVLPALENIL
FT                   YGANISNILSAHQNVVLDVLAWLPYGICHYGAPFVCSLIMFIFGPPGTTPLFARTFGYI
FT                   SMTAVAIQLFFPCSPPWYENLYGLAPADYSMPGNPAGLARIDKLFGIDLYTSGFRQSPV
FT                   VFGAFPSLHAADSTLAALFMSHVFPRLKPLFVTYTLWMWWATMYLSHHYAVDLVGGGLL
FT                   ATVAFYFAKTRFLPRVQSDKTFRWDYDYVEIGDSAREYGYDLAAYDGDFNLDSDEWTVG
FT                   SSSSISSGSLSPVDDHYTWEGESLASPIADVESGRHVLSA"
FT   CDS_pept        join(814967..815046,815138..815257,815330..815375,
FT                   815471..815512,815602..815808)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660195"
FT                   /orf_name="An16g03660"
FT                   /protein_id="CAK42864.1"
FT                   /db_xref="UniParc:UPI0000EFCD81"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7I6"
FT                   /transl_table=1
FT                   /translation="MSPELGLENIKGSARRSRRKGGFWASTNTRSEGSSNEVEAQAPVS
FT                   SGQTRIFGDGHVARVTLTQGGQVEEGREIGERGGGAEVLDQQDRRRGGQRRGRPGKATS
FT                   PLWEWEKGGLPLLALARIGGASVRWTGRSEVPERTKVQPFHIAEIFFMVGQRSPQQPNC
FT                   G"
FT   CDS_pept        join(complement(816926..816976),complement(816611..816846),
FT                   complement(816367..816528),complement(816210..816309))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901869"
FT                   /orf_name="An16g03670"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42865.1"
FT                   /db_xref="UniParc:UPI0000EFCD82"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7I7"
FT                   /transl_table=1
FT                   /translation="MAGWETSLVRLLCRTEGAGLGTRLSSELLDPVMGGTVMSIRLSSI
FT                   AASYSVWTKVQIRIFQSLSPDYGDCVYEAAGSGSLDHRLRSGGGKVFANIRYKNPHQQH
FT                   SIVSMPGPIVPSFRRVRGRRFDNAHNAQDDIVTNQTIQGQRVLAAGEIGSGDPLLPIGC
FT                   GWLAGGAPKTNHQGQSGIP"
FT   CDS_pept        complement(818368..818823)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901870"
FT                   /orf_name="An16g03680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42866.1"
FT                   /db_xref="UniParc:UPI0000EFCD83"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7I8"
FT                   /transl_table=1
FT                   /translation="MWETFEKLGSQLQERKEKPDFESIVADGLELRPRLSRLFMMYYDV
FT                   YDVEPHVFLPSERNRMSMMQHEEAGTPLLAFYETWKGGCCQYPPTSCIFCPLCIPDVEY
FT                   SRPESEVVMMMMIWSKPRLGVGRWSRCVGPSLCRSTHGQATVNPQPS"
FT   CDS_pept        join(complement(821476..821840),complement(820881..821409))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000096548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901871"
FT                   /orf_name="An16g03690"
FT                   /product="Function: involved in both homeostasis of calcium
FT                   and manganese ions"
FT                   /protein_id="CAK42867.1"
FT                   /db_xref="HOGENOM:HBG748253"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniParc:UPI0000EFCD84"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7I9"
FT                   /transl_table=1
FT                   /translation="MSISSLRGLLTNYSPVSEEFTQPDLEKELHVSLRNGDDSESSSSR
FT                   SVCREKAEKKESKIVDGRIVSDAIIGLSDGMTVPFALTAGLSALGDTKVVVFGGMAELI
FT                   AGAISMGLGGYLGAKSEEESYRATLKETKQEILTDPASVTETISDVFAPYDLPAELVGE
FT                   LTRHLSSSPNLPSFLMNFHHTVQEPSGSRAFICALTIALGYFIGGFVPLLPYFFVGPHD
FT                   VLSALRWSIATMAVALFLFGYGKTCFVSGWKGYRNIRRGVIGGLQMVLVGGVAAGSAMG
FT                   LVKGFQMLADSHSHEH"
FT   CDS_pept        join(823327..823425,823475..823888,823936..824112,
FT                   824165..824203,824251..824459,824508..824657,8
FT                   24704..825019)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901872"
FT                   /orf_name="An16g03700"
FT                   /EC_number="3.1.1.5"
FT                   /function="lysophospholipase activity"
FT                   /protein_id="CAK42868.1"
FT                   /db_xref="GO:0004622"
FT                   /db_xref="HOGENOM:HBG603039"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniParc:UPI0000EFCD85"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J0"
FT                   /transl_table=1
FT                   /translation="MKLNVAAISALATVASALPHRRNVEQWDHIRSNIKHVIYLMMENH
FT                   SFDNIAGYWDFHPDIDNLRNISYCNEYTNPNWTVWDEPLNICAAPFETEVPLTDPDHNF
FT                   AGTSYEIFRKWQPTKDDVPNMGGFIERQSEKYASSPGESSFVIKAYDEKKTATLIEVAK
FT                   NFAFWDSYFAEHPGPTNTNRQFATSGSTCGFVDNTYQAAGWYANYTGTTCATSIFEALS
FT                   NKNITWKNYYETDIVDAYMYKWVQDNAMDRLVHSDQFYRDLEEGTLPQFSYYNPECCTI
FT                   DSMHPTSNMASGEQLIKHLYDAVRKSKYWDNVLIILNFDEHGGFADHVPTPINVPQPED
FT                   GITFTGMSDGHNVTYDFTRLGVRVPSFIISPYIPANHLIHDQGTMYANNSAYTHTSFLH
FT                   FLQELWGLEGLNNRVQWAKTFEYIFSSEKRDDTPEKLTTPTWYGSSWEPKPDPYYKLNQ
FT                   NYDYYENLD"
FT   sig_peptide     823327..823377
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J0 "
FT   mat_peptide     join(823378..823425,823475..823888,823936..824112,
FT                   824165..824203,824251..824459,824508..824657,8
FT                   24704..825016)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J0 "
FT   CDS_pept        join(complement(825598..825803),complement(825308..825518))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196625" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901873"
FT                   /orf_name="An16g03710"
FT                   /product="Similarity to hypothetical protein CAD60720.1 -
FT                   Podospora anserina"
FT                   /protein_id="CAK42869.1"
FT                   /db_xref="HOGENOM:HBG328483"
FT                   /db_xref="UniParc:UPI0000EFCD86"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J1"
FT                   /transl_table=1
FT                   /translation="MTRLYPLFILLFVLLILGTIFYITYSIIQDVKRNTRSKMEKKNVT
FT                   FSRDGVTVGVKELKDEDYLDRSQSILVNMWNHTSFPAYKSRLWDMTKPTNWNENAAGAS
FT                   DEGLRGRFWSAAGRVGEWAGYHDQGQEGEKKKGQ"
FT   gap             826065..826164
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(829611..829633),complement(829259..829394),
FT                   complement(827125..828912))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196647" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901874"
FT                   /orf_name="An16g03720"
FT                   /protein_id="CAK46804.1"
FT                   /db_xref="HOGENOM:HBG328485"
FT                   /db_xref="UniParc:UPI0000EFCDB4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J2"
FT                   /transl_table=1
FT                   /translation="MGSYTFTWPYNANEVFVTGTFDDWGKTVKLDRVGDVFEKEVPLPV
FT                   TDEKVHYKFVVDGIWTTDNRAPEEDDGSSNINNVLYPDQILKDSTTPLLNGTAAMAGVT
FT                   PGSTTAALAAGVPKESSSKHGQNGYYPTISSAAPGSTTAALGQDVPLEQRANVPGSFPV
FT                   TPASEADKFSVNPIPASSGAGNPIKLNPGEKVPDSSTFNTNTISSTARTDRAGYEQGTS
FT                   GGFPGSPAYDASAFAIPPVSKNMIPESSLPMGENQGATEPTYTIQSAAPTSTTAGLAAA
FT                   VPLESQRQTSSGAPTRDVPDVVRQSMSEAHRDPEAATNKEAVDEKKEMEEELRRKVPVD
FT                   NSTGAPAPTTVAGLGTSSGLGFTAGAAPSTNLGPSTGLDVATGMGTTTGLDSVSGPTAA
FT                   QSFQKETTSGLPAHDVPDVVKQSISEAHKDPEAAGVEEAVGEKREVEEELQQKVPVSNQ
FT                   SGTPAPVITAATSETAPGSGAEPASERAPRATGGGPASAQISPRATTPTDGPTVTTGVA
FT                   TSKAPEESGPGASGREETTEIPTKPAAGATGASATKTVDSGVESGIAPEDTTSAPTAGA
FT                   TGASATKTADPTETSGAPTSGASKPAESAPTNNAAATSKPATNNAAGAATNGKEEKKKK
FT                   GFFSRLKEKLKSV"
FT   CDS_pept        join(829674..829944,830067..830175,830286..830389,
FT                   830490..830539,830610..830900)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660196"
FT                   /orf_name="An16g03730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46805.1"
FT                   /db_xref="UniParc:UPI0000EFCDB5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J3"
FT                   /transl_table=1
FT                   /translation="MGCWWEQGPVSNRDSSKNGGETKELIARGRQDKTKLKKNSRNGLW
FT                   KKRLGTAIKLAGKMGRGEMERGLFGRTQTVTGRTVWQEVLRDSKVGFGNDEPKQPRRNT
FT                   HGLSHRAGDSRHSQWLPALCQPVAAFLPVVTAIRLAFRTIFPGASRRQKFYWMKHVDGP
FT                   GKLYMVRVDPNPQPTAPARPPPSPFVKSFAPKKISRPAYSYATVLRIRAEQALEWMIPT
FT                   HYYSCSFCVLVFHPPPTALPALILIQRARTLTSLQEESSQPVIQECDNGLLR"
FT   CDS_pept        833202..834437
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901875"
FT                   /gene_name="pkaR"
FT                   /orf_name="An16g03740"
FT                   /product="CAMP-dependent protein kinase regulatory subunit
FT                   pkaR-Aspergillus niger"
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /function="kinase activity"
FT                   /biological_process="regulation of protein phosphorylation "
FT                   /cellular_component="cAMP-dependent protein kinase complex "
FT                   /protein_id="CAK46806.1"
FT                   /db_xref="GO:0001932"
FT                   /db_xref="GO:0005952"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG736470"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI0000EFCDB6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J4"
FT                   /transl_table=1
FT                   /translation="MAESAFPSAQQPLRVGTKDDKAAAFQKISEEDEYEVTSPTDPTFR
FT                   SANAAAASSSTGSPFFGGSYGENSGPIRFNRSPFDNGPREEDDEGADEFPPEDIRPTGA
FT                   ANQGFPNNYALGRRTSVSAESLNPTSAGSDSWTPPYHEKTEEQLSRLKTAVSSNFLFSH
FT                   LDDDQFKSVLDALVEKPIPAKGIKVISQGDAGDYFYIVENGHFDFMIHPSGSVQPGPDG
FT                   MGNKVGSVGPGGSFGELALMYNAPRAATVVSVDPKSTLWALDRITFRRILMDSAFQRRR
FT                   MYEAFLEEVPLLSSLKPYERAKIADALDAIKYPAGSTIIAEGDPGDAFYLLESGEADAF
FT                   KNGVEGPVKSYKRGDYFGELALLDDKPRAASIVAKTEVKVAKLGRDGFKRLLGPVEDIM
FT                   RRAEYESKPVPA"
FT   CDS_pept        join(complement(835438..835936),complement(835061..835293),
FT                   complement(834764..834775))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812984"
FT                   /orf_name="An16g03750"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46807.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG398383"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI0000EFCDB7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J5"
FT                   /transl_table=1
FT                   /translation="MPKKTSKQPPSSTPKSHLQQKQQQPNWPPLRPLIPSTSLTLDPLV
FT                   PDQIYLIRNFFPSTLCKTYTSFLASLPLTTTPGKPKKGDAVRVNDRFQIQDEGFAEGLW
FT                   SGTALKEMVMNAGGGDEYEEEEESKEEETTRDVKDIWGGEPIGLNGNIRIYRYSKGQFF
FT                   DKHYDDSNAITFSSPGRPPRAARTTWTLLIYLTSCEGGETVFYPEATRFNRNPEPVSVA
FT                   PVPGMALLHRHGDRCMLHEGKEPPK"
FT   CDS_pept        836478..839804
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901876"
FT                   /orf_name="An16g03760"
FT                   /product="Similarity to hypothetical protein 15E6.220 -
FT                   Neurospora crassa"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46808.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG328487"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000EFCDB8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J6"
FT                   /transl_table=1
FT                   /translation="MSSSQTMTASAVGHRPPDAAPNMSSVYDYARSQQQHDDQPHPSPP
FT                   SDSAIRPLHDSAPDSPPNGLSTLSSTTPVVKSEPGDHDSAPSASAPPESQSDIRRQSAA
FT                   SALLAQLLGNQVSADGLESEDHPMPPAQDGAEPPQNNDQDVKSQWQFESTSEPPAAPAD
FT                   STNGGADQFPPESTESLAPHQQDEKISEQPPDIPFSNPDHGDSMSIKASEAVEGLTDPL
FT                   LFSKSSLDHPDLFSSFDITAAPKTPFEALQQNEMLTAAYLSQSADLSALGYSGGHLSHD
FT                   IAGSVAGSEPRIQAFAKLEFDDGHFYCNTYSFILGRDVRAARAAHQREIQVRQAMRTSR
FT                   AKSSSGGNTSHTPNRVKHEGSGILGSVVSDRGGIMGFDPDIPPHLPHHLSRRSSVSSHA
FT                   ESAPLHATPAQLQSTTDYNALAMQSLNEENGDAKPVDALALLPSPDACPTIPIHPPATV
FT                   DGSAAGHRGISRKHVKIAYNFDRNLFEMEVMGRNGAFIGADWLSPGQVRPLHSGDYIQI
FT                   GGVRIRFLLPDVPIGETGADRVEEPFTAEDEKAQASTTAENETPAPKRASDGSETKETP
FT                   KTTKIILKTRAEPDPSRPVQSVEGSGDPNQQPVRRRGPGRPPKDGIMSKRERAELAREQ
FT                   KLAAKREANGGVTPPPMNRPKAGKAPAPTSGATAAPKESVGAESPGSKPEKRKYTKRKK
FT                   PDGTPMDFPLPSTEGGQFPMEHRPEEFIKAPPVKKRKPSRSPSPNYPPESAYTPEDLAK
FT                   PPYNYAVLIFDALTEAGTPMTLKQIYRALKLKYPYFRFKCETEGWTSSVRHNLNGNSHL
FT                   FMHAERDGKGWSWQLRPGASVEKEKKRRPSPPPPASQPPSAPSATPQYMPQLNPSYGNQ
FT                   HGQPGMANPHFQFPSMPPNPYAPPPPPAPAPNPTPAPHHSSPYPPPAPAAASTPFPIPS
FT                   PLRNNLPPAFAQTTPSTYTSPYASDPPPQLVQLQQSQQTQPMPPQPQHQSPYPPPNPPS
FT                   MPPMNAPPHQGHHPPPPPPGPPMQHPPPNMGMGHDPGPGPMDNSEASSFNERASKAIDD
FT                   FEAVLMEDYEDKNYIREVLKSARARVLGNATDSSFPGGEPKDEAVILDALRNLIGSLKD
FT                   E"
FT   CDS_pept        join(complement(844119..844172),complement(843775..844035),
FT                   complement(843358..843494),complement(843176..843273),
FT                   complement(842612..842885),complement(842295..842528),
FT                   complement(842076..842246))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901877"
FT                   /orf_name="An16g03770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46809.1"
FT                   /db_xref="UniParc:UPI0000EFCDB9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J7"
FT                   /transl_table=1
FT                   /translation="MGGNASNPAPDRTAGSQNRQTERQGERVRERERQASQPDGTRPET
FT                   PGAGGLRPVRLFRTGTYVVPCLPTGRFYSLKGVSEQFVVTVRLAAKKGGGEKGKLLEST
FT                   ASGRIGEWNRRQCEAAIVHRSAGKREWNGGKGGKRNCRKSKASHRKGSDRRYLLRNGTL
FT                   NFYCGWTALVGGPRTASTIGCGRRLPASYLLIPCKSMRLEKHTKHPRLQQERQWQCRQS
FT                   VSQSVTLKRARLIGLLCQGGVPCHPPTLKRPIREADSLILNYKRNDTTGRQGDRTGQGQ
FT                   GHCTYIITSTLFSLPHIVIIIIIILIVRWLSKPHSMPTFRGCSNNGLVYVRSVPEKRHL
FT                   TVIAIPTGLSDQTVTHRPPGGWGQYDQHMIGPEYFGACSLITFVPQNGGIHSSEFSTME
FT                   DYSADGDWQ"
FT   CDS_pept        846878..848296
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966151"
FT                   /orf_name="An16g03790"
FT                   /product="Similarity to a hypothetical cyclin-like protein
FT                   of S. cerevisiae"
FT                   /protein_id="CAK46810.1"
FT                   /db_xref="HOGENOM:HBG328489"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI0000EFCDBA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J8"
FT                   /transl_table=1
FT                   /translation="MPSFFAPGLQGLPPTPPHILSGGRMEHDQPFYLLGPSAAFPPRYP
FT                   QNGCDFIEQYSQSACYSKPMNSQSALGVRNGRDMVAAHSALNQPMFGPLGTANVLPPIR
FT                   NNVQLPPMESAIPPQYRRQEMMVQPEPQRKEEKATGGVAAHLDYEMDQMSDFVAEMAQG
FT                   MYALYITKINLADIDLARSVYPGSSVPPQFRKYVYQILSSTRLPSSTILLGLYYLASRM
FT                   RMLSSTKVFHTGSGQVYRMLTVALLLGSKFLDDNTFQNKSWAEVSNIPVSELNSMELDW
FT                   LFAFEWKIHDRIYDQQDGFASWLSHWETWRTKTVARAQESRHALAPIDTNVSRSHRVSK
FT                   PLLSPEGPIPPQYQRSTSYETSWLNPAASEYSPPSAPHTGPNTPDYYAAGPWYTQPPPP
FT                   YSRTWVPPPQQYIPPAPRSQPPSYHHTPAYALPFAQSVWTGHGSSCGCLYCAKHMEHYM
FT                   CANPFGSMQPIVAG"
FT   CDS_pept        join(complement(852189..852203),complement(850287..852128))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901878"
FT                   /orf_name="An16g03800"
FT                   /protein_id="CAK46811.1"
FT                   /db_xref="HOGENOM:HBG328490"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0000EFCDBB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7J9"
FT                   /transl_table=1
FT                   /translation="MGKPRMIILIRHAQSEGNKNREIHQTIPDHRVKLTPEGHRQAQEA
FT                   GSRLRTLLRPDDTIHFFTSPYRRTRETTEGILQSLSLDSPAPSPFPRHTIKVYEEPRLR
FT                   EQDFGNFQPCSAEMERMWLERADYGHFFYRIPNGESAADAYDRVSGFNESLWRLFGEDD
FT                   FASVCVLVTHGLMTRVFLMKWYHWSVEYFEDLRNINHCEFVILKLNPDNGKYVLQNQLR
FT                   TWSDLRREKEEERQRERAAKGLDPVQPAPAETSVPIRRKWGGCPDGCNHGVRRRSSLRV
FT                   PRGHNTDHPKHQHDPQSKETTTHSATHNHRSHGNQNGHPRPVPAVTGTSTPVDQHMLRA
FT                   PEPALGDRSIDARPLGRTLPSPAQQYEFEGVQLETTSTSQATFPTPNASTSTISHLGQP
FT                   IPNPNPIPRRPGLAHLHRDSEDHLLHPPNCNYAYIHLVGRDGGGSMSGANSLAPSEDER
FT                   DEKLRPNMHAYTHSHRQTHSRPKPTSSTHQIRPSQDLDNDGDDESSSKQAARPRRTRSH
FT                   SHHARNPPGLAHQTLSKQVANALSQDRAGQDRSDDEPLPTAPPSSKAENQPVDAHNRED
FT                   DQYDDHEHYHHHGDDEEDDYNEEDASFEAERKHDQGIRGSVY"
FT   CDS_pept        853028..854533
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812985"
FT                   /orf_name="An16g03810"
FT                   /product="Similarity to hypothetical protein B7F18.100 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK46812.1"
FT                   /db_xref="HOGENOM:HBG328491"
FT                   /db_xref="InterPro:IPR007255"
FT                   /db_xref="UniParc:UPI0000EFCDBC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7K0"
FT                   /transl_table=1
FT                   /translation="MADYLYDLLAPHLASTKAAAALCDPDRDTTTAQYLNRLPTLSLQA
FT                   LQSTEPQSLTQSSHSTLLSLQALSNRSYKAFVTSADGLSNLRASIPQLAQNAQQLRDAV
FT                   PKLDEEAVRFSSKYSRAAENVALEQRKKVMQLARNVDRLSDILELPTLLATAVSSAAAS
FT                   STTTGSSVSTTYSTALDLYAHIKRLQTLYPDSPLIKDVVSQAEDAMKDMTSNLIAGLRA
FT                   QNLRLAAAMRTVGWLRRVAPELDNLHHEGSPAAGEGALGAIFLICRLANLITMLEALDP
FT                   LRELADQETQRRAPSTDRKNGTTGTWSEGHQTEKYLKRYIEIFREQSFAIVSLYKNIFT
FT                   PDQSESELAVTGLRSIDARIKAAASRPSRPEDPLQCLPPALATFPMHLVQLLTDTLRTY
FT                   LPNVRDKSSRESLLTQVLYCAASLGRLGGDFGMILTELSEAADEEQEESDADADDLAYE
FT                   WEEVTRKHRALAGRLEQLTGGTTPGSSTKGHSSRQALPMQGDI"
FT   CDS_pept        855120..856448
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901879"
FT                   /orf_name="An16g03820"
FT                   /product="Similarity to hypothetical protein B2J23.130 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK46813.1"
FT                   /db_xref="HOGENOM:HBG324227"
FT                   /db_xref="InterPro:IPR019194"
FT                   /db_xref="UniParc:UPI0000EFCDBD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7K1"
FT                   /transl_table=1
FT                   /translation="MAAPALSTGGLIDPTKQAEYPIVLGDRLSGKSSSPQSQLVNIQYN
FT                   YKTKSATARQRITRTRQSRDRYNLTITDKAPNADNVLTYSYQGSVDPTQSVSDVGEHNL
FT                   VLVFDAARKVFVLEPVSTQLNFNLRSAPAKSQKQVLEQYEQLRTLQEEDHGSGDDRGSD
FT                   NASGNDDGPADDSNPYDYRHFLPKENADDDKSGSDKTPEPPSYTSKLDTPLMSATRPIP
FT                   SPRPPPESRTKPVHPKKKKPDGVKPPKPAAARPRPRSPPRPVQPREERKAEVEEEPPVE
FT                   TFNSSPSDTGLGAVSSQKAVPSPGSNIIIDGDLIIDMGSPPPARPFRVNPAYFSSNHTP
FT                   ADEEGNRDEDEEQEDDEDIEDLRLPSPAGHGGAPMASSGINLEPGVDEEDLEVDDDPLA
FT                   AEMEAAFEEDVQEDDRSQPVPTQAVSQQYHMASEDESEVSEEE"
FT   CDS_pept        join(857387..857428,857468..859048)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966152"
FT                   /orf_name="An16g03830"
FT                   /product="Function: pch1p of S. pombe interacts with the
FT                   cdc2 protein kinase"
FT                   /function="kinase activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46814.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="UniParc:UPI0000EFCDBE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7K2"
FT                   /transl_table=1
FT                   /translation="MASSAAHHPSELPPAHWIFTDEELTRTPSQLDGMALEAEHMSRSK
FT                   GVNFINQVGIMLKLPQLTLATAAVYLHRFYMRHSMVDLPQRPGIHPYTTAAAALFLATK
FT                   VEENVRRMKELVVACCRVGQKQPNMVVDEQSKEFWRWRDTILVHEDVLLEALCFDLQLE
FT                   QPYRILYDFICFFRMQDNKPLRNVAWAFVNDSGYTVLCLQFTARIIAAAALYAAAQHCD
FT                   IGFEDDVLGRPWWEQLDVDLTQVRRACMRMAKLYENNAAHRNGLYYLTNPISTDEGTEK
FT                   TRIPRVDGPADNTMRPIDSGREADAVNGRKRSRDPDDETKPPRPLADSMPPSEAGPATQ
FT                   NGAPSPKRPRRDSLGASTDRVPSSRIPKAPLPSGGPAFSHDRPSANGHAPPAPHSHPYS
FT                   ATRHPHPLPPPPRPYPRRDSSSRSGGGPPGLPVDPIQQRIDEIVQQNMPSQSGGPGRVE
FT                   RRPQERHRGDWEAEADSGQRRRPSMSTGGQPPSQEDAHPHPPPQHLPPPPPPEEEPRPP
FT                   SQPEPPQAPEPEDEGGGSEEGEL"
FT   CDS_pept        join(859894..861965,862198..862234)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117184"
FT                   /orf_name="An16g03840"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46815.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EFCDBF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7K3"
FT                   /transl_table=1
FT                   /translation="MHPAPATTDRRRSCRFCRSRKLRCSGASVCSACKDRQIECVYDQG
FT                   GPKGRPRVSGARTTGRLVAGQPAPEPDMKQAPWTSPSSPSSSAAGQLFSPRLKSVADAL
FT                   SEVTAEIQEKLQGPRVDGMPWSQAGSPRQRPAKLGCRELILVLTQDIIDATVARFSGLD
FT                   CLAFFANQSQFFRASLASSSPPEPSPALEPAPLAAYNGYRITQLLDVWFGAHPLSMALS
FT                   KTLLLRDVRSNSYDPLLLAVVLGGGLLELGDTDTQVESEQLLHWASSRLQYISTAAADL
FT                   STAQALSLLAWHETCQGNIIKAMTYSIYANRTVTRLIMDTLTRSSRDVRQINGVDLVQI
FT                   ELEMMHILGWMTLALMVWYFTHLGIVDDSLPALAMMYEHPPMNKDASLVLRLDKAADNL
FT                   STLSHQWAWIQEIWTISHITSAAVHLNSIYPRQASGPTSPIAHPHHSWQSQLHEQLRNI
FT                   QLYKVDIGNLCSEARAVLSRNVQIIEANMEDQVAQTWILTAYRTLLIHLLFPRMETIAI
FT                   TADLVQNLADCLAFFARSFTVLVHISTTHALPQSSIQSCIRSYMAGLAACGSAIDAIFL
FT                   ISPKQLQCWEPEILQGLARLLEQATKLDTLFTDDTLLTDWRWRNVQNRFHRLSKYKTEL
FT                   QSVPAGWDGLPLPVRPAERQSSTSSLQPVAAAGVAETTEPTPTPLVPIYTAATELPLSI
FT                   ASILFPLS"
FT   CDS_pept        join(complement(865738..865967),complement(865370..865682),
FT                   complement(863677..865322),complement(862882..863626),
FT                   complement(862793..862806),complement(862718..862744),
FT                   complement(862607..862612),complement(862548..862569))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173191" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901880"
FT                   /orf_name="An16g03850"
FT                   /product="Similarity to hypothetical protein SPAC57A7.05 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK46816.1"
FT                   /db_xref="HOGENOM:HBG328495"
FT                   /db_xref="InterPro:IPR018820"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="UniParc:UPI0000EFCDEB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7K4"
FT                   /transl_table=1
FT                   /translation="MADERTTQESSPAWSDSDSAAPVIAAKKRRLPPFLDHFNGRDLKI
FT                   FFRCWVAVWVACLLIFILPSLESIGTATFFAALVLLFLPPSGIVFVYLLGALSLFIGIC
FT                   LAWAWGVITMKAAQAARPAADTQAKMAALQQTAVSQAQNSTYSATEIAQRLVYEGYMLD
FT                   ARVTAVTFCLICTFVYFMARLRASNPKAALTAIFGIIISDLFLNYTPLLPSFSGTLPLT
FT                   LVKPAAIGVGLGLACSILFFPQSTSHVVLDSMEDIVRLLQVPLAMTANTLCKKDEQPNP
FT                   DDLRMTQAGIIQKYKSMEPSLAFLPLDFSVGCWGAEDVASFQGPLRDILVAILSLLDFH
FT                   IGRIVGEARTQDVLRKYVDKTPDGDEKPTREVGAHQLTQLAQLLDGFRSPDSHPLRKEV
FT                   IQELVKTSTTAIDACAEGLSVVQECIHLVNCRRWFRRPSQAEREQLQQRCEKALENLAK
FT                   ARSVFINEMSDILIGQHDQRTLDGPQHFRPLMFVLVFEEHISNTVQKTEALLARVSTVF
FT                   QESTKIRIYLPTRFRYAASWASSNQVKAPGSQGTEDDPDRVSADDATKAAQEKLRATRG
FT                   FRTKPRPPLSRAVLGTYHWFTCDEGLYAMRMVVVTIALGIPGVIPHSAGFYYRAKGLWA
FT                   LIMGQTGLLVYMADFTFSVIARVIGTVIGGVLGLLAWYIGSANGPGNPYGLSAITAAIL
FT                   VILVWTRLYLPPALMQGGIIGGATFLLVIAYSYDDTHIPQYGNPGVGYNVFWRRLLLVL
FT                   VGVAASAILQTLPRPPSASRHVCKTLSRAMRTLSTHYALLLTVWAQNSTEGKRLAEPLS
FT                   LQLAETLVSLDGPIKLLGFEFSSSRFDSASLAKVNSLCRSLNRQLGRLLLLSSSLPQEF
FT                   QEQLARQTGLLDHRLIGQVMAVMGLCEQALKTGDALPEILPTPLFKQAVDNWSRGRRGQ
FT                   EEQVISAEMMRDEGYRRFCVAASAYFGFLITVDEMVLVVKGVLGEAHLINSNCHRDNES
FT                   NKYSYLRWFEN"
FT   CDS_pept        complement(867105..868853)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812986"
FT                   /orf_name="An16g03860"
FT                   /product="Catalytic activity: ATP + a protein [ "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK46817.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000EFCDEC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7K5"
FT                   /transl_table=1
FT                   /translation="MDTSANIAGHDDISVGDVFSPQADMSHSHKDINMSDAPETGFRMS
FT                   ARSPQRKQGPMIKGPGVHGGNPFPAPELNAHPLAAKADRRKKKKKQVVHEVAPALSTVR
FT                   GFTPRGSADEDSDRSAASSRAPSSHPRTRAGTNGGSPLVQPAAGCGVSALKLQLDSMSL
FT                   SGNGTRAGPAETPSNASVCSDSDQTEVLTSYEVPLEHDYVSADAAAEEDSQNTSSVRDM
FT                   RTQLCRKMTTDDFEPLLCLGKGSFGTVLLVRHVLTGKLYAQKQFRKASITVHKKLVEQT
FT                   KTERTILESVNRHPFVVKLFYAFQDHEKLYLILEYAEGGELFTHLAMERMFDEDAAAFY
FT                   MAEMVLALEHLHQTVGVIYRDLKPENCLLDSEGHLLLTDFGLSKIAVNDDDRCNSSLGT
FT                   IEYMAPEVVQGKSYGKACDWWSLGALGYDLLTGSPPFKANNNAKLQEKIVKQKLALPYF
FT                   LGPDAKDLLTRLLRKEPSKRLGYHMPKDLQTIKTHRFFRKIDWKALERREVAPPINPVV
FT                   TDPALAENFSMDFTQLPLSPIVHAFDDHYAARASGPPASHPGEGELFGGFSFVASSSLL
FT                   DNGMMV"
FT   CDS_pept        join(869310..869596,869685..869784)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901881"
FT                   /orf_name="An16g03870"
FT                   /protein_id="CAK46818.1"
FT                   /db_xref="UniParc:UPI0000EFCDED"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7K6"
FT                   /transl_table=1
FT                   /translation="MDPKPEHLVVGDGANGRHGREASRGGSVERRRGREVRVESQQTRA
FT                   GAADKSGRRNRGQRRQAHRGTAKARMDERAGDGNETPRSRHKRHSEGLETGKLPGLGAE
FT                   CIFPGPRANQRVPVLSDARPDRVA"
FT   CDS_pept        join(complement(870368..871231),complement(870106..870294))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812987"
FT                   /orf_name="An16g03880"
FT                   /product="Catalytic activity: 2-amino-4-hydroxy-6-(D-
FT                   erythro-1)"
FT                   /EC_number="4.1.2.25"
FT                   /function="dihydroneopterin aldolase activity"
FT                   /biological_process="folic acid-containing compound
FT                   metabolic process"
FT                   /protein_id="CAK46819.1"
FT                   /db_xref="GO:0004150"
FT                   /db_xref="GO:0006760"
FT                   /db_xref="HOGENOM:HBG328497"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniParc:UPI0000EFCDEE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7K7"
FT                   /transl_table=1
FT                   /translation="MADQRVNVHIPSHPPVLDSVRLRNIELPLPAAPDPWHRPGKSQPC
FT                   TASLKLSYSSAVAAAIADDVSLSLDYGKLYRRLEEDIRNLGKHPENPGHRMISVDGSRR
FT                   DEMLASDVGQDVRLTAGIVAHCGLGLLDETAAGVRRMSHVHNTQRRSSASAGSQSQALA
FT                   AIFNSASTSPIDGVFGQCEVSLHLPKALLRAEEGLKYRSVTVWGYRQANEAITDDVGES
FT                   ERCPVVLEEEFRIDGIRCYCILGVNSHERVEKQAVIVSLEFKGPGQLPWGSTVVNSYQA
FT                   MTRAVAERVETTSFQTVEALATFVARIVTVEFGNERVTVRVEKPSALAFVEGSGVEITR
FT                   SQAFFEGRDA"
FT   CDS_pept        join(complement(874108..874159),complement(873599..873727),
FT                   complement(873306..873466),complement(872774..872847),
FT                   complement(872615..872711),complement(872171..872553),
FT                   complement(871922..872129))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000276234" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901882"
FT                   /orf_name="An16g03890"
FT                   /product="Function: human SRp75 can complement a splicing-
FT                   deficient extract"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK46820.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EFCDEF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7K8"
FT                   /transl_table=1
FT                   /translation="MTEVSSTRLYLGNLPRNVTKQDIEEHFSTHGSGKITEIKLMNGFG
FT                   FIEYEDAMDARDVVPDGSDFKGERLTVQFARGPRRKENFPGPMDRPNMPRPRRTIFRMM
FT                   VSGLPETSWQDLKDFARQSGLDVVYSETGRELGRGFVEFETANDLKTAIEKLDGREFKG
FT                   SRVTCIADIQTYPDERAIRDPYRSRSPRRSYPPMDEYDRRFPAPRGYSPRAHYRERSPI
FT                   PIRRDYYDRDGYGRRTPPRPRMEDYPPPRRPYDDPYDVRPPPPPRHYDDPYAPPRPYGR
FT                   PRSPPRGEYMPYDRRGYCAWRIPIVHAFPPLFSLVDWFPLSWPFRDELISPISESASGS
FT                   DTAQDTNVCVCQIDTDNGTTLALVFIT"
FT   CDS_pept        join(complement(876259..876521),complement(875724..875878),
FT                   complement(875578..875612))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812988"
FT                   /orf_name="An16g03900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46821.1"
FT                   /db_xref="UniParc:UPI0000EFCDF0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7K9"
FT                   /transl_table=1
FT                   /translation="MKSHRNRSNPSTGPMSSLPQDPSPWWWCCDSLYTCFSAYFLIKSV
FT                   PLGTTIVKQDSFADFLIDTSMANQLDAHRASMNASELVDILQWKIYDVGKSKTLPYVCT
FT                   LGIAIATVKYIHCRVGYVEDCLLRTYLDAVPISIQIRSYYLNTNLP"
FT   CDS_pept        join(878417..878714,878806..880327,880378..880477)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000259450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901883"
FT                   /orf_name="An16g03910"
FT                   /product="Catalytic activity: reduced ETF + ubiquinone [ "
FT                   /EC_number="1.5.5.1"
FT                   /function="electron-transferring-flavoprotein dehydrogenase
FT                   activity"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46822.1"
FT                   /db_xref="GO:0004174"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG291987"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR007859"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniParc:UPI0000EFCDF1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L0"
FT                   /transl_table=1
FT                   /translation="MASKGAVLPLLRRELRPTWSRLSRSCAPLAPFNNSARISNSSLAA
FT                   SGKRAIRRTSFFPPIQARAFSQSLSRKLTDEHGNFDPRQLDRESDEVDVCIVGGGPAGL
FT                   AAAIRLKQLANEAGNEEFRVIVLEKAGELGAHVLSGNVLEPTAMNELLPDWLSEDNPSR
FT                   FENVTPAKEDKMRFLTKNSSIPIPAPPQMNNHGNYIISLNELTKWMGERAEELGVEVYP
FT                   GFAASELVYKKSDGSVLGVATNDLGVGRDGKAKDSFERGMEFHARVTLLAEGCHGSLTK
FT                   QVIKKYDLRRDSQPQTYGIGVKEIWEIQPEKFRPGEITHSLGYPLPSDTYGGAWMYHFG
FT                   DNMVSIGLVVGLDYPNPWLSPYGEFQKLKHHPLYKEVLEGGKCISYGARALNEGGFQSI
FT                   PKCAFPGGALIGDSAGFLNVPKIKGTHSAMKSAMLAAESAYAALQGSSEGSVFLFDYEE
FT                   ALRKSSIWKELYEVRNMRPSFSTPLGLYGGILYSGLEAYVLKGKAPWTLKHHGTDAAAT
FT                   KMASECNKIEYPKPDGVISFDILTSVSRTGTNHEEDQPVHLQVEDWDKHTDVAWPKYQG
FT                   VENRFCPAGVYEYVEDASKPHGVRFQINSQNCIHCKTCDIKVPTQDINWQTPQGGEGPK
FT                   YFMT"
FT   CDS_pept        join(881261..881459,881667..882058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901884"
FT                   /orf_name="An16g03920"
FT                   /product="Similarity to negative regulator LIN-1 -
FT                   Caenorhabditis elegans"
FT                   /protein_id="CAK46823.1"
FT                   /db_xref="UniParc:UPI0000EFCDF2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L1"
FT                   /transl_table=1
FT                   /translation="MVSSSSTSMPSTRTITTPSPTDDDEDVEVVYTPSTSSTSSSSPSS
FT                   IRLTAAGKCKAELKSGNIGLELEEPPNPRHTTLTKLMNLMDLYPLLYVRGIPDSGKGTV
FT                   SQFRRDNFMLMTREQEAHSFFLPVDKPLEEFDSEEDLLKQVVNSFNRLCKEPRFFFLVL
FT                   YFLTLSAFMGVRFLELVVLPYLPAPGKGMRGLR"
FT   CDS_pept        join(883147..883313,883637..883805)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117185"
FT                   /orf_name="An16g03930"
FT                   /protein_id="CAK46824.1"
FT                   /db_xref="UniParc:UPI0000EFCDF3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L2"
FT                   /transl_table=1
FT                   /translation="MVWNLAGKRQIKRQMRGENGLARDEPHDATDDATGAYRDEQIHDW
FT                   STFLDKQNGRLMDGLESGSELSVAGATRTGWGDEWLQACNPSVRGATANENGRRRDEWS
FT                   RRSTNQR"
FT   CDS_pept        join(885063..885331,885406..885493,885572..886063)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812989"
FT                   /orf_name="An16g03940"
FT                   /product="Complex: together with the TAF proteins TBP
FT                   belongs to the TFIID complex"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /protein_id="CAK46825.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG499930"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012294"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="UniParc:UPI0000EFCDF4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L3"
FT                   /transl_table=1
FT                   /translation="MDSLTTHPSTAQQARAFTSPASLSFPGGAGDLTPPSDKDGNMAMA
FT                   QGANGMMNGQQQGGNATNGNGVAPATPAATPGANTPGSGIVPTLQNIVATVNLDCRLDL
FT                   KTIALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYAR
FT                   IIQKLGFNAKFTDFKIQNIVGSCDIKFPIRLEGLASRHHNFSSYEPELFPGLIYRMMKP
FT                   KIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSGMHRSPRFGSEVDLLLTSCKDFRK
FT                   V"
FT   CDS_pept        join(complement(889691..889739),complement(888633..889617),
FT                   complement(888285..888565),complement(888125..888183))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660197"
FT                   /orf_name="An16g03950"
FT                   /product="Cofactor: FAD."
FT                   /EC_number="1.5.3.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46826.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG328502"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCDF5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L4"
FT                   /transl_table=1
FT                   /translation="MSLPANILIVGGGVFGLSTALSLSHRHPNSQITLLEASPIIPNPH
FT                   GSSVDSSRIVRADYSQPHYAKLAAEALDLWRNTDWGKEGRYTQNGLLLVYPPGSTNARD
FT                   YANKSYENVKQIPGQDVELLPTREDVARAAPAYGVNLSVEGGYVNWGSGWSDAEAGVRY
FT                   TKQRLDQEGKVIFKTGDVSSLQYSNDKSNRVTGVNLADGSSLTADLVILATGAWTAKLV
FT                   DLRGRTVQTGQAIAYIRISDEEQKRFEHMPTILNFATGIFIIPPRNNMLKIARHAYGYV
FT                   NPVQVPVPGTAQDEGKRMKVSLPEKGVPIPAEGEKAFREALKELIPSFADRPFAETRIC
FT                   WYTDTPKGDFIITYHPDHPGLFLATGGSGHGYKFLPVLGDKIVDALEGKLEPALQDLWK
FT                   WPAAVPESEFDGTEDGSRSGPKGMRLMDELLKTRKAKRGMEGMWSDEMEISRHHLARS"
FT   mat_peptide     join(complement(888633..889600),complement(888285..888565),
FT                   complement(888128..888183))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L4 "
FT   sig_peptide     join(complement(889691..889739),complement(889601..889617))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L4 "
FT   CDS_pept        join(890021..890127,890294..891110)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000236769" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901885"
FT                   /orf_name="An16g03960"
FT                   /product="Similarity to hypothetical proteins YDR316w -
FT                   Saccharomyces cerevisiae"
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAK46827.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG557472"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="UniParc:UPI0000EFCDF6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L5"
FT                   /transl_table=1
FT                   /translation="MSAPRVGRAALKKAKLPASASASKPAPRFPVADGTGVMTIFGVSA
FT                   LTLSTYIGYLYASYRREVTQSQSLSVPHDVSDRYNHTARTFDADVEMSEKVMRMGSKRA
FT                   DLISRARGDVLEVSCGTGRNLQYYELGQRRGLDSKGRAGMHGCRSVTFVDLSPEMVEIT
FT                   KAKFAKQFPEHEVPVNFEVQDAAGVPRRPVDPSRKGDEGYYDTVVQTMGLCSMPDPVGT
FT                   LRHLGTVVEPNKGEILLLEHGRSHYDWLNRILDNLASAHADRHGCWWNRDIGKIVRDSG
FT                   LEVVEEKRWHFGTTWKYVLRPARTEK"
FT   CDS_pept        join(891844..891892,892097..892169,892232..892303,
FT                   892396..892547,892793..892841,893153..893399,
FT                   893777..893965,894007..894028,894125..894357)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117186"
FT                   /orf_name="An16g03970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46828.1"
FT                   /db_xref="UniParc:UPI0000EFCDF7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L6"
FT                   /transl_table=1
FT                   /translation="MLTLLNYFFPLYLCDDWREGGEHAVYYWGEDYLLRVERHGNILKF
FT                   RSDILRLTLASHAVYSSHKRRSVHRQKLKRWDDDADDDTQLQFQPVCPVSSCRCCPPRK
FT                   SGDKVHTYIAACNEMEITSYISSRQQDSLVAVSQNPPSQPRPGVARPGFHAERRALCPL
FT                   SSSRLSATSHPSDWVLFQSSRRPGIYSTAADLIRYRLQTATLGTIILGTAVVVAAVLPS
FT                   RWEGTQYIPLYFKLLPRSLDKTTEQETCNLFEAREKKKHQIRWSQKMVRFSRNLSSGSQ
FT                   KLGSTRSQGALVSCRLASSSYPIRPPWIDSTEHTPLWSPCRTSVDHGLLRQSPSRAFIL
FT                   VVIDTWLVPPYFLPLQSIGRV"
FT   gap             895009..895108
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<895109..895153,895275..895924,896000..897131)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196759" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901886"
FT                   /orf_name="An16g03980"
FT                   /product="Remark: N-terminally truncated ORF due to the end
FT                   of contig."
FT                   /protein_id="CAK42870.1"
FT                   /db_xref="HOGENOM:HBG023591"
FT                   /db_xref="UniParc:UPI0000EFCDF8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L7"
FT                   /transl_table=1
FT                   /translation="PPSLILLPPLCTILPTIILLLLLLVLLLFPCFYTVLFLPRVFVWL
FT                   SVYYFTTTTSIIAYRSPISIVPLLHFLTTFLPFFFSDYAAMPYNTRRKSLSLPSLGIHL
FT                   PNTSRRSPSATKSPHATDDQLPPSKKVKRSHDSAYSLSPEPSSSSSARTPDGKESAAPL
FT                   RQSGRRGPLEHTPPPSPTDGTVATKIDTEGINDDIVVGVIEQLEKTGNRPHLVKELAAV
FT                   LIALNENVANSANPAALLSSRLSAYMKRPWTALAPCPIAKELVPIHPRKVYYYLTTLPR
FT                   QPLPENSDDVIIPGVEGKDITPSVSSADLDEEDAMARERSRLSPSPEVDLSSPDFEEES
FT                   IDLDGRNGPVGASRSGTDFNDHHHARLMHSNRAASPPLEGDEKEFTQTASAVRERASEQ
FT                   KGGQLQIPGGGFSALSEGLSELHDGAMSISDSVEDSPLSSISGDRMSDDQDGDYFSHNA
FT                   YQQQSPLQDHLQQQQDFDDAAVATLFGTSPSPSLTSVASSISSGTSVASDDGLDGETQP
FT                   ETVGRTPQISLPEDLTVPPVSALKRSIDMLNSGLPDLDMKMSDLNEQDDKLPLGASAFA
FT                   SQDVEMVFDSWRELQSPETVEVDELDEMFGEI"
FT   CDS_pept        join(897839..897928,898008..898085)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660198"
FT                   /orf_name="An16g03990"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK42871.1"
FT                   /db_xref="UniParc:UPI0000EFCDF9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L8"
FT                   /transl_table=1
FT                   /translation="MWMTGSFLECGGTGVTGVTAGTRHANVADLESRCWDGGYLRHSQG
FT                   LGCDDVTEHY"
FT   CDS_pept        join(898685..899079,899144..899255,899333..900042,
FT                   900103..901542,902068..905380,905540..905602)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201466" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901887"
FT                   /orf_name="An16g04000"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42872.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCE26"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7L9"
FT                   /transl_table=1
FT                   /translation="METPGFSQPGEGLSQGDIPLRPHTEGPSIVVPTAHPPALPGTSSH
FT                   NPQKPRLATRPAYAEKKQLLSSGSSKVAIPRQRSTAAPRYTRRVPLACESCRQRKTKCS
FT                   GDTPVCRQCKELRISCRYPVSWRERTKGELDKLAVRVTDYENLLRDLGPIVDGRAAERI
FT                   RTVLEKHSDSGSGENTQSSSVTPQDEDNDDEVTSPSSIGSLDAIDRVEEDVNRTPSSRA
FT                   TGYMGKNSEVTWMQRVRMEAEHRARKLPGPYEAEDEGEFAIHSVNYHLDDMDISVPGPV
FT                   HVYWMPPRKVADKLFEDYLDTVHPFYPIISRTLFRAQYKTFFESAARPGDKWLAILNLI
FT                   FAISAKHAHLTRAPWRGDENDHLVYLTRARILSMNGDVLFSHPDLQQVQVEGLIAYYLL
FT                   ASDQINRAWRIAALAVRSAVTLGLNMKNSSEGTANISKEARYRVWWCLYTFEHMLGIMT
FT                   GRATTITDGICTTPFPLPFEEDQLVEAAATKLLNEPELRQEHIDSALACISVRQMPSNP
FT                   KGGRNAQTTDKPRDPTWLRSVPPSSALGFLYYVDLAVISQEIVNRVYSLDCVSIPWGHI
FT                   ENRIGELRARTDVWYANLHESYDFTRREEDQPAATLRGKLFLAFHYYSARITLGRPCLC
FT                   RRDARQTASNKKETFSHEMAVITLESARRMLDLIPDVPDAVRLYDVCPWWCILHYLMQT
FT                   TTVLLLELSFGSIHMPDEEANFLQAAKKAIRWLFAMSENSLASRRAWELCYGSLRQIAA
FT                   GMSYDISDLPAYGFETQPQAQAQGQALNGTQHDYLSHLEETMHAGPTFYNPAAADMSNS
FT                   ASASSSMAQQPSMLFAQTEQPLQGLAMPASNPFPTNPELNSGSGDSYFPYDPISGVFIR
FT                   SFFPSSTGEEPWGGATLTQQDEFPRRSFSFRRRRNTSKAFASLQQLPPPVAGYRQAHAL
FT                   SAQIEECRPVSTIRHAPQNVRPTVTSRFGFPPPAGLLRYLRRVMKRCLSPARLPCLDRG
FT                   SSFVLHPSILRRLAPRHIALTSRGPFPDRRRQWSRQFSVGAGPPINRQLLQDYVRVGMK
FT                   RCPVAGPDQSNPEAWIARLDQYLPPSLRRDSDGHTNNDDVPDDAAIRTDAAYFAQTIEL
FT                   ANLLLHARDSGKIDLLAYVGFRLNNWPAVQFLINRLLDAADSLKEVTLPSRPLSSYDWG
FT                   LGLGLSLDELTDRSEPQAPKIPQASNGLTASDMTSLDAFTERPYADDHSKRFMAEVWQS
FT                   LGSIVLDAADASPNEAKLAMSHVFQVLARLHHSDAISDRVYKYVPPDSYQATFRPPGMH
FT                   LLSSHIMSVLSDAAWLVHEAEVAAKAAAAGEDSPYLPFKMGVRELGPEVWLEFILWCCV
FT                   EHGHIEEGVWLIDRMTSKTGDQAWKFQSWKPLLDDSGSVWQTKVDQEETWRQPGHQERS
FT                   TMLRKRHSPTPFHGLGKRTMSTEVAAALLDSLPNQVYLGLGFRGMSPSALLRYASSLKF
FT                   AIAPSTDDGKLLPTRRTSNWFAVRVMESGGLKPEADPRTFEDFLRITPCVVPPWDTDLY
FT                   HVNEDALTRMSRSQLYDDTAALVGLIEYNIRFYSSERFCGDALNAFSWLQAIVDSSKMQ
FT                   RIDEFFSSRVDRPGVVLPTPELDDLDSTEPFESSMPQLSSVTLAELIDLVTVSRAFTFG
FT                   NWLFYSDDIDGPPVSPRAYGDQALAPSIIRYATATRNAALCDAVVQSLSQPLSSNTLRA
FT                   LLNSRIALHQWDAVTKLFEYLRDYRAKSWGQSNATALAAEIIRLEHTIYRQQPPPDPST
FT                   LQETTTSLTRAKELLSRLLKGTYNEPNHIATSRFQERAISGLYNIFLSIPGTLHDLAAS
FT                   ITNSSNSNKFSTPRNAIPYIPATAFHTLLSAIVDTRGSAAGQRFYDKWCLDTKSPTSRR
FT                   LQEGGIVRFYLGKERNLAKGDPHFDARYFKRAREKATMPNPTTVRIIAQAAVAEFHEHE
FT                   AEGKGAVNPAEDVLSFCIKRFEAFGMRRREINREVGGILYRRRREGDKLRREMKKEKMS
FT                   DNRLLYYITTSAFMCISY"
FT   CDS_pept        join(complement(908337..908381),complement(906080..908284))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196781" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660199"
FT                   /orf_name="An16g04010"
FT                   /product="Complex: Tid3 from S. cerevisiae forms a
FT                   centromere complex together with Nuf2 "
FT                   /protein_id="CAK42873.1"
FT                   /db_xref="HOGENOM:HBG328506"
FT                   /db_xref="InterPro:IPR005550"
FT                   /db_xref="UniParc:UPI0000EFCE27"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M0"
FT                   /transl_table=1
FT                   /translation="MSQDTGLFSIRRTRELSQSMAMGSQNYSALPQPSSALKRTSSIGY
FT                   QNPPFTSQHTRMSLLNSASRPQQPNFQRSSSGGGFGADAGLSSVRRSVSSNMFHGPSVG
FT                   RPSFAPGPMSSQSTAGSQGLQRRSSVFSRPSVGGAMGHHSFFTQVPSVAGVPRDPRPLR
FT                   DRSFQARIGQELLEYLTHNNFELEMKHSLGQNTLRSPTQKDFNYIFQWLYHRIDPGYKF
FT                   QKSMDAEVPPILKQLRYPYEKGITKSQIAAVGGQNWPTFLGMLHWLMQLAQMMDRYLLG
FT                   EYDEACAEMGVDVSGDRIIFRFLTSAYHDWLQGGEDEDDATAEKRLVPHVEMMAQEFER
FT                   GNEKYVQEMESLEAENRALRDQIEEMEKNAPDMAKLDKHFRILEDDKRKFEDYNQNVQG
FT                   KIEKYETRIKFLDDELKKTEDDLQAAEEERAGLQASVDQQGLTIQDIDRMNTERERLQR
FT                   NLDDTVNRLEETHARVMAKEAEASRKLEDLEEIVKVYNTLGYQNSLIPSSAVNAKGDDY
FT                   ELSLNVNESNFSASQVGGLANRISTDGDRLLADPFTGYHPAHLLNLDLRGIVRSNLQAL
FT                   RKEINERRKRAIDDDLERRNLLDNIKEAMDEKRSEVEALEHKARAAEEEFERLKEVTTT
FT                   QKLASDAQIEKMEKELAKMRATLGESVQLMEQREMNTNIEYEQLTLRANALREELHTNV
FT                   ESMLNDVIRFKVHIQKGLEDYESFVVDEVEQELGGDMQFADEDIEMGVEEEEEEL"
FT   CDS_pept        join(908940..908969,909044..909050,909110..909362,
FT                   909419..909503,909562..910299)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117187"
FT                   /orf_name="An16g04020"
FT                   /cellular_component="membrane"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAK42874.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG328507"
FT                   /db_xref="InterPro:IPR006785"
FT                   /db_xref="UniParc:UPI0000EFCE28"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M1"
FT                   /transl_table=1
FT                   /translation="MVREELISSAVTFLQDPSVAASPIEKRVAFLQSKNLTKEEIDVAL
FT                   ARAGEDPSTAAAAVTASSGYQSAPQQVVYRPPPPPAAGYGYPPYGQWQAPPEPPKRDWR
FT                   DWFIMATVMGGVGYGLYTITKRYISPLIAPPTPPQLEQDKEHIDEQFNRAFALIEQLST
FT                   DTAALKSAEETRTERLDTALREVENLVSDMKNASRRRDDETRRISDEVKSLKDAIPKAL
FT                   EGAREGNETRLKELGAELKSLKVLLGNRLGGSGNNATSPAPGRFSGMNIPTASRPAEES
FT                   TPAAAAPVNGTPAAPASTEQPSQSAQPTPSPSTPSMSNSPLSQLGRSASIPAWQMAAAN
FT                   RSKTASPSTPSTSTPDNTTGAAPESSAPAS"
FT   sig_peptide     join(908940..908969,909044..909050,909110..909135)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M1 "
FT   mat_peptide     join(909136..909362,909419..909503,909562..910296)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M1 "
FT   CDS_pept        join(910732..911153,911223..911506,911598..912027,
FT                   912379..912735,912776..913199)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901888"
FT                   /orf_name="An16g04030"
FT                   /product="Similarity to hypothetical protein B15B10.090 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK42875.1"
FT                   /db_xref="UniParc:UPI0000EFCE29"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M2"
FT                   /transl_table=1
FT                   /translation="MSTRDSYSHSRSHRDRTHSHTRSRTRSRSPNRDPTSRSDKHRSSR
FT                   HHHHHRHHHHRHDRHRDHDRDRHRRDRHTSRSKDQPEPAPAAPIVLPFNSRELTKYDLE
FT                   HYAPMFDMYLDIQKGIIMDDLAEDEVKGRWKSFMRKWNRGELAEGWYDPATLEKARTNL
FT                   AQMQAQTSTNTGYRGESQQDERRDATRDRDVEGEDDEDDDEYGPVLPSTSGRGGGPSSG
FT                   PTIPTMQDLELRKELAAEDAIAARQDSRAQYRSELRSHKSEFKYLQEEVAPRAEPGTHE
FT                   RRMEKRQEAAASNRAFAEAKRGGSPEAAPEEELMGSGENDLDSLKKAREREQRKKNERE
FT                   IRREELLRARAAEREERLQQYRQKEEETIGWLKTLAKQSHTAQSQKQQRSTTMPVPPAA
FT                   PPLTQVDNPPSTSQRTLIITSPDWNTHDVFFKITRGRFLVDEAENLRMREIKFDMNDSP
FT                   VSQQNGWGPLTAPLYRSIPTACSTRPFSCRWTMAAKSLQSQRGRYHELRISYHIYQCRV
FT                   QLTQLDPGRPETCSEHQRLVSTHGTRMQNNTQLELSSSWRKLPAFPFSGMGDTEIGSEA
FT                   TSASCHDMSAEEVAKCVIHASWQLVLRQRHTAITTRRSRPLHQNLGSHALQSLSIMDET
FT                   VRD"
FT   CDS_pept        join(complement(916870..916950),complement(916567..916616),
FT                   complement(915723..916524))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812990"
FT                   /orf_name="An16g04040"
FT                   /product="Remark: the patent protein AAY81534 can be useful
FT                   as a vaccine"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK42876.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI0000EFCE2A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M3"
FT                   /transl_table=1
FT                   /translation="MTGYAKKRPVTKSDLKLAGRSEVNHQEVLSLNCAFGERWWYRSNY
FT                   MGALLFSSATFILPAIYGTLVKIWMANIDASLVVTIDVYTHIGTVAEVINEGLPRAVWS
FT                   TIADKGARSLGARLGLAHSLLVFQTLMGVLLSIMFVCAAREFLSKFVPHDVAEASITYV
FT                   HISSFSALSSAVEVAASSATRTLGKPDVPLVINTVKVAVNILLDLLLTSKFHAGGWQPT
FT                   VIMQAGICDMVAACSGLPYFIITTSRRENAKAPSTGGFLAPFKPGSVTFIDSAVRNTLY
FT                   LWLVSGVVADLKLLLFSRMKSYNHHYSID"
FT   CDS_pept        complement(917852..918511)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966153"
FT                   /orf_name="An16g04050"
FT                   /protein_id="CAK42877.1"
FT                   /db_xref="UniParc:UPI0000EFCE2B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M4"
FT                   /transl_table=1
FT                   /translation="MSSPEVVRQITDLIGVIEQLMAAFDSIKDLSNLPEAFQEASNWLP
FT                   IVERTLRDVKSSAEKLKSAEDVRASKTALYSCDKKADNLLDIIEQLGEKSKGEYHSSVY
FT                   QGIVMRQGKQRVETLMDGILESLGALVTHKAFLGEMHNQISLLAKGREDLAGVCPSLAD
FT                   SDLADLPGAANQYGENSRQYNLFGEGTQRIADGHYFEAKGNQNFGILPPKETVESI"
FT   CDS_pept        join(919305..919328,919397..919446,919569..919736,
FT                   919782..920019,920190..920504,920560..920892)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235044" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117188"
FT                   /orf_name="An16g04060"
FT                   /product="Remark: the protein BAB55393. 1 is encoded by the
FT                   cDNA FLJ14917 fis"
FT                   /protein_id="CAK42878.1"
FT                   /db_xref="UniParc:UPI0000EFCE2C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M5"
FT                   /transl_table=1
FT                   /translation="MNYLLFIGVERDVSIVTPSIADAIRFSQFKMPFFNQAMVNRVLRR
FT                   RRQPSSAPNPTPELQQRKSFPNGIKTLCSPDDGTIDIVFIHGLTGDREATWTAEGATEP
FT                   WPKSLLPSILPTARILTFGYDAFVVDWRRPVSENFIGNHAWNLLTSLSSYRDNDDTALF
FT                   QSRQRSEKHLQSILDCTRGIIFLGTPHHGAGLANLAEVVSRSIGLLKQTNPKIVDVLKR
FT                   DSEVLARIQEGFHTMIKAHSTAETPPIEVTCFYEELPVLGVGLVVPQYSAILPGYITIG
FT                   IHRNHMDMTKFVNSEDPGFVAVCGELRRWIRDTDLNERSHTKKSPAVKPHAACQHGKNG
FT                   RQYNLFANGAQRIADGHYFEAGGDQNFGMIPPKGQ"
FT   CDS_pept        922943..923311
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901889"
FT                   /orf_name="An16g04070"
FT                   /product="Similarity to hypothetical protein BAB08329.1 -
FT                   Arabidopsis thaliana"
FT                   /protein_id="CAK42879.1"
FT                   /db_xref="UniParc:UPI0000EFCE2D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M6"
FT                   /transl_table=1
FT                   /translation="MIFLAHRMFEYGEAHFQSLLVDLKDHWEDLPGVSGDFPFPFSFSD
FT                   AEIERIKLVSDGAVAGTELVAGVKEQLGDLWPDKGLIEHERYEECRAALEEVRDRIVEE
FT                   LGESEEEREEYRRLWPFD"
FT   CDS_pept        join(complement(926155..926166),complement(925137..926050),
FT                   complement(925026..925085),complement(924884..924948),
FT                   complement(923535..924853))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812991"
FT                   /orf_name="An16g04080"
FT                   /function="ATP binding"
FT                   /function="hydrolase activity"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAK42880.1"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG324223"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI0000EFCE2E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M7"
FT                   /transl_table=1
FT                   /translation="MHILVVNDDGPPSNQSSPYIHSFVQSLQSAGHIVSVVLPHQQRSW
FT                   IGKAHLIGAAVKPTYFRPGTLHKDDGTTHEFPHGMNEGDDDSYDGDEWILVDSTPASCV
FT                   QIGLYHYFQDRGPIDLVVSGPNYGRNSTALFALSSGTIGGAMEAAVCGKPAIALSYAFS
FT                   SRDHDPVVIAEASRHSVRLIEYLHKNWADGVDLYTVNVPLEPGVSQNKVLYTNMLDNRW
FT                   SSGSCFRAVDASASANSPEKQEHDVRHQTVGSGEKSAPAVDGTTPLKRSRIQHKHFEWA
FT                   PNFSDVYRSVEEGAPGNDGWAVKEGMTSVTPLRANFMHTPGIQGEITLLCISRSAVCPF
FT                   DCSFCYLLYLDSISCRPDNNTEPTFYSLVDSDDSYVQSLMERALQRRLGNGQCRAISSL
FT                   SDLPSRTTPIFQYREYERLDFEHTMMHTSTSLANAYIIRKALIRKHYLSNTVINWVTKH
FT                   PDSVLGKHFKPGFDFELDYAEFLDDALLEAYELRESLAKNETLPDEEKEWWILKPGMSD
FT                   RGQGIRLFNSEDGLREIFEEWEVPDSDDESGSERPEPEDNDEDDDNHGVVTSQLRHFIA
FT                   QPYIDPPLLIPSSHNRKFHIRTYVLAVGSLKIYVFKEMLALFAAKPYCPPFEDEDEVTD
FT                   LARHLTNTCFQENGRANPDSVRRFWSLEDYVPGLSDTWKQNVFDQICAVSGEIFEAAAR
FT                   GMMVHFQTLPNAFELFGVDFLVDKKGNAWLLELNAYPDFAQTGEDLKELVVGKLFEETV
FT                   DVAVKPFFGLQEDGEDMGKGTEMLKLVRDVDLGRKA"
FT   CDS_pept        join(complement(927522..927700),complement(926966..927421),
FT                   complement(926405..926900))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901890"
FT                   /orf_name="An16g04090"
FT                   /product="Remark: Suggested activities include nutritional
FT                   sources or supplements"
FT                   /protein_id="CAK42881.1"
FT                   /db_xref="HOGENOM:HBG324222"
FT                   /db_xref="InterPro:IPR009617"
FT                   /db_xref="UniParc:UPI0000EFCE2F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M8"
FT                   /transl_table=1
FT                   /translation="MAEALRPLVSKRAQKIYLGAFLFFCTAIAMIVTSTVAYGIFYYRF
FT                   IPQAGLERIVHLQFGEGPPWGVASLGSDLVPSLPYDVQVELELPRTPSNLAAGNFMLDL
FT                   ALLSRPSTSAAYDTNTSVTTLSHSRRPAILTYTSPLVDTASKISFMPLYVLGWHHEAEK
FT                   LQVPMMERVQFARGWRNIPGSLRLELHSSEIMQVYKAKVTFRARFTGLRWVMYNWRLTS
FT                   FVVFGFLFWSVSMASTGLAWVVFASLLSSRGDTSGPVVKKEDRSATPIIKKEEEEIDEP
FT                   LFHLPIAESSKTAEKRRVTGPEEAEKEEDEEDNGGIADEDETDEDNYLYEEDAEDGRGE
FT                   GPSEASGTGTARESAHARGVQRRRSHIIQEDHRETL"
FT   CDS_pept        join(complement(935024..935746),complement(928649..934945),
FT                   complement(928520..928585))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117189"
FT                   /orf_name="An16g04100"
FT                   /product="Complex: Cdc39"
FT                   /protein_id="CAK42882.1"
FT                   /db_xref="HOGENOM:HBG328514"
FT                   /db_xref="InterPro:IPR007196"
FT                   /db_xref="UniParc:UPI0000EFCE56"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7M9"
FT                   /transl_table=1
FT                   /translation="MTFPPPPPSSQSSIASGTDKSSSTRPARSQQSPWGPSVSQSSVRR
FT                   GLTPLATNNLSSLASASRGPPQSNSPGPGGSTASPLTSSFSAVLSSARGHPVGRNVPSP
FT                   ASTPSPFASFQSGSQQHQQPGQSLSSPKFRAHTPSSGSHLASAAGSVAGGGGSGGGGGG
FT                   TGSSRGATFSPLLSGTTVNSPTGFPSDKPGSAASGSAAHASQSSLTKISIAQVFLLLDS
FT                   ITEKEGREKWETKAAQIHKLVESNGMEVFSKYFRRLLTGNAPQIFPGVNKSVENAGNYP
FT                   LLVQEMQKVSQDIEQAQKIAETVDTSEGDIFRDFDLSTFLDHFKLDPLVKVSLALAFKT
FT                   ANKSDLRAKGELFSPTMRLCSKSTDECFLAADAIISNSITPFLQSLATLSDVSKDYKNS
FT                   FIGMTIERFILYPPRNFTDEVKGKLVYAANLRYQKLGVDMPFEVASALQMFNFINPRYT
FT                   LVRQLHSRGPKATSNADAVTETINAIGPECWGEEHIASALLFLVLCQHWREFSLETFLG
FT                   AVQAHYGEKRINWSLIFRSFDREGLRLDARQFTKLYAVLLAAATDDSTLDIQKLWGGDW
FT                   EHRDTQMSFLTAFIASRTDVSQVPNLRATFPSDFFADGPELVRLQGERAAKSPLRSLDA
FT                   MRAIFDLALFSQASWAAAESQLMIKAVVQYDLPVFLCSALSLPQPWTSVQQSFVLRTLI
FT                   VFILKQEEGYHLALHGAWRQDRQWVAEQLFTTFTQDPTSTAAIYEHAVDFGWLDYLLGY
FT                   TNGLAMDLACYAHRKGPFDLEQWVRNAAQKGPMDMGSLLSKFLRIKAEDELHVQRKEQS
FT                   APQMVSLAVKTVFTLLSVLEEYVGDRENLTPVQRICIQTYPRLINYGEGFDDIIDANGE
FT                   NGNSLPEAVDKQMQELFGKMYHEELSLREILELMRRYKSSREPAEQDLFACMVHGLIDE
FT                   YHCYHEYPLEALTKTAVMFGGIINFRLVDGITLKVGLGMILEAVRDHEMHDPMYKFGVE
FT                   AIEQLINRLPEWAGFCHLLLQIPTLQGTTIYQKAEEVLREQGSQVRDEAGRADSIPGAA
FT                   VNGNVDENATADGSTRKFVSVHVDPLIRPEVYRDPDEDVQDKILFVLNNVSEQNIDEKL
FT                   RDLTDVLRDQHHQWFASYLVEERAKLQPNFQQLYLDLLDRINDKLLWAEVLRETYVSVS
FT                   KLLNSEATINSSTDRGHLKNLGAWLGSLTIAKDKPIKHKNVYFKGLLLEGFDSQRLTIV
FT                   IPFTCKVLVQATKSTVFNPPNPWLMDILALLMELYHFAELKLNLKFEIEVLCKDLDLDH
FT                   KTIEPSVIIRDRSAHIEDALSTANIPDGLEAFEDMTLTSINQGIRHERLSPAAIMSTLP
FT                   SLDKILVLPSSASSMVDPNVLRQIVHSAVERAIAEIITPVVERSVTIASISTVQLVSKD
FT                   FAMEPDEERVRHAAGIMVRQLAGSLALVTCKEPLKVSMTNYIRMIQQEYSDQPMPEGLI
FT                   LMCVNDNLDAACGIVEKAAEEKSLPEIEKVIEPQLEARRRHRAARPNEPFIDPSMNRWG
FT                   LFIPEPYRQAAGGLNKEQLAIYEEFARQARGPAAAHVQNVSTDSGRQLPDVLQEPYSPI
FT                   PNLSTPAEQPAVPHRTPQPQQDARLQQTGLVGAQSQLNGFLEAQSPREKVESIVSELQQ
FT                   AARNAPEERIRDLGRESAVLQEYNQALRTILASPNGEELARLTGLRICTTLYSQTPGTL
FT                   EIEVLAHLLAKLCDMSTLVARYTWAILSEVDDEHMFNVPVTVALIDVGLLDIRRVDMIL
FT                   TRLILQKNTAALDVLSNLMDRVLFSEEPSALRSDFSGSLEAMSQWLAEESDVTVANDII
FT                   RKLRESGIPEVVNPLLSDKARSKRDQMEYIFSEWIGIYKAPGAIDRTYYSFLKDLHQRR
FT                   VMDNQEDSALFFRLSIDISVAMFDHESQNPSGSLDEAFLYIDALGKLVVLLVKFQGEST
FT                   GAAKTSKAAFFNSTLSLLVLVLNHHHVMRGEAFNQRVFFRLFSSILCEYSMNGLQQSDQ
FT                   HQDMMFAFANKFLSLQPKYCPGFVYGWLSLVSHRFFMSGMLNMPERAGWGPYCEIMQAL
FT                   LSYIGEQLKPASISYVAKDLYKGVLRILLILHHDFPEFVAENHFQFCNVIPAHCAQLRN
FT                   LVLSAYPSSFHKLPDPFREGLKVERLEEMREAPRIAGDTAGPLEQANIKSAVDSALQST
FT                   NASDSVIQQISDAVYNPPTKETGPYYTPINVNVVLLNALVLYIGQSAVSANATKSNIRA
FT                   AFDNSPHSALLEKLAKAFRPEARYYLLSGMANQLRYPNSHTYFFSFAILRLFGTDYSEQ
FT                   DDSDIRQQIIRVLLERLIVHRPHPWGLIITLQELLQNRSYTFFRLPFIQAAPEIGRLFD
FT                   ALLQHIQQQSPRAMA"
FT   CDS_pept        join(937342..937384,937447..937551,937611..937897,
FT                   937950..938162,938224..938322,938370..940449,9
FT                   40504..940673)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901891"
FT                   /orf_name="An16g04110"
FT                   /protein_id="CAK42883.1"
FT                   /db_xref="HOGENOM:HBG324221"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI0000EFCE57"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7N0"
FT                   /transl_table=1
FT                   /translation="MPGTVADGPTVAMSFANNFWGKEDAGVGPMLDRMHTSKVSCDELK
FT                   TFYNIRAAIEDEYARKLLALCRKPLGSTEIGSLRSSFDTVRGETEAIAKAHAAIAGQMK
FT                   RELEEPLIAFAGGSKERRKIIQNGIERLLKTKIQQTQTVNKTRDRYEQDCLRIKGYLAQ
FT                   GHMVMGHEERKNKAKLEKTQIQLASSSSEYEAAIKILEETTTRWNKEWKAACDKFQDLE
FT                   EERLDFTKSSLWTYANIASTVCVSDDASCEKIRLSLEDCEVEKDIIFFIKEKGTGQDIP
FT                   DPPKFINFCRGDINDTSSEVSEEEGYSVAQFQRTINPAYRTSSPQPSSYEPQIDPDAEI
FT                   AAKINGPSTPSSREATGTPQKAPQQPMQQPVQKHVQQPMQQPPQQPIQQPVHQPVQQPM
FT                   QPPMQPPVQQSMPQPMPQQMPQQMQQPMQQPAPLDLRRGGQLPPNYDPNQHGEIAKVPH
FT                   NAYPTDGMTMFCRTGPPSERSSGSNSAYRPSSRDSQSEVSNPTSMSSQEPPSARQSPTK
FT                   PTNGVALPGLGADKQVQKKRSAFFSNSPFRRKSRHDKDRQSGPSQPPSRGTWESPSKPT
FT                   SPVKAPQPQQPISVPDPDRVSGSPEPVDPRANFQLNVGNNVFDVGSPDKDKKGSQAKAA
FT                   KGGEEELDPIARALADLKVAGKQSTTRVSADRYHGIATPVPPVAANPGAVSTPPPAYND
FT                   SSLKRLDAPQPAFTSAQMQKTTQRYTGQAQNMLRGSSKPPSLTSRHGAQSQEATRARSP
FT                   APRRSASPHVSPRVDTRMGQYSRAASPSPTYHSSSSMRSRYNQSPTVPSPSQRPVDASP
FT                   TAEYARRGSSRAVSPQPQYRQSPTMAPRGVSPQPQYRQAQNTMPRAVSPQPQFRQQTRP
FT                   SSAGGMELQLSGQPDMYAGSRDGYGSRRGSGRPMSYYDDAASVRSRSRSRTVAVADPSR
FT                   QFSRDGRPILHFARAMYSYTAAIPEELGFSKGDVLSVIRLQDDGWWEAEITTARSRTGL
FT                   VPSNYLQII"
FT   gap             942885..942984
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(944108..944404),complement(943735..944031),
FT                   complement(943448..943618),complement(943308..943391))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901892"
FT                   /orf_name="An16g04120"
FT                   /product="Similarity to hypothetical protein SPBC32F12.08c
FT                   - Schizosaccharomyces pombe"
FT                   /protein_id="CAK46829.1"
FT                   /db_xref="InterPro:IPR013960"
FT                   /db_xref="UniParc:UPI0000EFCE58"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7N1"
FT                   /transl_table=1
FT                   /translation="MMHRSTAEEMDRLQLSDDDSDDLWDSPSKRGNKILHQRAVKEESM
FT                   SPEPTITHDAGETLFDRQEAREAALRSELESVRKINQVIEGLLGSLDCAKENMGTVSRT
FT                   IDSASTLLNTWTRILSQTEHNQRLILNPNWQGAVQDVADMENEELLRQQAAERRERELQ
FT                   QQREAAARKAEEDQRKRALAAGSRTTRGTTTRGRVTGQWDRAGHRDCAGARQGVEAGMN
FT                   RRFSMYSTTRGYETKANDNDDMMIPKTTLKLCERGSDKVPEATNCGAAIKLLCTSSSGV
FT                   G"
FT   CDS_pept        join(945249..945994,946052..946649)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660200"
FT                   /orf_name="An16g04130"
FT                   /product="Similarity to hypothetical protein B8I24.160 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK46830.1"
FT                   /db_xref="HOGENOM:HBG328516"
FT                   /db_xref="UniParc:UPI0000EFCE59"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7N2"
FT                   /transl_table=1
FT                   /translation="MATTPPPPSTLRIPPTPRLGAKYDDYEPYSTRYSARLASQRAARD
FT                   RESRTTPPPSFPSSKTANKYDMNESDTLSPPGSVQTSPRKLKSARATGLFATHSLEGPS
FT                   GTNDSDPFGAGPSSLRHQSRSLRPTMTEGMLPTPAKTPRKKAVADVGNTARVLFPPPSA
FT                   RKKTKKHTGFSLDSFCEDDTQGGSEIQIYTDSRDRIPEVDKSEDNPFYNKPTASNTTTR
FT                   ASRRKETRRDKEIDDSLNREDGMLYVFRGKKMFRKFTDDAESDLDDDDDDLGLLAARPD
FT                   LIDSSIDTVRPLTRSSIKPRVLFPTAKSQTPQESRSSDVDEEAATDIEDHLLHDEVEED
FT                   ENPTVDVEMQQRPVTPPPQSTVATPPSPGATMRSLRSRSKRDGPEHSETPTASETKKKR
FT                   VSPFDGWLRKKTAPALTGTKAKKRDAEAAGSPGGPAPKKTRGNKATAS"
FT   CDS_pept        join(complement(950496..950505),complement(948009..950416))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196892" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19812992"
FT                   /orf_name="An16g04140"
FT                   /protein_id="CAK46831.1"
FT                   /db_xref="HOGENOM:HBG328517"
FT                   /db_xref="InterPro:IPR015408"
FT                   /db_xref="UniParc:UPI0000EFCE5A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7N3"
FT                   /transl_table=1
FT                   /translation="MTSMAEISWPPKSPRDALLSTPNGRKRYEDMQRRREHLGSPLKHS
FT                   VTTPDLRSKASQLLSDGVDEGEDDEDEETLQLKLAAIEARLKLKQLQKSRTKTGTPGPD
FT                   KHGGETFSRPASAIGSFQGQDEPIGTRNNGHGTDSTAHIDDVQVPLSPTRRAAPPTDPV
FT                   SPRRYLLGIDKGLRSRDVSLKRPPSSRGANPPASRPGTREGLVSRSGSLLQAITVGGER
FT                   SRPKSFSERMAESRSADASRRERAARIEKIQANRSSAFQIDKAEVEAFKAAAESRKDVP
FT                   GSPTRRRRAESFSREDVLRSYNLKPSLKRGRSQTTSSVQRSDDGVADAKESLPYFHRRN
FT                   HKSESEVPASSQNSATDDSQGEKSGDSSKFEAFSSLHLSNRILPHSFLSRTLEDKKALR
FT                   IPDLLRTVKAPDFELPEDIDTDYVVFGIVASKSEPRQIKQPANATKKEVDPFDDGTNNT
FT                   NQYMVISLTDLKWTIDLFLFDTAFPRYYRISEGILIAILNPTIMPPPKNKTDTNRFSLA
FT                   ISSSDDKILEVGYAQDIGFCKAVRKDGKTCHSWVDGRKTEFCDFHVDLQVRRTQAGRMG
FT                   VNGGTGMYGPGGRSGSRTGFYGGDKKGRPQNGLKPNGARYDYQSQSSYYVAPAPKTRGG
FT                   GSSFHPHPSGQSAAALIDADHDDPFIAAGMMGRGMESKEERFRRRLAEKQRERDIADKL
FT                   ISRTGGVGAEYLRSRDNDNVQSTRPEQAKNNLDAFSTTNLGISNFRKADSVKLSPLKRA
FT                   HDGDRPHGSGVKKTRFITSHGIKEAGRDSLGGKPDMVPTNYDDDDDDELDII"
FT   CDS_pept        951109..952350
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196903" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901893"
FT                   /orf_name="An16g04150"
FT                   /product="Similarity to hypothetical protein B8I24.140 -
FT                   Neurospora crassa"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46832.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG328518"
FT                   /db_xref="InterPro:IPR019024"
FT                   /db_xref="UniParc:UPI0000EFCE5B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7N4"
FT                   /transl_table=1
FT                   /translation="MRTRSSAPSEQPQSPPSTSDDQTTAASTSALPAQSKPQKTFILPS
FT                   TAGADARFLTLPNPRTASPTRYFFDPKLGVYEFTVLSSPPTTPRSTLLVRNPDPTSSST
FT                   SQPPAHISKKAELLLATPIDILFFLIPILTANTKQNNLFQPLDDIIDSLDEELLPPHLR
FT                   HVLYDETFRGTLHARAAAISDSVEAGDEKMFRFNETKLLQELVAKADRMVSVGLPPSLE
FT                   ERFVRQALATPLMAVKRDDVVATGENKENEGEDGKEEGEKTTADNEDAKEHLPEGLKAP
FT                   DGVANLLRISTALAFIKECYLSREMSARIDELLAAPESPKDFKPMQDHLDLVAKLRAEA
FT                   LATRSLGDFSRKRSVEDQEAAESRAEKKRRMEEEEKKKKANESRGVRDLKKVNTTGMKK
FT                   MSDFFGKAAAKKKT"
FT   CDS_pept        join(complement(953836..954491),complement(952893..953774),
FT                   complement(952797..952833))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000241099" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901894"
FT                   /orf_name="An16g04160"
FT                   /product="Catalytic activity: ATP + D-galactose [ "
FT                   /EC_number="2.7.1.6"
FT                   /function="ATP binding"
FT                   /function="galactokinase activity"
FT                   /biological_process="galactose metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK46833.1"
FT                   /db_xref="GO:0004335"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006012"
FT                   /db_xref="HOGENOM:HBG725121"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000EFCE5C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7N5"
FT                   /transl_table=1
FT                   /translation="MATPQELVPQTESIAEVYATDDASVTSVAPHHQSRFNNLVSQFNK
FT                   VYSYRPDFVARSPGRVNIIGEHIDYNLYDVLPTAVSVDVIIAVKVVPATGSDSVVKIAN
FT                   VNPEKFPAREFVVPRDTDIEIDPKKHEWVNYFKAGLLGALKFLRKQNADGSFVPASMEV
FT                   LLDGNVPPGGGISSSAAFVCASALAVMKANNHNVSKQDLLDLAVVSERAVGVYSGGMDQ
FT                   AASIFSRRGYLLYTQFFPNFSVQHVPIPKADEEITFLMAQSFVTSNKAETAPRHYNLRV
FT                   AECTLAAVVLAARNGLTLPKDNSSLGFSLRNFHNELMRKEGRLGDPLEYQIDSVIQSTL
FT                   ELLTQEEGYTREEIAKLLGITVPELEAKYLSSFPVQAERFLLRQRALHCFTEARRVLDF
FT                   KACLAKASTLDERRIQYLGQLLNESQASCRTQYECSAPEVDEICDIARRAGTLGSRLTG
FT                   AGWGGCTVHMLPQSKVEAVTKALKEEYYLKHFPDISEEKLAEAMVISKPSNGSFMVTGA
FT                   AIAQVEV"
FT   CDS_pept        join(956745..956908,956988..957086,957158..957225,
FT                   957297..958982,959047..959102)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901895"
FT                   /orf_name="An16g04170"
FT                   /product="Catalytic activity: 2-acetolactate + CO(2)  "
FT                   /EC_number="2.2.1.6"
FT                   /function="acetolactate synthase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="CAK46834.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG323037"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="UniParc:UPI0000EFCE5D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7N6"
FT                   /transl_table=1
FT                   /translation="MMPMRPSKSAMRALHYQRYIASGRMTFTTASVAATAPHRFSAQKR
FT                   FQSTATAPAEGTRPVPSPAFNQEPHRNEVSPLQNRQVPELDDSFVGLSGGEIFHEMMLR
FT                   LGVKHVFGYPGGAILPVFDAIYNSKHFDFVLPRHEQGAGHMAEGYARASGKPGVVLVTS
FT                   GPGATNVITPMQDALSDGTPMVVFCGQVPTSLIGTDSFQEADVIGISRACTKWNVMVKS
FT                   VAELPRRIQEAFEIATSGRPGPVLVDLPKDITAGILRKPIPMNSTLPSLPSAATMAARE
FT                   LSMQQLQGTINRVARLVNVSKKPILYVGQGLLARPEGPQILKELADKACIPVTTTLQGL
FT                   GGFDETDPKALHMLGMHGSAYANMAMQEADLIIAIGARFDDRVTGNISKFAPQAKLAAS
FT                   ENRGGIVHFEIMPKNINKVVQANEAVEGDCAENIRLLLPHVEPVAERKEWFEQINDWKA
FT                   RFPFSLYEKQTAEGPIKPQAVIEKLSDLTAHMKDRTVITTGVGQHQMWAAQHFRWRHPR
FT                   TMITSGGLGTMGYGLPAAIGAKVARPDALVVDIDGDASFNMTLTELTTAAQFNIGVKVL
FT                   LLNNEEQGMVTQWQNLFYEDRYSHTHQKNPDFVPMAQSMGVAADRCTKPSEVEAKLKWL
FT                   IEQDGPALLEVFTDRKVPVLPMVPAGCALHEFLVYDEAKEKERKALMKKRKVPGF"
FT   CDS_pept        960181..961626
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901896"
FT                   /orf_name="An16g04180"
FT                   /product="Similarity to hypothetical protein AAF45871.1 -
FT                   Drosophila melanogaster"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK46835.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG328519"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0000EFCE88"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7N7"
FT                   /transl_table=1
FT                   /translation="MASLPGYSASSRPQSSDNNTTSTTQQNSVSTNITSSASSTESFET
FT                   SDTVLLNGTSDTATAGGSPTSPTLADASGEEPRRCWICYTDETEDSPLNSQWRSPCPCA
FT                   LTAHEACLLDWLADLENPRSRRRNGHDAKMLCPQCKTEIIVSRPRSYIVDVVRLVERLA
FT                   GRMVLPGMVFTLGATVWAGCCAHGVYSMYFVFGTDEARQILEETADGAWNSGLNLGLPL
FT                   IPLVLIFSRTRYADGLLPAIPVMFFATHQPGQELELDLWPPSAAVTFAALPYLKSFYGS
FT                   IYERMFGKLERRWIAEVQPRQSDVNEFDDNAPPEHPEPDPPNDDNGVLMEIDLELRMGN
FT                   EDGPQGLFGFNGGNAQGGQGQNQGGNGQPLGLGRRDELVADTSSLADIILGALAFPAIS
FT                   ASMGGLLKYLLPTSWTTPSTLGKVRPGLLQTRWGRSVVGGCAFVLLKDALVLYCRWKLA
FT                   QTHRRRKVLNYDRSKKRVGKAGS"
FT   CDS_pept        join(complement(962391..962707),complement(961976..962315))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901897"
FT                   /orf_name="An16g04190"
FT                   /protein_id="CAK46836.1"
FT                   /db_xref="UniParc:UPI0000EFCE89"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7N8"
FT                   /transl_table=1
FT                   /translation="MIPPLPTRPLRLQPRILNRNQIPKHTRLDHTLPEQLSTVSSTRAQ
FT                   FLTRSLHRLPLSLQLQLVLPSLLPLVQVPGAVDRPVAEEASAGESKGTGSEWVVEEVAD
FT                   QCDSAVAAESGLFSLLERDGCAELGLRLELGLAEGVGDGVAGEGWAGHWDAEDRCQGGE
FT                   DRGEGAHFGGVSSLSLSFFCLWGIGAELRFGGGGGGVSENVRKTDTARRSGSLIS"
FT   CDS_pept        join(complement(964423..964457),complement(964138..964216),
FT                   complement(963806..963997),complement(963467..963754))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15901898"
FT                   /orf_name="An16g04200"
FT                   /product="Function: Rho2 GTPase regulates the synthesis of
FT                   alpha-D-glucan"
FT                   /EC_number="1.1.1.15"
FT                   /function="D-iditol 2-dehydrogenase activity"
FT                   /function="GTP binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK46837.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0047824"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI0000EFCE8A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7N9"
FT                   /transl_table=1
FT                   /translation="MAQQQTDNVMRRKLVIIGDGACGKTSLLSVFTLGYFPTVPTVFEN
FT                   YVTDCRVDGRSVQLALWDTAGQEDYERLRPLAYSKAHVILIGFSVDTPDSLENVKHKWI
FT                   EEANERCPGVPIILVGLKKDLREDPLAVEEMRKKSLKFVTPKEGSDISTQIGARKYLEC
FT                   SSLTGEGVDDVFEAATRAALLTFDKRKSSCCIVL"
FT   CDS_pept        complement(966339..967595)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217390" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966406"
FT                   /orf_name="An16g04210"
FT                   /product="Catalytic activity: Salicylate + NADH + O(2) [ "
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46838.1"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG328521"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000EFCE8B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P0"
FT                   /transl_table=1
FT                   /translation="MSNQAIIIGAGPAGLAAALQLHRNNNIAITVYELRPEPTTLGGAI
FT                   GLFPNGMRLVHRLGLHEEVVARGFSVTDMEIHSLPNGDIAKVDISGWANRQTGFEYLRI
FT                   RRKDLQGVLLDAVAKDQIPVHYNKRIISVTESTTDVTVTFSDGSTDTADILLGCDGLHS
FT                   SVRRLHVDPSIVPEYSGIAGTQSIIDCTGLPEELSTHANAFLTRTGILAMMPCSPSGDE
FT                   LFWFFSRETPIPHSESGNARDGWEERRQKEVAEYKDTILNIIGEGKGKWPEALTGMVNR
FT                   TDAVGFYPIFRLPLGGKWYTSRTVLLGDAAHAMQPHAGQGVSMALEDVFLLSRLLKDDQ
FT                   RSLEDAFAKYEEIRKPRITEIYNLAAKNGKMRKDVSPWGLRMKEYMAWAAYGLYNRLGL
FT                   ESWGIGQKHLVYDIDEAKI"
FT   mat_peptide     complement(966342..967541)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P0 "
FT   sig_peptide     complement(967542..967595)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P0 "
FT   CDS_pept        join(complement(969333..969928),complement(969137..969263))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217388" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902857"
FT                   /orf_name="An16g04220"
FT                   /product="Catalytic activity:"
FT                   /EC_number="3.8.1.2"
FT                   /function="(S)-2-haloacid dehalogenase activity "
FT                   /protein_id="CAK46839.1"
FT                   /db_xref="GO:0018784"
FT                   /db_xref="HOGENOM:HBG328056"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000EFCE8C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P1"
FT                   /transl_table=1
FT                   /translation="MTGSKNVVFDIVGTLVSYDVLFDAIDTQLGDRLRAEGIKPSLLGY
FT                   TWIEVAEREYTYLSLSGQYKTFATCLELLFWRMLKMAGIQDPRSFATKSDLEFIMSRYA
FT                   KLGLRPGAAECVTKLRDAGFTVWALTAGDAARVGGYFANAGLEWPAENLKSCDSQGIGK
FT                   PDLRVYQPLFEQLSQHGQPWFAAGHMWDVSAARRAGYKGAYCTIWEKEPIVELFGEMEV
FT                   MAETLPAMADKIISAENN"
FT   CDS_pept        join(970395..970570,970624..970655,970711..970750,
FT                   970808..970946,971001..971819,971875..972153,9
FT                   72206..972367)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660434"
FT                   /orf_name="An16g04230"
FT                   /product="Function: Gap1 is the transporter for L-amino
FT                   acids"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK46840.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EFCE8D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P2"
FT                   /transl_table=1
FT                   /translation="MTEKVNIKDTVVDANDPEKDVAKGDCELLGANEDVGYHRSLGSRQ
FT                   IMMMTFGAGVGTGLWVGTGTALKYAGPGGIAVAYTITAFVVYLQYTSIGEMTTFKPVHG
FT                   GFIRQCIEYVEPAFGFAVGINFWFSWVICIPAEITAAVSVLEFWPATEVVPLAAYITIF
FT                   LVVIAAANCFGVRIYGHVEYIMSFVKVLAIFVMIFFMFIMTSGGIPATHGPIEFRYWRN
FT                   PGAFNNGIKGISKAFVQALFSFGGGEHIAVIAGEAKDPRRTIKRTVYPVFWRMFSFFVV
FT                   NVWLVGMCVPYDDDNLINGSGTLGSPFVIAIERAGVMWLAHIINGFIFLTVISCGITSA
FT                   YIASRSLAALSDMAILHPFFGRKDTAGRPYVSLALSLTIGGALCYLNCNDTGATVYGWF
FT                   SSLVSVSALFQWSGIFISHIRFRQGLAAQGIDKKTLPFRDRTAPYAQFVGLVVVLFIAG
FT                   CEFYLACFPFGEKGSAKSWFSSYIAAPLFFFDYFGYKIYYRSKLVRPSEMDFSAAAAFD
FT                   EEDRARAAVGYEADTGTVSKIGQYIKNLIFG"
FT   CDS_pept        join(complement(974194..974293),complement(973983..974134))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117446"
FT                   /orf_name="An16g04240"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK46841.1"
FT                   /db_xref="UniParc:UPI0000EFCE8E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P3"
FT                   /transl_table=1
FT                   /translation="MWRLDGHEMLRSCLDYLVSGMIETLGNADQPGSDQFRPGVSYTEV
FT                   GTYRRPAQMEFAIDVLTGRLTMVEGWRPAIAGTSLLEP"
FT   CDS_pept        join(975008..975328,975380..975796,975846..976853)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235047" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966407"
FT                   /orf_name="An16g04250"
FT                   /product="Similarities to CoA ligase-like proteins "
FT                   /function="ligase activity"
FT                   /protein_id="CAK46842.1"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000EFCE8F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P4"
FT                   /transl_table=1
FT                   /translation="MVACNGTESWVRGGEKFRGHRLLPDILDYYAHDEPDRVFAAIPKT
FT                   KSVTDGFKDISVKKMATAVDHMAWWLERAFDGVSRKTTLAYIGPPDLRYPILLLALMKC
FT                   GWNAMFVSPQNTPIQNLGLLQEANVYGLLYADVMCSAAESLQQFDPFMQSLQVPTLAEL
FT                   FKSKSSPFHWNASFEEFQNKRCLILHTSGTTGQPKLVQYTHGTLACADNDTFMSVPEGR
FT                   RAQNADQFNFSPPGRYYSPFPPHHLAGLHAFTLLPLISRTAAFVMGPLTVPPSGALLSA
FT                   IMKQQPQIRAIYVPPFLVEQWVLEPGAYDQARRLDFILCGGAALAPSVGNKLSEVTNIR
FT                   QMYGSIETCHIQALNPQPGEWQYIEFNNCPEIEMQAVGDDVYELVLHPTKSSRPYLSLA
FT                   HNYPKVHTWRTKDLFKPHPTKAGLWLFHSRTEDIIVLENKLKVWPIPMETILRGDPHVT
FT                   GALIVGNGRPDPVLLVEARQSSYQEMSRDELLDAIWPSVVEANSVASEHAQIQRSRIVL
FT                   CPPKLGFFRTPKGTVMRKPTESLYAELISAAFTEEDDDSSGDEYDFSGDRTELGMREAE
FT                   LLTAT"
FT   CDS_pept        join(979255..982276,982331..982444,982501..982970)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048398" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902858"
FT                   /gene_name="nst1"
FT                   /orf_name="An16g04260"
FT                   /product="Stress response protein nst1 "
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK46843.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG328524"
FT                   /db_xref="InterPro:IPR018799"
FT                   /db_xref="UniParc:UPI0000EFCE90"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R7P5"
FT                   /transl_table=1
FT                   /translation="MSDPASTSIPAHATNGEAHAPNDHHHAQLPLSDSKPVSVNRKKQK
FT                   RRQKQAARLAAERQFGNGHISADMSEQNGLSPTAPASHVSDDHDLDERANGETYYEEIH
FT                   DATHDLDDHPPNLSNGQPGQQNATARKSKKKKGKKNRAGSQTMGDESSTPLSTPSVSMS
FT                   QHLPPPLPSHLPHTLLKTSKDRSIWNTSTQEERENIKTFWLELGEEERRQLVKVEKDAV
FT                   LKKMKEQQKHSCSCTVCGRKRTAIEEELEVLYDAYYEELEQYANNNQGSFEKGPPMVPP
FT                   PRLYHPPLRSPGQHTRTQGQFHPSRGRIHELPEDDEDLEEDYDEDDEDDEPYSDDEYED
FT                   EETRAARADFFAFGNSLTVKGRRQIMLLSFIFPKPVTNLIFTLADGILTVADDLLKNDG
FT                   KHFIDMMEQLAERRMQREEDTQYGIAAAHQSLHGGHNHGPLDDDDYDEEEDEDYDSQED
FT                   EDYEEDEMVSSGNWPGGDAVQADSFLQDAMTEEQRMEEGRRMFQIFAARMFEQRVLTAY
FT                   REKVAEQRQQKLIEELMEEQTRNEQRNAKKAREAQKRKDKKKLQKQAKEEEKARREAEK
FT                   AAEEAAAKAEQEKKLEEQRRKREEQKKKREAERKAQEAERLRKEAEKQKRLREERERQA
FT                   EIERKQREQKELEKKRREEARQNELREKKTKDERERKLREAAPKTDYEGQEKRDPQAKR
FT                   VSHTGPVPIPASLQHAQALPAYLQSPHYQIATPIVPKAPTPARPRQPSQQGSHTSSPRS
FT                   QPASTEPSQVSISPRSMAPSQSSGASSVTSKQGHGQPPLLHHPQPSTPLSPLGALNRSH
FT                   PPGFSPSNPPGLGLVARPPIGHELPSYPPHSGPLMNQLRGFPAPNGLPVLPGMNGTRPM
FT                   PPGRGFPLDPGHGLAFHQQPIANAFAAQPSGLSHAHSRQPSSSFERSPLDAHAFPISRP
FT                   SPIKRPSSTQQDQNNRSAQRDVDDLSAHLGSSALLDDSDVPFTSNLSQSLPGATAPGTL
FT                   PGPTRASFAGTSLFADPLAAKHSGFPIGPSVGNTWSTQIPFGTSPFPSAPTWGTGPGSG
FT                   WSNNAFAPGGHHRAHTSRPVTIRLLVIQACKQLNMMSPSKGASGYHDVKVVLRQVDQLR
FT                   PVNEPPISLKEMLDICDTEGNSQNGGGSFSIRSDETGECVKFEPDTNSASSGHRGSIVP
FT                   GEIGSPVPSSSLPAFGGIGSSTPSVLRQFSSPTGF"
FT   CDS_pept        join(complement(986954..987090),complement(986237..986874),
FT                   complement(985225..986183),complement(984617..985165),
FT                   complement(984244..984561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196946" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902859"
FT                   /orf_name="An16g04270"
FT                   /product="Function: the protein Vps35 is involved in
FT                   vacuolar sorting"
FT                   /protein_id="CAK46844.1"
FT                   /db_xref="HOGENOM:HBG317989"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="UniParc:UPI0000EFCE91"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P6"
FT                   /transl_table=1
FT                   /translation="MATPVAAPEDQSRLLEEALGVVRQQSQMMRKCLETPGKLMDALKC
FT                   GSTLVSELRTPSLGPKQYYELYMAVFDALRHLSVYLKENHPVNHLADLYELVQYAGNII
FT                   PRLYLMITVGTVYMSVEDAPVKEIMKDMMEMSRGVQHPIRGLFLRYYLSGQARDHLPTG
FT                   SGDGPEGNLQDSISFVLTNFVEMNKLWVRLQHQGPSREREKRMQERRELELLVGSNVVR
FT                   LSQLVDLEGYKSGILQALLEQVVQCRDVLAQEYLLEVITKVFPDEFHLHTLDLLLSAIS
FT                   RLNPHVDLKKIVIGLMDRLSAYAARETESSAEPDARIKKEEEAVTKLLGNLKVSEETKK
FT                   QAPEEATQENGVEEAATDNAEQGEAATEGESTANGDDKAGIPADVKLYDIFYEQVVNLI
FT                   KSRGLPIQDTMALLVSLVNLALNTYPDRLEFVDQILDFATRETATYADHADLHSAPTQQ
FT                   NLLHLLTAPLRSYASIFTALALPHYIPLLTSQSYTTRRAVAGEIARSLLKNRTFITTTE
FT                   NLDRVLQALRVLIKEGTQQSMGYPGIQSQRRGETDETIEEQGWLARLVHLIQAKDNDTQ
FT                   LKLLQATRKAYLDGNERIRYTTPALVTSSIRLARKLKAREHYDDNWQSQSSALYRFMHQ
FT                   CVNNLYQRVNPGCADLSLRLFVMCGEVADQTGFEEFSYEFFAQAFTIYEDSISDSRAQF
FT                   QAVCIIAGALHGTRGFSKENYDTLITKAALHGSKLLKKPDQCRAVYLASHLWWVVENPQ
FT                   RGEEDPKNLYRDGKRVLECLQRALRVADACMDTAVSVELFVEILNRYVYYFDQQNETVT
FT                   IKYLNGLIELIHSNLQTDENEPNPSLEGPKRHFQRTLEYIRSRDFEGVVTDPRQ"
FT   CDS_pept        complement(987897..988943)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902860"
FT                   /orf_name="An16g04280"
FT                   /protein_id="CAK46845.1"
FT                   /db_xref="UniParc:UPI0000EFCE92"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P7"
FT                   /transl_table=1
FT                   /translation="MHTAALFLALALSAHAVPVLHARGNDTVERREEGPYKVVNVAGPT
FT                   TPVVETITATNPPAPPTTITVTEYPSSTPASVPGASPSPWNAGPTVDGAPLNRRETNSS
FT                   ASAFHRRVFTDDATNSTASRRAMFSDDATTNNTVSRRGILEDATNSTLSRRARLEDDAT
FT                   TNKTESRRDILDHATNSTLSRRKMFSDDATNSTENHAIATRSNDTIPAQSQPKVDVIAR
FT                   GLLSEARNETEHSLQARSNITSEVVARSNDTIAKAMARRSLYEGLESDNSTARVAARSN
FT                   DTVSKLVTREIGDAESALNSSKVLDHKVRGLNATALQARAFNDTPSDTAVMSSRLHARG
FT                   LNHTDSQA"
FT   mat_peptide     complement(987900..988895)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P7 "
FT   sig_peptide     complement(988896..988943)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P7 "
FT   CDS_pept        join(complement(990174..990280),complement(989997..990074),
FT                   complement(989884..989916),complement(989722..989778),
FT                   complement(989358..989481))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902861"
FT                   /orf_name="An16g04290"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK46846.1"
FT                   /db_xref="UniParc:UPI0000EFCE93"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P8"
FT                   /transl_table=1
FT                   /translation="MQATSKPELASRSKRTRGRRSRGPCLSWAVMRCDVIYDELFAFGG
FT                   LSVADGMMRFPPNGSTRGAHTADLLMLRTMRQSEMNLGRAVRGSARKVFAAGKRRSTGS
FT                   SALLPTRNQRGWQRQDSIHPSQPPLTVS"
FT   CDS_pept        join(991188..991294,991334..991493)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813237"
FT                   /orf_name="An16g04300"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK46847.1"
FT                   /db_xref="UniParc:UPI0000EFCE94"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P9"
FT                   /transl_table=1
FT                   /translation="MSGYPYPKLTLCLYFLNFSSSNSHRGVRCEDCRPALHRHSDDVYH
FT                   LGDSEDLTLDDHNTHALFSNEKIRFKNHALMMVDETSSPAITH"
FT   sig_peptide     991188..991250
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P9 "
FT   mat_peptide     join(991251..991294,991334..991490)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7P9 "
FT   CDS_pept        complement(992122..994440)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196959" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902862"
FT                   /orf_name="An16g04310"
FT                   /protein_id="CAK46848.1"
FT                   /db_xref="HOGENOM:HBG328528"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000EFCE95"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7Q0"
FT                   /transl_table=1
FT                   /translation="MPRPRRSNRASSARTKYIHDPFEAAGFSDEGEGPATSETPQRRKG
FT                   KGKAKQAVADEGSSDEDFAMDDANGDDDDDDDEYNDNDVEMVLENEDEDAEEDDDASAS
FT                   DVDTGSRRQRKKPAAAATPKPSSSVKRRRPDGSLAVPGEETHSRGSWNPLEHVGKAVHL
FT                   RVTFGTDERDILSIISARDRWYKGVDSTFPTRESLNESHDMPDYGYGNSFGLEAEDMKR
FT                   ESSRAWDWYYSKDVGAHFRKRQRIQKIKENEARSVYFPSSRGPHTVLAGPVDEQKVFSL
FT                   AQHDVLDFGEAWEDDASTSQKQGKQAGKQAKTKQPERKRRKREGWLLNLGNKVQCLAWV
FT                   PNQTGLTQYLSVVAPILPDQKEQYPDPYKDQAAPAFRPSAPYPSALQLWELKAEEAASL
FT                   TKTIDMTSKPRLRLALCTDWGDLRRMAWCPMPRGPRNEDDKDAQKSVGLLAGVWGDGRV
FT                   RVIDVKLSRDPNQTEYCTSKYQNKAKSHTNSSDKLQSPVFEAKPHSTVCTSVTWLSPSD
FT                   IAVGCANGFVAIWSIVSSPSSPSNPIPYFYQQLHSTWILNLASAYPTHPYLISTTSMDG
FT                   ESRLTSIIDPQKDSVNANRMRVGTAHLTYSPLLHSFVSGDENDFLRLLAIRRFFTSTAV
FT                   ARLPSMISALGPCSFWHPSLLVGCTGGTVQATNPLRRMMHAKEKQWQQTWFQHEWVRGS
FT                   GTGTGTSRFHDGYRAEHTSLLRNLVGDPRLINGTAVITVFDEGTHVTALSWNPNRVCAG
FT                   WAAAGMGCGLVRVEDLALS"
FT   CDS_pept        join(995135..995164,995221..996174)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902863"
FT                   /orf_name="An16g04320"
FT                   /protein_id="CAK46849.1"
FT                   /db_xref="HOGENOM:HBG620655"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="UniParc:UPI0000EFCE96"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7Q1"
FT                   /transl_table=1
FT                   /translation="MSHPGILHHYTPRLVAFEFTPPNSTPTTNALLFIGGLTDGLLTVP
FT                   YVPTLASALSSTPNNTWSVFNVLLTTSYQGWGVNSLDRDIEDLAQCINYIRKLKGPESK
FT                   IVIMGHSTGSQDVLHYLSAPNPIPQNPSVNGLQYLTRPPVDGAIMQAPVSDREGMHITI
FT                   TTAEARGAYEQLVGLAKAAVAEDPRAILPLNLTSLVGLDAETPVNAWRFLSLASPDSPG
FT                   SPSQDDLFSADLGDERLRETFGVVGKRGLLRGKLMALYSGADEYRMPGLDVEGLMKRWQ
FT                   RATDEGAGEVKWDAEGSAVVEGASHNVQDVGQEELVERVRGYLAGI"
FT   CDS_pept        join(complement(997042..997145),complement(996336..996969))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117447"
FT                   /orf_name="An16g04330"
FT                   /EC_number="2.4.1.83"
FT                   /function="dolichyl-phosphate beta-D-mannosyltransferase
FT                   activity"
FT                   /protein_id="CAK46850.1"
FT                   /db_xref="GO:0004582"
FT                   /db_xref="HOGENOM:HBG752660"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI0000EFCEBF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7Q2"
FT                   /transl_table=1
FT                   /translation="MGAAENKYSVILPTYNERKNLPIIVWLLERTFRENNLNWEIIIVD
FT                   DGSPDGTLDIARQLQKHYGSNHILLHPRAGKLGLGTAYIHGLQFTTGNYVIIMDADFSH
FT                   HPKFIPEMIRIQKLGDADIVTGTRYASRDGIKGGVYGWDLFRKFTSRTANLIADVMLMP
FT                   GVSDLTGSFRLYKKSVLEKVIHSTQSKGYSFQMEMMVRAKAMGFRVAECPITFVDRLYG
FT                   ESKLGGHEIVEYLKGVVNLWLKV"
FT   CDS_pept        join(complement(997834..998032),complement(997525..997799))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902864"
FT                   /orf_name="An16g04340"
FT                   /protein_id="CAK46851.1"
FT                   /db_xref="HOGENOM:HBG328530"
FT                   /db_xref="UniParc:UPI0000EFCEC0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7Q3"
FT                   /transl_table=1
FT                   /translation="MSVFLRSRLSLRATPSIAARQLAPLRSAYPLGQRFYAHSSYGGDG
FT                   ETEAQQPDNPRNQPTRDIEHPGYSSQTPINVQSILGPPPPDTGSSSTAKSSSGSSSSSS
FT                   KQPSNKAHPTLADGDESPYVDKDGHTTADAPEDVRRHNEEIEKRADRPTERAG"
FT   CDS_pept        complement(998926..1001058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902865"
FT                   /orf_name="An16g04350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46852.1"
FT                   /db_xref="HOGENOM:HBG328531"
FT                   /db_xref="UniParc:UPI0000EFCEC1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7Q4"
FT                   /transl_table=1
FT                   /translation="MSGRLSSDHNRSFSQSSRPPSQQIDSMHHRSMSARSSNPNVFSDE
FT                   YSLEPIDSEQATLTPRSPSISSSVSSNTLRGSVPQQQQPKAYNTIPPTDAELAEDPFGD
FT                   EARVSFDETPHRSSLPPKGVDLANRNSVASTAPSITSRSQSASSRFSMPVRALSPYTGA
FT                   TGPSHPYAMYPQVGVSRSPSVATTSTLRPVDRPLEDTTAPQHPYAMYPQNVVPEDDGID
FT                   NSMVPLGFPGHNAQVYQRPPNRADDDLGDLIGPDGHTEQLPPYSRYPENAVPKVEGTFA
FT                   TVNDAGIIQDETLHNERAGPPMSEVSSNTLVMENTTSGGGIGNGNGNGNRGLEEPPVTG
FT                   VMAFEEKLKSKGKKKACCGLPVWTLVLVGVVMLIGGCIGGIIGGVLGARKAAEQDHGDK
FT                   PSRPHIVTVTETPRMDATPVTATPTNLLTLPTGQYAIPASPKNQSKFCVADSDYRVSWG
FT                   CLNSGKIPIVVGGTDEQRNITFEDSYDSAYSSSLTYGAQQPVFSNPTQNLSMMMDSNDL
FT                   SFGPALTFMTFYDKLVIVPQDSFPSSSSSKRDYVTEDEVVSSMLSRKATAQAGDKPWFC
FT                   WWNSTVMEFFLYINETTKEYQYSSTAVVTTTSTQIAQATQGSSNSHSKRDSIADYPRRI
FT                   KMEEKRDNPSAANPYCQQMQVLDDGQVGPISQETVQIKVVQPTPTTTVEAASGTSQTYT
FT                   AKAEYESVCYCISLTD"
FT   CDS_pept        join(complement(1003108..1003172),
FT                   complement(1002785..1002961),complement(1002549..1002636),
FT                   complement(1002113..1002343),complement(1001857..1001928))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813238"
FT                   /orf_name="An16g04360"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK46853.1"
FT                   /db_xref="UniParc:UPI0000EFCEC2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7Q5"
FT                   /transl_table=1
FT                   /translation="MVPDRQVPTGCHGSPTIQTTPWPETAKRASVHSYDIIARAHDNRP
FT                   RRSFEDACILTQARDCARLSEFGQIEFSEPCTTSTSETVRLLEVVRTRGGSFPIEAKKL
FT                   WVSMCTRSHAAKERDESGAHRLELREEATGISAAAGASDDDGGEERSGGVSGPKLLHSQ
FT                   GGRGGRERGEWEWVRYLSGHASTPASTAEQKEGGRLPRICHYDSATR"
FT   CDS_pept        join(complement(1004238..1004711),
FT                   complement(1003458..1004204))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902866"
FT                   /orf_name="An16g04370"
FT                   /product="Similarity to F-box protein FBP-13 from patent
FT                   WO200012679-A1 - Homo sapiens"
FT                   /protein_id="CAK46854.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0000EFCEC3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7Q6"
FT                   /transl_table=1
FT                   /translation="MGNCVSWGKWALCVRNNETSARSWSPTGFDVRSLLSQSLSEQPST
FT                   EPSSSEQPTTEQAVTEEPRNAPQNLDTLPAEIFDMIASYLDQNELYSLYLVSQRVGRLA
FT                   YSSILASLHAKKHTGLTPREIENIHTLAIDPTINHLPRSLHVTVPYIGHSAARKALHEL
FT                   PEMKALRQDLNRLVNCKEFHFTLTRAGSTLENKVVYIEDALYAVLAENTIPVEKLILDS
FT                   RVVKSRTNEKSIMHPNLARVWRRLKSLKITESPSLDFSRGTALSHILQHAPELRSLSLH
FT                   SLADTPARRSKIFKLASSANIRTNRLEKLRLSYLTVEPEDLIMWLTRFNNTLRILDLHS
FT                   IGLAHGSWVNVVQHILDSCPNLQKVVVDYPWVSEWNRRAWDSFECSGLDMRIKLEQFKQ
FT                   SATAAKI"
FT   CDS_pept        join(1005206..1005263,1005456..1005606,1005696..1005927,
FT                   1005985..1006229,1006324..1006407,1006476..1006626,
FT                   1006702..1006806)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902867"
FT                   /orf_name="An16g04380"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK46855.1"
FT                   /db_xref="UniParc:UPI0000EFCEC4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7Q7"
FT                   /transl_table=1
FT                   /translation="MVPRTGLQRNSGSESGVLASTLDVLWGDYTFTADTTDGVRRVCLK
FT                   PGQTFHLVHVPNPSIWIVNYLPPVRNRPGPSGTGETRNRPSGTSGIIRHHTRVFIGACR
FT                   FSSWGTQIRCAVTHLLVDGQYWLPENGVTGILPPALLHPRDFGQIGGRITYFKRTSGHA
FT                   LVLVHTSGIFYSFGDAFISPSLDPTHGLFLWSCGMIIILALHVLAPVKRSEYEKFRKTQ
FT                   QQWAYMMQECAVTVSSGGGSRIMVFILTTCHNHRCGALSVPLCYASGARGGCKPLGAKQ
FT                   HGRINDDWFGTQAYLLYSMDRATGAEVDIPAAVPLYYPTMCTWLGVTQLRAGGNPLYDC
FT                   L"
FT   CDS_pept        1007871..1010300
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902868"
FT                   /orf_name="An16g04390"
FT                   /protein_id="CAK46856.1"
FT                   /db_xref="HOGENOM:HBG328535"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="UniParc:UPI0000EFCEC5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7Q8"
FT                   /transl_table=1
FT                   /translation="MSDESKSKGFPDISAKLSAIPKKSLFERQKAEAEAKRAREQAETA
FT                   AVYEDFVKSFEDDSPAHDRHSSDGRLSRFPPKNPGFGGPGKRHFTSSGPRLSGPGTLGP
FT                   PPPRKRTHEGFQPIHRNRDTASGVLGFDNTAPAAASAFRASDDEDEGAGDAKEAERAAA
FT                   KPTLYLASLPPGTSPSVLKSLIPSVLTVDNVKILRPPGQPINDRKSVAAIVTLANESAA
FT                   SDIDSTVSALQNRYLGWGYYLTISRHLSSAAIGSTMPVTVGLSSASSLPFGAKSIAPDI
FT                   PGRLNRAPPPGLHRGGFAPPSSYGSAYGRSGPSTQVEVKAPSDLKQLKLIHKTLENLLS
FT                   YGPEFEALLMSRPEVQRDEKWAWIWNARSAGGVYYRWKLWEILTNTRPPAHRRGGTQPS
FT                   CTIFEGGANWAPPEAHIKFEYTTRMDEFVTDDDYDSSDEEMSDYEDEKRNLGGAPPAEG
FT                   PGAANEGLGYMNPLQKAKLTHLLARLPTTHAKLRKGDVARVTAFAIEHAGAGADEVVEM
FT                   IVSNIMNPFAYTGANPDREAETGIARREQADLAKDNPAEEGRPSTKENLDTSAAKLVGL
FT                   YLVSDILSSSATSGVRHAWRYRQLFESALKTHQVFEHLGRLEKDFRWGRLRAEKWKRSV
FT                   GTLLHLWEGWCVFPQSSQEHFFQIFEKPPLTEEELREEREKAEAERAASAFSKNKSRWK
FT                   TVDEDATSGKFDPGRAPETHPHPMDVDKPSAAPAGAESFDGESMSDIDGEPMEDSDLEE
FT                   ADGEPMEEDSAPEEDPRESEEQIQKPADPPAQPEYQPPARKPRPKAEDMFADSDDE"
FT   CDS_pept        join(1010694..1010700,1010870..1010887,1011055..1011119,
FT                   1011192..1011263,1011334..1011432,1011547..1011654)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966408"
FT                   /orf_name="An16g04400"
FT                   /product="Complex: S. cerevisiae Ntf2 interacts with the
FT                   small GTPase Ran/Gsp1p"
FT                   /biological_process="transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK46857.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG319937"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI0000EFCEC6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7Q9"
FT                   /transl_table=1
FT                   /translation="MADFQSIAQQFVQFYYQTFDADRQQLAGLYRDNSMLTFETASQMG
FT                   VAPIMEKLTSLPFQKVQHQISTLDAQPSVNGSIIVMVTGALIVDEEPRPMNYTQTFTLN
FT                   PEAGSYYVFNDIFRLIMG"
FT   CDS_pept        join(complement(1013118..1013185),
FT                   complement(1012800..1013057),complement(1012067..1012734),
FT                   complement(1011971..1012015),complement(1011883..1011937))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197025" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902869"
FT                   /orf_name="An16g04410"
FT                   /product="Putative frameshift"
FT                   /protein_id="CAK46858.1"
FT                   /db_xref="HOGENOM:HBG328536"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI0000EFCEC7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R0"
FT                   /transl_table=1
FT                   /translation="MDLSNPRCEHLASPDIKNFILSILIVFGILLSYTPQHVRILTMKT
FT                   SFGISPYFVLLGTTSGSSALANVISQQQSLHDMACCKQVNGMGCFAGILGILQVGTQCL
FT                   CFFIILFLFVLFFPRNTAHLPKSSPTYRTAVTVAVICILHAAFMLITTLAVGYTRPSSL
FT                   QAWSNFCGILSALLASIQYFPQIYTTLRLRCVGSLSIPMMCIQTPGSLVWAGSLAARLG
FT                   PKGWSTWGVLIVTACLQGTLLCLGVFFEFLGPNRGHSHEGHDKDTEVVRGGAGEEEVVA
FT                   EDDQLAVGGDAFVEGSVRSSLYGWILAFGKSGMWSSGLEMQKRKTVLLVPLYFLAAMYQ
FT                   SLLAQLLEHGTVCHLYPTVKRNR"
FT   CDS_pept        join(1014161..1014245,1014315..1014365,1014423..1014570,
FT                   1014628..1015419,1015472..1015979)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197036" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902870"
FT                   /orf_name="An16g04420"
FT                   /protein_id="CAK46859.1"
FT                   /db_xref="HOGENOM:HBG328537"
FT                   /db_xref="InterPro:IPR018803"
FT                   /db_xref="UniParc:UPI0000EFCEC8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R1"
FT                   /transl_table=1
FT                   /translation="MKLHLASYLVFALATFEAVGASSWFSKAVYNKWHETELERWLSDH
FT                   DIPYPSPADRKDLESLVKSNWEAKVQKPLAHVTQHSHDHWHDAKEWLFDTWSDSQLKAF
FT                   LDRHGVPAPQPRKRDTLLKTARENYESIATKLGEAVAYPGNWVYEQWTESDLKEWLDER
FT                   GWPVPQPTTRDRLIASVRRNARLASLNAKSIAASASASAEAAQATLSDALFKAWSDSDL
FT                   KKFLDEHGVKVPQGSRRNELVALARKHRASLVSQASEASATISSTATQIIGAATSKAGN
FT                   EYGKATDVAESKAQDTFDTVIQGWSDSRLKAFLDARGVPVPQSNKRDELLAKVRLHSHK
FT                   AATGWSAWTFDTWDTEHLKKYLSSMNAKAAHRADITRDELVKQAQENYAKASKAGGANF
FT                   ASATSYMAQATDAAKGSAFDTWTHSDLKAYLDSYGIPVYQGSGINELRAAARRNAEYFR
FT                   YGTSSPSGTIFAKMQEAGQWLLDQLKIGASSGRAQGQEAAEKAKAKGSEAAEKAKAQGS
FT                   HAASSMRVEL"
FT   sig_peptide     1014161..1014223
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R1 "
FT   mat_peptide     join(1014224..1014245,1014315..1014365,1014423..1014570,
FT                   1014628..1015419,1015472..1015976)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R1 "
FT   CDS_pept        join(complement(1017244..1017256),
FT                   complement(1017149..1017176),complement(1016823..1017060),
FT                   complement(1016506..1016736))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902871"
FT                   /orf_name="An16g04430"
FT                   /product="Function: bovine MSBP is a high affinity steroid
FT                   membrane receptor"
FT                   /function="heme binding"
FT                   /function="receptor activity"
FT                   /protein_id="CAK46860.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG715794"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI0000EFCEC9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R2"
FT                   /transl_table=1
FT                   /translation="MSTPDEAVPPPAEVMTIATPINLILLSLFVILVYLQLRPKAPVSL
FT                   PKGPPPVVFRTFTPTTLLPFNGENDAPVYLAVRGRVFDVTPGKNFYGPGGPYENFAGRD
FT                   ASRGLACQSFDEEMLTKDLKGPLDDLKDLDNEQLENLQSWEERFSEKYLVVGKLVAEGD
FT                   PEAENA"
FT   CDS_pept        join(1018503..1018669,1018735..1020301)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197047" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660435"
FT                   /orf_name="An16g04440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46861.1"
FT                   /db_xref="HOGENOM:HBG328539"
FT                   /db_xref="UniParc:UPI0000EFCECA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R3"
FT                   /transl_table=1
FT                   /translation="MWGKMSFHRSRKPVIGKPTLIDKTLDDSVYRSLSPAPGNQSSDTL
FT                   AHPKSRPAIARNPTDSLLPAQHPDTGRRVASTSHALDIATGDQPHQRSASLSHNYLLDP
FT                   ATFTHDLYRPESASISPPDSPISFGRPPASRDSSRVSPIEDDFRLDSSAGSMENKENAR
FT                   FASQLPVLRKRTNSQADRLQTPKSSRSQTSRWDDFSGELTPSDLSMSGQTTPGSVSFRT
FT                   EISAKPASSHSSNIFGWSKDHLNSKRKLSDPRTRVSKTENSLPPGVREPWKGPSGRAPI
FT                   IAPIQERPRAKSPSRVHMSRSNDRLREAHSTTPDYAACGFVPTVVTTITAGDSKPKASE
FT                   KVRHTTSRDNLRTRTPEEPAPISIVSSAEPPRVDFPAPDDWESSLADLKLTTDDAAEQP
FT                   ASRFSATTYEPTETASSVGSARGSIDAASQSTEHVPSIMSRKRPVPSAVAPAKKPSRKP
FT                   TPAQASEAEPPKDQLQLTPEEQIQNRIQTLEARRDTLTRRRTNIDTIIYELTQVIQPSS
FT                   VAYDMAARDEVKRTVASLESELAEIKREEHEIGLKLFRAWKKRDDLGFGGGSLWVKRVT
FT                   S"
FT   CDS_pept        join(complement(1021122..1021143),
FT                   complement(1020963..1021052),complement(1020801..1020895))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197071" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117448"
FT                   /orf_name="An16g04450"
FT                   /product="Similarity to protein SEQ ID NO:40331 from patent
FT                   EP1033405-A2 - Zea mays"
FT                   /EC_number="3.6.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK46862.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR015157"
FT                   /db_xref="UniParc:UPI0000EFCECB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R4"
FT                   /transl_table=1
FT                   /translation="MGGQSREGGKVKPLKSAKKEKKELDEDDLAYQAKKRAEEKAKKEL
FT                   MEKAKGKGPLNTGNQGIKKSGKK"
FT   CDS_pept        join(1021733..1022454,1022503..1022723,1022809..1022919,
FT                   1022951..1024284)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197082" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813239"
FT                   /orf_name="An16g04460"
FT                   /product="Complex: hPRP4 interacted directly with Clk1 on
FT                   its C-terminus."
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK46863.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG328541"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000EFCECC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R5"
FT                   /transl_table=1
FT                   /translation="MASRRSRSPSTPSEGEIIESGSETKATTSKLPLNGSIVDRPTRAS
FT                   PAPATRSRSPRHRRSRTRTRSTSRTRSRSPYRDYRGYKRRRDDDYDDYDHVDDRRYRHE
FT                   PPRRVGSRYDDSRYYGRGQPDRRARPSYYDYDREEHYGDGLRYSDESDRRREKRARTRS
FT                   RSPYREVRKPKQYSGDEWESPGDGSTASRNRRRGASIEQSVSERGNTPVVAQGIKQDAE
FT                   TQKPQVQQASATLHAHVDSVNGTSDTHEEQPPAEPVDEAAQLEARRKRREAIRAKYRGQ
FT                   ATPMRLQALHIGESSRDSSTPGADTAASGSAISESAPLSAPETPADSPGELFSDFKVGK
FT                   DADLMNGAPVNDYDPTLDMKAEREKHDSRGANEELSAASYDETQTSRQDILLPDAVPPP
FT                   PQPKAKDPYDMFAEDDDDDMFAEDTQETTQPTHASAKSAVPQPKELDISMMDNWDDPEG
FT                   YYNVRLGELINGRYHVQQNLGKGMFSSVVRATDSKTGGLVAIKIIRQNDTMRKAGMKEI
FT                   GILEQLHEADPEDKKHVIKFERYFDHKGHLCMVFENLSMNLREVLKKFGRDVGLNLRAI
FT                   RAYAQQIFLGLSLMRKCNILHADLKPDNLLVNEQRNILKVCDLGSASPATENEITPYLV
FT                   SRFYRAPEIILGIPYDHAIDVWSIGCTLFELYTGKILFTGRNNNQMLRSIMECRGKYPP
FT                   KLLRRGSLTPMHFDDMLNFLSMEEDKITGRPVTRVLDFKKPTRDLKTRLMGGKETRGMT
FT                   DSEAKELAQFVDLLDRCLNLNPEKRCTPTEALKHPFLSRPKA"
FT   CDS_pept        join(complement(1025901..1025953),
FT                   complement(1025783..1025830),complement(1025648..1025703),
FT                   complement(1025387..1025448))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660436"
FT                   /orf_name="An16g04470"
FT                   /product="Similarity"
FT                   /protein_id="CAK46864.1"
FT                   /db_xref="UniParc:UPI0000EFCECD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R6"
FT                   /transl_table=1
FT                   /translation="MAAVSSCNYRHESGYVSRYIRALLLGVPDPIAVLYAYLPCFLAHY
FT                   YSNYTVSIRKRYTSDPSIHPRYTRQPR"
FT   CDS_pept        join(1027816..1027961,1028040..1028151)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902872"
FT                   /orf_name="An16g04480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK46865.1"
FT                   /db_xref="UniParc:UPI0000EFCECE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R7"
FT                   /transl_table=1
FT                   /translation="MEMEIGRWRDGSCPVKEIIIITAMGVSLFFSSSRPASLESLELQT
FT                   RTVYHPSCQPHSYHTAAQAMATTGHPGADTIDQRTQWDTK"
FT   CDS_pept        join(complement(1030206..1030441),
FT                   complement(1029897..1029942))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902873"
FT                   /orf_name="An16g04490"
FT                   /product="Similarity"
FT                   /protein_id="CAK46866.1"
FT                   /db_xref="UniParc:UPI0000EFCECF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R8"
FT                   /transl_table=1
FT                   /translation="MQNKSPKLYHDEDEEEEKPEKEEKQQCKTKINDLTGTRRKEEKRS
FT                   NTPERKGRRPGTEKGRDREERRSIGNKTERGRARKPKQKIRKIITPNN"
FT   CDS_pept        join(1031217..1031805,1031880..1032517)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197083" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813240"
FT                   /orf_name="An16g04500"
FT                   /product="Complex: S. pombe Ran1 associates with cpc2 "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK46867.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG328545"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000EFCED0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7R9"
FT                   /transl_table=1
FT                   /translation="MPPTPPPSPPISRCYAPEDRLGFLLANRLELTSILGVGAYGVVYT
FT                   AVDIHTNVLYAVKALNKTGLDPRQLKFQQREIKLHHLASQHPNVVSLVRIMDSVDCTYV
FT                   VIEFCPEGDLFSSITEKGNFVGNDPLVKRVFLQILDAVQFCHSLGIYHRDLKPENILVT
FT                   DQGLTVKLADFGLATTDYLTSDFGCGSTFYMSPECQQPNPRPMSCYESAPNDVWSLGVI
FT                   LVNLTCGRNPWKRASIEDSTFRAYLKDPYFLKSILPLSDEMICILNRIFECDPSKRITI
FT                   PELRQLILECPRFTMNPIAPWSATGPVPVDFVNGPVPVSVTVDTFNTQTSSVSSGSSQY
FT                   SDFSESAVSDASSFTEGYPDLDSVSSMSSVGLEPGLECKDDFMDPVPCGGFPEPHLAHA
FT                   PFTILIPVC"
FT   CDS_pept        complement(1033246..1033761)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117449"
FT                   /orf_name="An16g04510"
FT                   /protein_id="CAK46868.1"
FT                   /db_xref="UniParc:UPI0000EFCED1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7S0"
FT                   /transl_table=1
FT                   /translation="MTGRGRPAHPPGGCLPVGQLAPLLRGRREVQTRLQCHKFFFSRSR
FT                   RRLTVASAALTGRARLLQHSREQTATRQWTTASRRGSYWKSVSSGPKSVYQQEGRERKK
FT                   HRLVLVYCRYRIQGCSTLVHAVAPKTHTHSSLFTTASQTEDQSDGFLPDSFQQEIQSEI
FT                   KTIYRQIM"
FT   CDS_pept        join(complement(1035090..1035252),
FT                   complement(1034794..1034990),complement(1034553..1034704),
FT                   complement(1034110..1034464),complement(1034009..1034026))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18117450"
FT                   /orf_name="An16g04520"
FT                   /EC_number="1.1.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK46869.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000EFCF02"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7S1"
FT                   /transl_table=1
FT                   /translation="MDRLSQITSHLNYPHGLLANQVAIITGAGQGIGAETARLFANEGA
FT                   KVIIADIDGEKATAVATSINATHNSTTPRALAVPGDILNDAYIEELVTKAADFGGGKIH
FT                   IVVNNAGFTWDGVIHKMTDTQFNTMLAIHATAPFKLIRAAAKYFRVKDGEPRVVINISS
FT                   TSGVHGNAGQANYAVAKAGITGLTKTIAKEWGPAFGVRANTIAFGFVNTRLTAAKEDGA
FT                   FIAMADGTKVALGIPGKQLDSRRTGGGASTEQKKKGPEYPDIPLGRPASPEEAARAVLG
FT                   VASPLFSYLGIDL"
FT   CDS_pept        join(complement(1036323..1036655),
FT                   complement(1035929..1036276),complement(1035512..1035838))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966409"
FT                   /orf_name="An16g04530"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK46870.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EFCF03"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7S2"
FT                   /transl_table=1
FT                   /translation="MLAETENPVSNGDPPKLRAACENCRQSKVKCNLSGKDTCIRCMRH
FT                   GLPCRYRVANRSGKPKGSKNRATLRKLGQLQDEKKPTIPANGWVESVAKGQPPRVSYDT
FT                   DNGVDATSTQSTSPASQSRSPDSHGANMTDTTLLTDPTMEYPSIGETLAPMFNPSMSPP
FT                   FLPKEFISRGFTGCPLAVHIPNPLQPCECTNALLYNVNQIRTMLADSMHLRLDQILQGI
FT                   KIALTLFEYWTSYELSSAPAGGHNMIVPYGDYEMGPDETRRIRRYLIRGRAMQCREVLG
FT                   LLKDAVEMSRHLSPELRELNGTDGLEVEWFQQMLGGYDTMVDTILRAMSDNLCT"
FT   gap             1037291..1037390
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(1038563..1038628),
FT                   complement(1038443..1038513),complement(<1037467..1038352))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902874"
FT                   /orf_name="An16g04540"
FT                   /product="Remark: ORF 3'truncated due to end of contig. "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK42884.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniParc:UPI0000EFCF04"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7S3"
FT                   /transl_table=1
FT                   /translation="MKLSKVDGLVNDLRGSRRGSAASQKGTAILRGIPNALLQVPHHHF
FT                   GRSSYLILTRILPRGPPRLRSSRQPSAHRRSGICHSVCMLHVRNMSTRQRRPTQVHEKD
FT                   LGTSQPAVVAAAVLEQPSQVIRKLLHWDDLPHWQRDNQHIHTGYRPASFSLLVSLQSLT
FT                   YLHNETVNIYTHLLPSLLAVPAAGLLYRALAPRYESATQADLVAFGCFFAGAAFCLGMS
FT                   ATYHTISNHSPLVARIGNTFDYVGIVGLIVGSFVPSVYFGFYCMPDLQRLYWTMICASR
FT                   SWLHPCFDLPSFPDASVAAIPCVHVCRHGSVSGVPRDPRLTLVRSGADDTPNRARLAAS
FT                   P"
FT   CDS_pept        join(1038705..1038805,1038879..1039743)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902875"
FT                   /orf_name="An16g04550"
FT                   /protein_id="CAK42885.1"
FT                   /db_xref="HOGENOM:HBG328549"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniParc:UPI0000EFCF05"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7S4"
FT                   /transl_table=1
FT                   /translation="MAGHAQPGKAPGSRLKPVADSLDTVGFVSKGDQKLLDHKVQKEYY
FT                   DKIVNRYMEFCARHSKNIEAAWTSLPRSASSDATSNPPASLPSSNNNKSTGPRSPSPSA
FT                   ELSTILLSLRKLREAVLATSSKIPISFSQQVHIFSIKLAIQARHPPSYFPSFRYILEDL
FT                   HTSSHPLPDSDLKDLISYWILDYACRQEDMVAAYQLRARARRRYGFQSSTIDRVLNALA
FT                   HDNWIVFWQIRQDVDSRMRAVMNWAEDRVRRHALKAVGKAYLSTDTRWITEGCTGDSNW
FT                   TWENLVKAESLGWEKEGDRIIIRKPKQRPQSNLAPIKENP"
FT   CDS_pept        join(complement(1041417..1041459),
FT                   complement(1041296..1041344),complement(1040180..1041245))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197127" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902876"
FT                   /orf_name="An16g04560"
FT                   /product="Remark: human CGI-87 was identified by homology
FT                   to a C. elegans gene"
FT                   /protein_id="CAK42886.1"
FT                   /db_xref="UniParc:UPI0000EFCF06"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7S5"
FT                   /transl_table=1
FT                   /translation="MDASPTKHTRNVSRSSRPRSTTKGPLDQPDDPLGSETVNTAASPR
FT                   PATAGDGGFTGASFSRLDPLGPDELPPTVEKDLSYLLRYDVYHSLSQVEIPHALRSEFL
FT                   APTSDESLSTSLATLERLLAEGHFLLAAYLCGTILTSSLISATDIKRIFALFYTRLACL
FT                   QLSGNTIIAAQESKALEDLSSAFYYVEPISGTSDKHSNYPRHIVPWPLRVLAIRLQSIG
FT                   FGDSRRGIGGLYEIGLEARREILRPDMDPEERKLWRERLSDLGMRNVNALIEMGDLDAA
FT                   RRSLASLRMAESESEINKLRKVLLMLIIGDLDAARQVCGEESDAGNTVFRPLLSMAEGR
FT                   YDDAVAEWRALLGNEEHRPDESMISQNLAVCLLYTGRLNEVSHIP"
FT   CDS_pept        join(complement(1043311..1043508),
FT                   complement(1043145..1043230),complement(1042897..1043097),
FT                   complement(1042679..1042804),complement(1042480..1042599),
FT                   complement(1042262..1042387),complement(1042018..1042166),
FT                   complement(1041851..1041939))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966410"
FT                   /orf_name="An16g04570"
FT                   /product="Similarity: the predicted A. niger protein shows
FT                   weak similarity to rat SP120"
FT                   /protein_id="CAK42887.1"
FT                   /db_xref="UniParc:UPI0000EFCF07"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7S6"
FT                   /transl_table=1
FT                   /translation="MGGEERGHVVWRSGSASACGISIVSAESNFEGFRLDELCLSYLGI
FT                   TSPLSQLCTITRAQHESLHPNIAAPTAEFMQTIPFIHRQDANRVFAGARCKSQEQEQDW
FT                   KYNTKKKDQQSMSRSFSSSSRKGPNFSKQYAIRVQDPARQRQEQHSRFIIVAHSAQRWT
FT                   HAEDGKYNSRMAGEWAYLSFIDHMSDHSLKRSSAQDLGRPNRNQTGSGLDKTKPLHNTH
FT                   NCIHCSAHPVCGEASDKCIELRVRNAGEYSQAQNTKDDDHDVEREDVGDTESQAQDDAD
FT                   HARPTTRLPKAATDGGPFMTAPSAEDPGNHDLFSQMLQRRTVGQQRARNGTEKSGKQGK
FT                   SVLKFLERSSSARVMVPDEGAGYR"
FT   CDS_pept        join(1043569..1043877,1044030..1045151)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000265377" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813241"
FT                   /orf_name="An16g04580"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit L"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK42888.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG380809"
FT                   /db_xref="InterPro:IPR019382"
FT                   /db_xref="UniParc:UPI0000EFCF08"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R7S7"
FT                   /transl_table=1
FT                   /translation="MSYEERANAHPNLGDESDVEEEALVNDYREQVNFDDGMSELDRTT
FT                   SLGGGSQTQDLQAQLAAAATPLEYQATLETKFASYDNYCSLFHYILNSDGPVELEVPSY
FT                   YWAWDVIDEFIYQFESFCRYRNRVARSGSNEEEAQLLRENPNTWGCYSVLNVLYSLIQR
FT                   SQINEQLAAIKRGEDPLAFAGEYGSRPLYKMLGYFSIIGLLRVHCLLGDFSLALKTLDD
FT                   IEMNKKAMFARVMAAHFTTYYYVGFSYMMMRRYADAIRMFSHILVYVSRTKNFQKGGNS
FT                   YDAIAKKNDQMYALIAICVALHPTRLDDTIHSALREKYGEQLNRLQHGGPEALPLFEEL
FT                   FRSACPKFISPTPPDFENPALNVDPVDHHTAIFMDEVKNTLYNPTIRSYLKLYTTMDLK
FT                   KLAGFLEVEPEKLRSWLLINKQRSRQVRWVEGGLLEGEPVNANDLDYALENDLIHVSET
FT                   KAGRRLVDWYLRNLARVY"
FT   CDS_pept        join(1045307..1045426,1045598..1045729)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660437"
FT                   /orf_name="An16g04590"
FT                   /protein_id="CAK42889.1"
FT                   /db_xref="UniParc:UPI0000EFCF09"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7S8"
FT                   /transl_table=1
FT                   /translation="MGVWSRRYHQLGRGSSEIESKSCFSNGSFTLSALWPVHSHNSLFP
FT                   FCFIFEEMFKAYPIMLVFGFASGSTRSGLCASSCLCLS"
FT   CDS_pept        join(complement(1046732..1047184),
FT                   complement(1045929..1046300))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000228313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966411"
FT                   /orf_name="An16g04600"
FT                   /product="Function: S. cerevisiae Isa2p is involved in the
FT                   assembly of iron-sulfur"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="CAK42890.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="UniParc:UPI0000EFCF0A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7S9"
FT                   /transl_table=1
FT                   /translation="MAAPSLRSYYQSNLHSLSPKALLQSPFLTPTLPSMTTNMSRPILS
FT                   TAARRISRSHSPRTAVSALSPATLPTLSFSASFCDTVSQRSTLRPRFLCPRASSSSSRS
FT                   VFRFDAFGQRSSFSTTSIRPATKVLQNPRVDEDGKDLLINISPRAAERLREMTDPSSSP
FT                   SITKEENPYHHLRITVTSGGCHGFQYLMSLEAASKIDAEEDTIFAAEPEEGEAEAAGAG
FT                   EAKVVMDEPSLELLSGSTVDYTMELIGSQFKIVDNPRATSNCGCGTSFDVQD"
FT   rRNA            complement(1046404..1046522)
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="An16e04610"
FT   CDS_pept        join(1047441..1047630,1047695..1048038,1048095..1048578,
FT                   1048634..1049013,1049207..1049227)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000242438" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660438"
FT                   /gene_name="bna5-1"
FT                   /orf_name="An16g04630"
FT                   /product="Kynureninase 1"
FT                   /EC_number="3.7.1.3"
FT                   /function="kynureninase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="NAD biosynthetic process"
FT                   /biological_process="tryptophan catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK42891.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006569"
FT                   /db_xref="GO:0009435"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0030429"
FT                   /db_xref="HOGENOM:HBG523016"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000EFCF0B"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R7T0"
FT                   /transl_table=1
FT                   /translation="MSSQLGHESSVSSPLSYKTDSNAFTREYAESLDAQDPLRDFRKEF
FT                   IIPSKVDLKRKTLAIDDSSKDESDPRCIYLCGNSLGVQPRNARKYIDYYLRTWAIKGVT
FT                   GHFLPHEDQLLPPFVDVDDAGAKLMAPIVGALESEVAVMGTLTANLHFLMASFYRPTQE
FT                   RYKIILEGKAFPSDHYAIESQIRHHNLRPEDAMVLIEPEDRLKPILRTEQILRVIDEHA
FT                   SSTALVLLSGIQFYTGQYFDIEKITAHAQSKGILVGWDCAHAAGNVDLRLHDWNVDFAA
FT                   WCNYKYLNSGPGGMAALFVHERHGRVDMDKVGSDEEPFRPRLSGWWGGDKKTRFLMNNN
FT                   FLPQTGAAGFQLSNPSVLDMNAVVASLELFNRTSMAEIRQKSLNATGYLEHLLLNYPAD
FT                   FSTGKRPFSIITPSNPAERGAQLSLLLEPGLLDSVLETLEEHGVVVDERKPDVIRVAPA
FT                   PLYNTYTEYPTYRT"
FT   CDS_pept        join(complement(1050036..1050167),
FT                   complement(1049600..1049952),complement(1049439..1049514))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163282" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902877"
FT                   /orf_name="An16g04640"
FT                   /protein_id="CAK42892.1"
FT                   /db_xref="HOGENOM:HBG609692"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniParc:UPI0000EFCF0C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T1"
FT                   /transl_table=1
FT                   /translation="MASLPPPPPPQWVVRMNTPMPRPSKEAASIPDPPGFSRKMAGKNN
FT                   RAQQSSTTSAPSKPIETDTLKLKKAWEIALAPSKQIPMNAIMMYMSGNSLQIFSIMMVF
FT                   MLFKGPIQGLINTNTVFAKFDTEGTRGKLLGVKAIYVVMQLVLLCLGIWKVNAMGLLPT
FT                   TRSDWLAWESERQPLERAYFAFG"
FT   CDS_pept        join(1050740..1050778,1051123..1051307,1051375..1051450,
FT                   1051505..1051869,1051919..1052347,1052398..1053404,
FT                   1053577..1053605)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902878"
FT                   /orf_name="An16g04650"
FT                   /product="Function: the H. sapiens homolog BAM22 is member
FT                   of the beta-adaptin family"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAK42893.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG718694"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="UniParc:UPI0000EFCF0D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T2"
FT                   /transl_table=1
FT                   /translation="MSSSGGDAKLFARGKVAELRQELNSGGKKDKNHSAKKIALKKIVA
FT                   NMTMSNNDMVALFPDVIGCMNLPSLEIKKMCFLFLVNYSRAKPEVALKALPFLIDDMED
FT                   SNPLVRALALRTISYIHVREFVEATVQPVKRLMSDMDPYVRKTAAFCVAKLYEHDKKMV
FT                   EASDLIDRLNSMLKDENPTVVSSVLASLVDIWGRSESISLTIDYTSASKLVSILPDCSE
FT                   WGQSYILEALMSYVPQDSAESLLLAERIAPRLSHSNSAVVLTSIRVILYLMNYIADERH
FT                   VTSLAKKLSPPLVTLLSKPPEVQYLALRNAILILQKRPEVLRNDIRCFFCNYNDPIYVK
FT                   VTKLELIFMLTTKENISVVLAELREYATEIDVHFVRKAVRAIGKLAIKIESAAKQCIDT
FT                   LLELVNAKIPYIVQEATVVIRNIFRKYPNQYENIIGNVIQNIDELDEPEAKAAIIWIIG
FT                   QYADRIENSDGLLQDYLATFHDETVEVQLALLTATVKFFIQRPTKGQQLVPQVLKWCTE
FT                   ETDDPDLRDRGYMYWRLLSTDPKTAKQIVMGEKPPISAESEKLDSRTLEELCLNVGTLA
FT                   TVYLKPVQQVFRSARTRRLQYSPALQKPKEEPGNAVWQFPAPSQSSSPTAAMAASASAP
FT                   ADMNAAVNAADSYFNSVGTQQMAALDLGGREDGGVGGGGAPQTQYVVTQNQQQVYQPQL
FT                   AGGAATGNYALLGHE"
FT   CDS_pept        join(complement(1055044..1055069),
FT                   complement(1053762..1054965))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163249" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902879"
FT                   /orf_name="An16g04660"
FT                   /product="Similarity to hypothetical protein CAB46758.1 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK42894.1"
FT                   /db_xref="HOGENOM:HBG328555"
FT                   /db_xref="InterPro:IPR019339"
FT                   /db_xref="InterPro:IPR022209"
FT                   /db_xref="UniParc:UPI0000EFCF0E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T3"
FT                   /transl_table=1
FT                   /translation="MGGDLNLKKSWHPSLLRNQERVWAEEKRALEERKRIDQLRRERDE
FT                   ERQIQELQRLQEGSGKPKQIQRVDWMYQEPGAGGAGGGMYAEEMEGYLLGKRRIDGVLL
FT                   KKDGGETEGLKKGAEFNATLGGGGAVAQANPRDTMAKVLADPLLEIRKREQAALEGMVR
FT                   EEVRKGSSSKGEKRDRDRDGHRERRRERERRHRSRSPERRRRDTLDRDDRRSERDHRRE
FT                   RDSDRDYHRSSRHRDHRDREDRYDRRESRQDRSPADRHHSDRRRADDRRESDGHRDSRD
FT                   RDRERDRRDRDRSSRYHQDKRDYRPRDRDTYTRDKPSPEEAEQKRKQQEEERQRKLAEM
FT                   QANASEMEDARRQRIAEVTAMEEKQHEEDEKHRSEKGRFVSGLHKQLQEDSLDERIKRS
FT                   RGGLARMDED"
FT   CDS_pept        join(complement(1057552..1059295),
FT                   complement(1057397..1057492),complement(1055554..1057343))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163238" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902880"
FT                   /orf_name="An16g04670"
FT                   /protein_id="CAK42895.1"
FT                   /db_xref="HOGENOM:HBG328556"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI0000EFCF0F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T4"
FT                   /transl_table=1
FT                   /translation="MSSPPFTVKAVFEYASDHDDDLNFAIGQVVTVTAVEDEEWYFGEY
FT                   TDESGHKREGIFPKNFVERYEPPAPPRPTRPSRPKREPDVAPPPPEPAVAVEPPTTQPP
FT                   RSLEPEVEDTPAAVPQPPQSPPPALASPTRELPSSPKPAPVPASVPAPASVPQPPANDI
FT                   SEPAPKPSSKPPPPAVAEKPTGSSFRDRIAAFNKPAAPPIAPFKPGGLSAQNTSFVKKP
FT                   FVAAPPSRDAYVPPPREAPRKIYRREEDPEVQERLAREPPVSETRPLSSGGAEEGAEEQ
FT                   PKPTSLKERIALLQKQQMEQAARHAEAAQKKDKPKRPPPKKRTESHEEALPVEEPITEN
FT                   APSGEPERDHSVETVKGSHPPAPQAAMPPPPVRELVSDTNDADDSAAADTEDAEETSTS
FT                   KEDYDERARAEVQHEAQAESRQLEKAEEREAQVDEGAEEDEEGEEEEEEEIDPEVKRKM
FT                   ELRERMAKMSGGMGMMGFFGPPGGMPRPAAAPRKPKAPVEAERPSGEHERSGPATAPPV
FT                   PIMALPGMNVAKPAVTLSVEKEEEEAQTSPVTEKHPPHEVADVEDVVEEEPPRRTSTDR
FT                   PPAPLERSAPPPPPLETRPVPPPVPHDAPLSPPPVPGHQATPKGVAPADTGDESDDELS
FT                   LHTRNLSLNAAAADQSPSQPVPAPPLPDHLDSRRSSTYDVTSPKSPTLPADKRLSRPPP
FT                   PIPPVPAQSRPAPPPPPANIRRRSTADSRTSVTSQSRQAGEEVEGEVTEYDGDYDTDIA
FT                   SGAKFKDALKAHGRDSSFDEGTTTDDHSLQSPRSPPQTRLPPPPPPTAPRAVPPPPPIQ
FT                   PPKSAGRASIDSPRGPPPPPPHRELSFGGDDDEYDPYRYNAPQHGLPTPRGPPPVPAGP
FT                   PQLPPVIPSQPAEEEPEELYEASPVQSHPESTFSQSEKRTSMAPPPPTLPPPTPRSNRA
FT                   SLDVPRAQPSMRRSMDVSRPSVDQGFIAMDVDLAENTLWWTQHNTPPPVFQNRKDILLE
FT                   FEESSSSKRGGKTMVTKDIYVLFMDHSQTVITVNFDARNPTDVAFEQRHEAPPIQPRQD
FT                   QLENAHLQIGTHIAATANSVQNTTVTDGTPFGLVQHVLSPLSDALKPVGTRAYGALVYS
FT                   NLANASVQQNDEIRAGDIVSFRNARFQGHRGTMHQKYSAEVGKPDHVAIVVDWDGTKKK
FT                   IRAWEQGRESKKVKMESFKLNDLRSGECKVWRVMPRSYVGWEK"
FT   CDS_pept        1060428..1061429
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18117451"
FT                   /orf_name="An16g04680"
FT                   /product="Similarity to hypothetical protein SPAC23A1.16c -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK42896.1"
FT                   /db_xref="HOGENOM:HBG328557"
FT                   /db_xref="InterPro:IPR007308"
FT                   /db_xref="UniParc:UPI0000EFCF10"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T5"
FT                   /transl_table=1
FT                   /translation="MSSGRPNPILKTSLPSIHAATAASGPSNSAPNHRASPSNPLQMSQ
FT                   QQQPLPSSIANRTDVDPRHLAIALHHANQIQAQKDTEVLILDRILRLVELPSSRSADPA
FT                   SPSPDDVRVFKSALVPFQPADYDNLIEERNIEGLCGYGLCPRERRKEDGRGSFRITWGA
FT                   KGSGRGGRGREMDIVPKEKLEMWCSNECAERAMYIRVQLAEEPVWERRADDARGKHLVL
FT                   LEEARAKEGKGKMRDPVSIRDVAGQLDSMHLEKLQGPGDMADDIARLSVRDETRSRELA
FT                   MERGDVHPALYTGRVNIQVQENDNPRGPARAPQMRPGDEKGGSIEGYVPHEN"
FT   CDS_pept        join(complement(1062451..1062471),
FT                   complement(1062253..1062378),complement(1061973..1062170),
FT                   complement(1061833..1061907))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966412"
FT                   /orf_name="An16g04690"
FT                   /product="Remark: S17B of S. cerevisiae belongs to the S17E
FT                   family of ribosomal proteins"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK42897.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG460442"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="UniParc:UPI0000EFCF11"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T6"
FT                   /transl_table=1
FT                   /translation="MGRVRTKTVKRSAKVVIERYYPKLTLDFETNKRICDEIAIIASKR
FT                   LRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSALDVSQTESGQLDVD
FT                   SETKDLLKSMGFDNLKVNVIPVSQQQAQERPRRYR"
FT   CDS_pept        complement(1062973..1064340)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902881"
FT                   /orf_name="An16g04700"
FT                   /protein_id="CAK42898.1"
FT                   /db_xref="HOGENOM:HBG328558"
FT                   /db_xref="UniParc:UPI0000EFCF44"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T7"
FT                   /transl_table=1
FT                   /translation="MATARLSPTANLLRKSRLFALPQALTPPQTPPTSKSVNESETATL
FT                   PHPIRASIVTPSSSLSRGDWGLKRPLPAKSTSEKSSRPVVRINALDTFEHITDFESAAD
FT                   HTVTLEKFQELNMPVSLPARVTYGTSIIPRHQSPFESHVDNTHTSEGLKEPGARQFRHS
FT                   GPWLAGQTEAEFQAYLKKVRKNKPEILQKLREYFVAKREAEQRKQAQDNGQDLATLRPV
FT                   QITDEEFQGYLKKLRTDPFSLGPVVFELLDLPSPPAVPSSRLNNPYYQSPGSKLSSAEY
FT                   VASGPPRTHPSAGLSYTRSHALIYNHPKYGPQAHQRPVEARILRPRGRKGKNTKAIAGV
FT                   AGIAVEDLNTVTFTEQDSPAGLAYFDASIPGGAKYWATPIRAFVDSEGKIGLASYRASA
FT                   TAKAPYGIDSQKKPGSYSISDVARGDQRVVPRLDRQRNAAAETEEVARNLMKSLGS"
FT   CDS_pept        join(complement(1065842..1065863),
FT                   complement(1065727..1065778),complement(1065539..1065671),
FT                   complement(1065160..1065450),complement(1064593..1065099))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902882"
FT                   /orf_name="An16g04710"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAK42899.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCF45"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T8"
FT                   /transl_table=1
FT                   /translation="MPKVLLSGGSGFIAAHIVDILLAHGFDTVVTVRSEEKGQRILEAH
FT                   PNTPKEKLSYVIVKDVAAEGAFDEAVKSDPPFDYVLHTASPFHHNVQDPVKDFLDPAIK
FT                   GTTGILKAIKANAPTVKRVVITSSFAAIVNAKKHPESYSEKNWNPVTWEEALNASNTYR
FT                   ASKTFAEKAAWDFVEKEKPNFDIATINPPFVFGPVVHYLNSLDAINTSNQKVSNLIQGK
FT                   WKDAIPPSGTFLWVDVRDVALAHVRAIEVPEAGGQRFFVTAGYYSNKEIADIVRETLPE
FT                   LEDKFPPKGSSSDLPADIYSYDNKRSVEVLGIQYRTLKQSIADTAKSLSSIGV"
FT   mat_peptide     join(complement(1065539..1065670),
FT                   complement(1065160..1065450),complement(1064596..1065099))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T8 "
FT   sig_peptide     join(complement(1065842..1065863),
FT                   complement(1065727..1065778),complement(1065671..1065671))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T8 "
FT   CDS_pept        join(1067449..1067575,1067634..1068585,1068640..1072375,
FT                   1072466..1074343,1074406..1074795)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902883"
FT                   /orf_name="An16g04720"
FT                   /EC_number="2.7.1.137"
FT                   /function="1-phosphatidylinositol-3-kinase activity "
FT                   /function="ATP binding"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="CAK42900.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0016303"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="HOGENOM:HBG320181"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR009076"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI0000EFCF46"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7T9"
FT                   /transl_table=1
FT                   /translation="MAQAGPITDVTHRLFAELKSKNEETRVRAAYELYDNVLAISRDWS
FT                   PEKFLEFFNAVSQRIAQLVVTGNDAHEKIGGLLALDRLIDFEGVDAAQKTTRFASYLRN
FT                   ALRSNDNAVLVYAAAALGRLAKPGGALTAELVESEIQSALEALQSERQESRRFAAVLVI
FT                   RELAKGSPTLLYGFVPQIFELIWVALRDPKVLIREAAANAVSECFDIIAARDLQVRQLW
FT                   FSRVYEEALLGLKSSNVDWIHGSLLVLKELLLKGAMFMNEHYRNACEIVLRLKDHRDPK
FT                   IRTQVVQTIPILASYAPLDFTETYLHRFMIYLQAQLKRDKERNAAFIAIGKIANAVGVA
FT                   IAQYLDGIIVYIREGLAMKARNRAAVQEAPMFECISMLSLAVGQALSKYMEALLDPIFA
FT                   CGLSESLTQALVDMAHYIPPIKPIIQEKLLDMLSLILYGTPFRPLGCPESRLPPMPSFA
FT                   RDFAPQELHSDTEIALALHTLGSFDFSGHILNEFVRDVAINYVENDNPEIRKASALTCC
FT                   QLFVHDPIINQTSSHSIQVVSEVIDKLLTVGVGDPDPDIRRTVLWSLDRKFDRHLARPE
FT                   NIRCLFLAVNDEVFPVREAAICIIGRLSSVNPAYVFPPLRKLLVNLLTSLGFASTARQK
FT                   EESAQLISLFVSNATKLIRSYVDPMVTTLLPKATDANPGVASTTLRAVGELANVGGSEM
FT                   KTYLPQLMPIILDALQDLSSHSKREAALRTLGQLASNSGYVIDPYLEYSHLLAVLINII
FT                   KTEQTGSLRKETIKLLGILGALDPYKYQQISETAPVVHHINEVQTVSDVALIMQGLTPS
FT                   SEEYYPTVVINTLMQNILRESSLAQYHSAVIDAIVTIFKTLGLKCVPFLGQIIPGFISV
FT                   IRGSPPSRLESYFNQMAILVNIVRQHIRAFLPEIIEVVREFWEASYQVQATILSLVEAI
FT                   AKSLEGEFKKYLAGLIPPMLDTLEKDTTMRRQPSEKILHTFLIFGTSGEEYMHLIVPSI
FT                   VRLFDRTQNPQSIRKSAIETLTKLSRQVNVSDFASLMVHSLSRVVAGTDRVLRQAAMDC
FT                   ICALIFQLGQDFNHYIHLLNKVIKYNQINHVNYHILVTKIQKGDPLPQDLNPEENYAAL
FT                   ADDTNYAEIGQKKMVVNQQHLKNAWDASQKSTREDWQEWIRRFSVELLKESPSPALRAC
FT                   ASLAGIYQPLARDLFNAAFVSCWTELYDQYQEELVRSIEKALTSPNIPPEILQVLLNLA
FT                   EFMEHDDKALPIDIRTLGKYAAKCHAFAKALHYKELEFEQDQNSGAVEALITINNQLQQ
FT                   SDAAIGILRKAQAYRDVELKETWFEKLQRWEEALAAYKRREKIDPDSFGVTMGKMRCLH
FT                   ALGEWKVLSDLAQEKWNQASLEHRRAIAPLAAAAAWGRGQWELMDSYLGVMKEQSPDRS
FT                   FFGAILAIHRNQFDEATMYIEKARNGLDTELSALLGESYNRAYNVVVRVQMLAELEEII
FT                   TYKQNIGDPEKQDSMRQTWNKRLLGCQQNVEVWQRMLKVRALVTSPRENLDMWIKFANL
FT                   CRKSNRMGLAERSLASLETVVSDSNGTRAIAPPEVTYARLKFNWATGRQREALQMLKEF
FT                   TSSLTEDLTRFNALMLSQADHNGINGFRRLLAKSYLRQGEWQTTLQRGDWRPEHVREVL
FT                   NAYAAATKYNRDSYKAWHSWALANFEVVTTIASQASRDGTTMAMVPGHIVTEHVIPALR
FT                   GFLRSISLSSTSSLQDTLRLLTLWFTHGGDQEVNSVVAEGFTAVNIDTWLAVTPQLIAR
FT                   INQPNIRVRSAVHRLLAEVGKVHPQALVYPLTVAMKSNVARRSQSASNIMDSMRQHSAK
FT                   LVEQADVVSHELIRVAVLWHELWHEGLEEASRLYFGDHNVEGMFATLAPLHEMLDKGAE
FT                   TLREVSFAQAFGRDLAEAKHYCMLYRETEEIGDLNQAWDLYYTVFRKISRQLPQLSTLD
FT                   LKYVSPKLKDCIDLDLAVPGTYQSGRPIIRILSFDPILHVLQTKKRPRRMTLKGSDGNS
FT                   YMYCVKGHEDIRQDERVMQLFGLVNTLLDNDGESFKRHLSVQRFPAIPLSQSSGILGWV
FT                   SNSDTLHALIKEYRESRRILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYAMDNTTGKDL
FT                   YRVLWLKSSSSEAWLERRTNYTRSLGVMSMVGYILGLGDRHPSNLLLDRVTGKVVHIDF
FT                   GDCFEVAMHREKYPERVPFRLTRMLTFAMEVSNIEGSYRITCEAVMRVLRENKDSLMAV
FT                   LEAFIHDPLINWRLGIRESPDRMPFSAERRQSVVSNINIDHGVQPSNFSRHRRPSILEG
FT                   GILDAQEGIPNEAREAQNARALQVLARVKEKLTGRDFKPSEELNVSDQVDKLLAQATSV
FT                   ENICQHWIGWCSFW"
FT   CDS_pept        join(1075381..1075673,1075767..1076199,1076255..1076391,
FT                   1076447..1077191)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902884"
FT                   /orf_name="An16g04730"
FT                   /product="Similarity to hypothetical protein BAA97377.1 -
FT                   Arabidopsis thaliana"
FT                   /protein_id="CAK42901.1"
FT                   /db_xref="HOGENOM:HBG328559"
FT                   /db_xref="UniParc:UPI0000EFCF47"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U0"
FT                   /transl_table=1
FT                   /translation="MASDSTPNPDLHPVVRNALRISLSAKEYKLLHDYAVQRTPSAIQN
FT                   KLPSPSAFEAIVRSKNKHNEASIRASLRVFVLSSSLLKLVDVVAGRIRGDLTQKNTSRT
FT                   SFARSPNFRLSISLSLLLLIHRFLYRFFVKLRANLRTDDARPFRDRNPRISRALTSRFA
FT                   PAVGASIAGLALGICPQKQLRLTAAIYTATRSLEFLFNALDEKGWFKDRPRWFGSWLLM
FT                   PIACAQLFHAFIFDRETAPKWFGDVILRLSPSYVRGRPESLPLEIPWPEKEDVVDSLAN
FT                   IANLRWPAFASPILHPGSPNTLPSTLTSISPITGPAHPAISSLSCALLHPNSPSCSTAF
FT                   LHHILLLVPPLARFLTTVTLALSLRNIKALMNEPISSINKLSKKIITMTAILSASTGFA
FT                   WGSICLWNTLLPRSVLPAKRFFLSGALAGVPFAFLTNSRGIFMYFFRAAVDSAWKTGVK
FT                   RGLWKGWKGGDLSIIVLAWALIGSILETRPSAVQGKGVRKALAWLKGDGFADPVEMAAK
FT                   RRARKAAALKAEKAENEP"
FT   tRNA            complement(1077692..1077763)
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        join(1078753..1079079,1079146..1079886)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227439" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966413"
FT                   /orf_name="An16g04750"
FT                   /product="Remark: The S. griseus homolog strI belongs to
FT                   the streptomycin"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42902.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG612336"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCF48"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U1"
FT                   /transl_table=1
FT                   /translation="MSARKLKVGCAGLGRMGKRHALNFLQRTPRADLVAVSTPDDSELE
FT                   WAKANLAPYGVTAYKNYEDMLKHEGLEAVVVASATAVHAEQAIKAIEAGKNVLCEKPLS
FT                   TSVEISQTVLDAAAKKPELKVMCGFSRRFDASYRDAFNKMSAGGIGAPAVMRSQTCDKL
FT                   DPTGFFVAYAEFSGGIFVDCSIHDIDLALWFFGQDSKVKSVSAVGITAVEPDLRKHNDR
FT                   DNAVGLVEFHNGKIAYFYASRMMAAGQEDTTEIIGTKGKLAVNTQPALNLVNIFDENGV
FT                   RREIPQHYYDRFEYAFVTEANEFTACCLENTPVPLKLEGAVQAVRIGAALQESLITGEK
FT                   IFFDEAGQRIPKARL"
FT   CDS_pept        join(complement(1080975..1081865),
FT                   complement(1080860..1080916))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163182" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902885"
FT                   /orf_name="An16g04760"
FT                   /product="Localization: the C. gloeosporioides homolog alr6
FT                   is a putative peroxisomal protein "
FT                   /function="inositol oxygenase activity"
FT                   /function="iron ion binding"
FT                   /biological_process="inositol catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK42903.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019310"
FT                   /db_xref="GO:0050113"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG332059"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniParc:UPI0000EFCF49"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U2"
FT                   /transl_table=1
FT                   /translation="MAPVAVSPESPVFNTKRDGQALEELSDAIDNVNVLKDNMKKEKGL
FT                   YEESEFDKNKDKTKFRQYEDACDRVKNFYKEQHTKQTVAYNLKARNEFHSKTRAEMTIW
FT                   EAMEKLNTLIDESDPDTSLSQIEHLLQSAEAIRRDGKPRWMQLTGLIHDLGKLLYFFDA
FT                   QGQWDVVGDTFPVGCGFDERIIYGRESFKDNEDFGHPIYDTKFGIYSPGCGLDNVMLSW
FT                   GHDEYLYHVVKDQSTLPDEALAMIRYHSFYPWHNAGAYHELMNDHDKEMFKAVKAFNPY
FT                   DLYSKSDDVPSPEELKPYYLDLIDEYFPNKVIKW"
FT   CDS_pept        join(1083039..1083114,1083171..1083467,1083522..1083902,
FT                   1083962..1084167)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813242"
FT                   /orf_name="An16g04770"
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42904.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0000EFCF4A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U3"
FT                   /transl_table=1
FT                   /translation="MGSTSTVADTRFKLNTGAEIPALGLGTWQSGPGEVEKAVAHAISV
FT                   GYRHIDTAFAYGNEGEVGKGIKAAIESGVVKREDLFVTTKLWSTWHYRVEQALDQSLKN
FT                   LGLDYVDLYLVHWPVAMNPNGNHPNIPTLPDGSRDLHLNHSHINTWKDMEKLVGSGKTK
FT                   AIGVCNYSRPYLEELLAQATVVPAVNQIENHPCLPQQEAVDFCKEKGIHITAYSPLGST
FT                   GSPLLTAEPIVEVAKKKGVDPATVLLSWHISRGSSVLAKSVNPSRIEGNRNLVALDDAD
FT                   MATIAKYTNDLASKNAFQRFVFPPFKLDFGFPDKIGRV"
FT   CDS_pept        join(complement(1087589..1087732),
FT                   complement(1087429..1087441),complement(1087384..1087399),
FT                   complement(1085960..1087149),complement(1084718..1085901))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902886"
FT                   /orf_name="An16g04780"
FT                   /product="Similarity to hypothetical protein NUM1 -
FT                   Arabidopsis thaliana"
FT                   /protein_id="CAK42905.1"
FT                   /db_xref="UniParc:UPI0000EFCF4B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U4"
FT                   /transl_table=1
FT                   /translation="MIGIYDEMKTIGSTSTVQIRTHSYEWHLYSCARSSRKLNYLRGWQ
FT                   ILRRSTSSFLGFSLAYVVMTRRSESFCTSELPFVTEELDTYFWISRKRGDMGPEIRRTK
FT                   SADPVLPSVPQVDGPTEQRKAKKSKSKKKNNNKKNKNKGKGKAVEVEVEEIVVVDSGCD
FT                   VAKEGQQQKQTENGDDHRDDVVVAAADTAIATAAGVEVKSNNLPPPYSSAGEDTSIGEP
FT                   ASSVVTNSPVARMAPAAEAASLKAKIMEAMRIRDRLDRQIQEKRNASAQASSSCGEQRN
FT                   ARAVPAMSSPSSASQRRPDSGSVDNLSHVNRSQRSPVSEMRATGNLNSQPSTSVADYSS
FT                   EEAVRTSGTRSDEPNSQDNYRAANDREIKQYCRAHMRAPCRFDPSCCVHKPMQGCDCPP
FT                   RSSCCCSHHKGDCCTCLTYLNTVSAKSDTETPSDVGQGVEGGKVVAERNTSGGKQSVMD
FT                   DQLKNMEAFSEHLLQLFENRELCDFHFKLTLSNGMHQSTIVPVQVAVIARSPFVAALLR
FT                   TQLYQQGHREIAATLGDQVNLIHGFEHAIRNLYGSPLLHGERLRTEALAVLGYTEESQS
FT                   MYPFPIRTAMLDLAFSYAASGAFLHISNILEAGIRMALELIDWSTVETIIHFGLRVDRF
FT                   SIILEGTDTPPGSPRANHTRSGHVLIRNRQLREIWAPLLARAGLSFIAESIDDKFVLYA
FT                   QAQSLHLPNRIPESLHTASGAIGSEPGSASMNSTTTENKPSREALVASAVLISLPFVHL
FT                   QEVFRTLSARRVLSNNLAQAIMSERESRRLQALRELGRQGEINEQNLPKETKELGYGEY
FT                   LVFKSVCKQGQGPVTVTTEVSLEREWIGCRSPDAKQ"
FT   CDS_pept        complement(1088673..1092083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163149" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902887"
FT                   /orf_name="An16g04790"
FT                   /protein_id="CAK42906.1"
FT                   /db_xref="HOGENOM:HBG328562"
FT                   /db_xref="UniParc:UPI0000EFCF4C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U5"
FT                   /transl_table=1
FT                   /translation="MNRFRKTKKEKVKEDGDYSEASSVSLSSMLSKKSKKEEPEEKQDF
FT                   DLSNALPSTDDFRTSLLMPKLSARFSMLREQDDPESMIGKASDDSVLFPRRASRLNLFG
FT                   HNPSLLSDIDEVSIDGSRPSMNLGRTHSLASDSNNGYGTDDDPCQQGSIMSRARRAEGN
FT                   NLFGGRQKVYKIPSSKTTSGANSESGRMGGRALYDHDLTMSSFQRLKLTERENAATEDT
FT                   PQDSPTQESEDALSSAGSTKRTTFSSTASGPTFNGRTSTAATSFDEQSFIAPPSQTNSA
FT                   DTQASQSKPPVPNMAPERGSVKARRLYGQGLAQSAQNQQTSTLQRLESLSRQRGAGPEL
FT                   PPLNRAFSRSATNLRDRLQPLTIAEPAGTDSRPTSPPSQPRSPERSARVNPREPQTQAN
FT                   SAYGVPPLSPPASENEDKAPLMAALNPEDHGKATAAGLFNKPNSMFDESQFTRRQLQMH
FT                   QGRSTPPLGRLPPPPTQAIPQERAGRARGLSNTSYASRPGSASSHYSEAQRPGSRSAVN
FT                   SPPTRNDNGTFFSNPSPSDSEDDGGASRYATDEIHPALRPETPSKPSTPTSEHRSPLPE
FT                   VRYSDLGDLKPIAENDTIENGPGEDDGLPEKPDSPTLGPAGLGLSGLVRTHLRSNSDRS
FT                   SIYPPPSPGLPSKPIDTDAQEEPVLQHQAGAQNSAHWQTELIARHRREGSTETQREREE
FT                   FANELAERRRKVQEKLRGFAEGESRSASPVSGRQTPDFTPSKPGNAFAFLKNKSGKQHL
FT                   KGARGLNLANASTPALVSDEMWREEEERPSFSFAKHSNSSSPHIAGERSFRSKVFGRSS
FT                   QEDSRESSRSRGASPHSSFRSRRDRSTSDASGRSKSRTRRDRDGLETLEEVAHGVHRPY
FT                   AFPDYDQHGLASVPASTRASAEVSEPITYDRSASAASGRYRSDSRSAVSSYHERPFYPP
FT                   APAASTTSLIGAAAPRPSPIAPYSANATPPLEDMSQGHSLTPVTTNSSTTAPPPRAPGH
FT                   NGLHKRPVTKALISEPRFVSSTSNVPTVGLPPGASLSNGRDTPPVPPMNPRRRRQTTTQ
FT                   TILGALKGERHESQYAPSLDAAMMEETSNFSDDGEKRPRSRARLRKTSSEGGNLNAKAR
FT                   QQLQHLMSEAPPAVPSYPPPKIPMDGGMF"
FT   CDS_pept        join(complement(1094883..1094920),
FT                   complement(1094413..1094538),complement(1094096..1094190),
FT                   complement(1093965..1093985),complement(1093869..1093883),
FT                   complement(1093807..1093820),complement(1093404..1093508))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660439"
FT                   /orf_name="An16g04800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42907.1"
FT                   /db_xref="UniParc:UPI0000EFCF4D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U6"
FT                   /transl_table=1
FT                   /translation="MLDLLFPPSLLEGLPDGSRDDRPARPNFRNPSSGLGIKFKGHETA
FT                   SDRQVIFSRGTRGREDFFRGLGFSPQPQIGPHPGRRGHKRLFKKALISSTLSKREVSKN
FT                   LHRSIIKCGEEKNNHDSRAALKIRTAGREKKKH"
FT   CDS_pept        join(complement(1096623..1096958),
FT                   complement(1096445..1096518),complement(1096052..1096130),
FT                   complement(1095860..1095947),complement(1095653..1095738))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902888"
FT                   /orf_name="An16g04810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42908.1"
FT                   /db_xref="UniParc:UPI0000EFCF76"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U7"
FT                   /transl_table=1
FT                   /translation="MASCARPSVCLRRSMHTQSVTALQAAALLTFSPTMFLVFVHNVLG
FT                   AARVSVGSETHCPLQQTSPWQPASHLLEMRLAMPLDKQSCGDGVVVDQTSLARSRIHGW
FT                   SYSAIRARELASLTPAVEGETPADRLEGEVISASKGLIWNPREESRILGWAFLGSGPPP
FT                   AAGDDGDAGWDEINDFMMMWLTIVDVIDSKFYRTGGDNPAQVLSGLPLLDVSTYSTQ"
FT   CDS_pept        join(1097197..1097446,1097679..1098253)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000262434" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813243"
FT                   /orf_name="An16g04820"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAK42909.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG734645"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCF77"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U8"
FT                   /transl_table=1
FT                   /translation="MQVLLLGGHGKVALQLTPLLLARSWNVTSVIRNAEHENEILALGK
FT                   GAKGKLSVLLSSLDDIKSDADAKNVLDRVSPDYVVWSAGAGGKGGPARTHAIDEVAAKH
FT                   FLSASFSHPSVRKFLLVSWIGSRRKQPTWLSDDEWAGLQNVFYNVLPAYAKAKLEADEY
FT                   MTALAAARKKLVAAGAAQPLQAINLRPGTLTDTPATRKVDLGKTKKGRANVSREDVAIV
FT                   ADALLARDDVEGWLDLLEGEEDVEVAVERVAREGVDAVEGEDVEGMVSRFGL"
FT   sig_peptide     1097197..1097268
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U8 "
FT   mat_peptide     join(1097269..1097446,1097679..1098250)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U8 "
FT   CDS_pept        join(complement(1100261..1100360),
FT                   complement(1099511..1100146),complement(1098478..1099445))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230009" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902889"
FT                   /orf_name="An16g04830"
FT                   /EC_number="6.2.1.-"
FT                   /function="ligase activity"
FT                   /protein_id="CAK42910.1"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG547964"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000EFCF78"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7U9"
FT                   /transl_table=1
FT                   /translation="MPVSSRYPPVDIPDLDIWSFLFERQDKPFPDDKVIYQDADTQRSY
FT                   TYQQVKDAALTFGKGLKATFDWKKGDVLALFTPNSIDTPAVMWGAIWAGGVVSPSNPAY
FT                   TAEELAFQLKNSGAKVLVTQAPFLQVATAAAKEAGIPEDGIILIGDQRDPQARIKHFTS
FT                   IRNISGATRFRKPKVNPSRNLAFLVYSSGTTGVPKGVMLSHRNIVANILQLAAGEAGNL
FT                   TWNGGVDGTGDRILAFLPFFHIYGLTCLLHQTIHKGLHLYVMTKFDIEQWCSHVQNYRI
FT                   TFSYVVPPVVLLLGKHPIVSKYDLSSLRMMNSGAAPLTQELVESVYARIKCGIKQGYGL
FT                   SETSPTTHTQPWEEWRSTIGSVGKLLPNMEAKYMTMPEDASEPVEVPAGEVGELYMRGP
FT                   NVFQGYHNNPAATAECLSEDGWFRTGDVGFQDPQGNFYITDRVKELIKYKGFQVAPAEL
FT                   EGILVDNEAVDDVAVIGVESEAHGTEVPLAYVVRSAKSLNSGVSAAQEAENIVKWLDAK
FT                   VAYHKRLRGGVSFVKEIPKSASGKILRRLLKKKAKEEGIGAGAAGPKAKL"
FT   CDS_pept        join(complement(1102059..1102217),
FT                   complement(1101630..1102002),complement(1101450..1101567),
FT                   complement(1100968..1101388))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902890"
FT                   /orf_name="An16g04840"
FT                   /protein_id="CAK42911.1"
FT                   /db_xref="HOGENOM:HBG326047"
FT                   /db_xref="UniParc:UPI0000EFCF79"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V0"
FT                   /transl_table=1
FT                   /translation="MSFQSISYNAGPGILALNWTAAAIAILVMILRVIAKLRIRHYAVN
FT                   DTAMLCALVLALAASVMITLAIAHGYGRHSQYLSKANQVLALKYYTAFQCLSIVATGAG
FT                   RAAFTLYLLNILRQERYLGWILWLIFALQIIINIVSVATILAQCQDINSLWDAHVGTAC
FT                   WNPNVERIYGYVQCSINTASDLFLAVFPTYTFWSLSLKLRVKISLVVLMGFGLVAMVAS
FT                   VMRIVNLGSVAERGDQTAATVKLTRWALAECYLVIVTASMPCIRSLIIASVRNISSGNR
FT                   SRVVGSQYKISPPIPSRAAYSTWADTPPRLSREYNLSSYPMELERVGGRAITKQVDITV
FT                   FRNRSRSTRNSDYRRC"
FT   mat_peptide     join(complement(1102059..1102112),
FT                   complement(1101630..1102002),complement(1101450..1101567),
FT                   complement(1100971..1101388))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V0 "
FT   sig_peptide     complement(1102113..1102217)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V0 "
FT   CDS_pept        join(1102520..1102749,1102818..1102956)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902891"
FT                   /orf_name="An16g04850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42912.1"
FT                   /db_xref="UniParc:UPI0000EFCF7A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V1"
FT                   /transl_table=1
FT                   /translation="MGRSSASLNARFGHRGMSAGLHLHHSGNRACPSSSLQWVLSTEGV
FT                   GLAVHLIQSLAGIEGLIVDVSQVFSGPKQVQLTERGYIYSNGFRMLRYKVLIPPGWFAR
FT                   MFVSSQPVIPSGYIQKWR"
FT   CDS_pept        join(complement(1104502..1104547),
FT                   complement(1104176..1104255),complement(1103907..1104068),
FT                   complement(1103781..1103810),complement(1103586..1103684),
FT                   complement(1103174..1103395))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20660440"
FT                   /orf_name="An16g04860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42913.1"
FT                   /db_xref="UniParc:UPI0000EFCF7B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V2"
FT                   /transl_table=1
FT                   /translation="MFLPSRPSLSRPIRVHGLFLFLSYWLWGQLASSTTGDIRGHPGLD
FT                   GIFPSDANSWSKGCAVRKKGYNKPYSLFQLQDRSNDRQERPIKIPGLSLLGSELSDGPY
FT                   TETMAFDLHFGGYVRNVSSGISAQNPDPFHRRVELERLGSKRLNATLVGVYSLSGNSRW
FT                   DGRANISVLGEYRLMHVNQRGLADCEGRQSPSSVLKIVSEPRIPACCME"
FT   mat_peptide     join(complement(1104176..1104202),
FT                   complement(1103907..1104068),complement(1103781..1103810),
FT                   complement(1103586..1103684),complement(1103177..1103395))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V2 "
FT   sig_peptide     join(complement(1104502..1104547),
FT                   complement(1104203..1104255))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V2 "
FT   ncRNA           complement(1104351..1104450)
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U6"
FT                   /db_xref="Rfam:RF00026"
FT   CDS_pept        join(1105919..1106405,1106464..1106576,1106637..1107791)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19813244"
FT                   /orf_name="An16g04870"
FT                   /product="Similarity to protein SEQ ID NO:7732 from patent
FT                   WO200253728-A2 - Candida albicans "
FT                   /protein_id="CAK42914.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI0000EFCF7C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V3"
FT                   /transl_table=1
FT                   /translation="MRVPSIVSTFWLGVQPSSKTIPDAPLAITQHPVFAEADTQDEEAF
FT                   APDTSITSLSKLSHLAEDSVPSVAQAAAHLLLMEAMWAWKQKATSGDIAIKLLSLLSVR
FT                   NVGLQPENEKIRNQLLAGLMEISVPRFYAWWHAVHQTLSSTIREEGFMELPADLLPPID
FT                   VMIIWHAYMLQPVIYADDCSRLDVPHMRRILFPWQAVVDAIDIKTTGYCISSAAREFFE
FT                   KTSGQSADLLEMLCTEEHQLVYDITCPYCHTTRQLPIIPTAQTEDINQGFELECDCGYA
FT                   PSVDALRSDLLHLRQTRESRLRGTYSNPDLAQALYPLARALPIPILESNTKRETFLHAI
FT                   HTASYESNTPQWAVKTLLSFYIPTSPVTKASSAHYSSVLRGMRFVDEMHKQCWLRSPAL
FT                   CVRSTTGPSELVGTLPRAQQKYRNFLDLAPPSNDISVTPTSDVDLFWHTHQLSPGPYRR
FT                   FCIRHVGKFMDHNDKVVHENLNGSFEATQKAYWERFKGEYDACLCWPCELERNDQETTV
FT                   SSDEILSNRQDYRDWVRRVIVVFWQEVEARREKGLPGLERKSLEEVLAKGPRRRSSLVS
FT                   ISSFKSWI"
FT   sig_peptide     1105919..1105975
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V3 "
FT   mat_peptide     join(1105976..1106405,1106464..1106576,1106637..1107788)
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V3 "
FT   CDS_pept        join(complement(1111667..1111777),
FT                   complement(1111365..1111604),complement(1111238..1111316),
FT                   complement(1107971..1111185))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18966414"
FT                   /orf_name="An16g04880"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAK42915.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG328569"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015342"
FT                   /db_xref="UniParc:UPI0000EFCF7D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V4"
FT                   /transl_table=1
FT                   /translation="MAPRKPSTTAEVSLVPLKNCLVNLPPSLVALLVNANTAAQNVIVE
FT                   LQYRQTTGKANGNPAQRSCYLGWTGMPSKRKLAPVVGRDGISSASAAREQDISTVELDT
FT                   TFGRLLGLADGQRVGIYIHLDPPVAHTINIEPLTPEDWEIIELHATFLELNLLSQIRAL
FT                   PNPTYTTPQPDHMHPLALHLSPTSTANIVITSLTPAPPNTSPFAKIAPDAEVIVAPKTR
FT                   PKANRGTRGDSRSVTGSSRRSVGGRSSGSTVRPKGSRSDSTSRGSLFFRGIDRQLSEQY
FT                   FDEEAEEDNNDGFRVWLDPDMLATNELRGAGWACISVVQPAGLKAPPDPQQQVEQTEQK
FT                   GSDAGAPAAKLVARLIPWTDAPDTQHVAVSTLLSTALGVEGMVGGIVRVEAAPPPLQRS
FT                   TVKALKVYPFMADTTKKKDGLKFGSDTAAARDALAERIKMIYGSTGSDKGLLAGPLTDG
FT                   MVLPNTDYQAAGPSFDGAILRFDPPLKTGSETAKPAANWLLGSDAKLSLEVQAEIPRPA
FT                   ETSSSAHPSEDAIPPTVPEMVGIDRIISQSIDNLTKSSSILLTGGLGSGKTALSHLLAH
FT                   RVRKDYLFNVKYFSCRKLVTDETRISNIKETLNRLFMSASWCARLGGQSLVILDDLDKL
FT                   CPVETELQVGGDNGRSRQNSEVICSMVREYCTMNSSVVLLATAQSKESLNNVIIGGHVV
FT                   REIIHLRAPDKEGRRKVLEQLTSQDRGVPPALNGHARNSSSSTQDSWLNPSNPGSRPSS
FT                   AGADGFVLGRDVDFLELAGKTDGYMPGDMVLLVSRARNEALIRSVQDISASSRAITLGA
FT                   DDFENAIKGFTPASLRNVTLTSSTTTFAGIGGLTETRKMLLETLQYPTKYAPIFAQCPL
FT                   RLRSGLLLYGYPGCGKTLLASAVAGECGLNFISVKGPEILNKYIGASEKSVRDLFERAQ
FT                   AARPCILFFDEFDSIAPKRGHDSTGVTDRVVNQLLTQMDGAEGLSGVYVLAATSRPDLI
FT                   DPALLRPGRLDKSLICDMPNHADRLDIIRAVSEKLAMNEEVAARLDEVAARTEGFSGAD
FT                   LQAVVYNAHLEAVHDALGDHSVNDKSTAKNGTKSSSTATSTKSFIQFLYSASEQEAGKV
FT                   SMPSPAVVASKLDAIKSARRRQRQSEQGTANNTQTAAPNGTAQEEPREEIIVRWEHMER
FT                   SLNTTRSSLSPTERRRLEGIYREFIFGRNGEMPTGEGSQEIGGRTSLM"
FT   mat_peptide     join(complement(1111365..1111598),
FT                   complement(1111238..1111316),complement(1107974..1111185))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V4 "
FT   sig_peptide     join(complement(1111667..1111777),
FT                   complement(1111599..1111604))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V4 "
FT   CDS_pept        join(1112266..1112580,1112634..1112764,1112813..1114730,
FT                   1114793..1114852)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902892"
FT                   /orf_name="An16g04890"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42916.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008050"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI0000EFCF7E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V5"
FT                   /transl_table=1
FT                   /translation="MALNAYTLNVNYEAQLDAFKDFLKHFKSFESASESAATEAIEDLR
FT                   IDEDGTSDEYDFMDDVAQEGGAQRAGRRRREPKLKYMQVLQEVADRERTNILIELDDLA
FT                   TYEKGLSEDEDLRLVDSVQKNTYHYIDLFSRAVDALMPKESKEITFKDDVLDVIMSQRE
FT                   KRNEAMNMAAEANADADAAQSIFPPELTRRYTINFKPLTPSGSSSDRQSKALAVRNVSA
FT                   EHIGGLITVRGITTRVSDVKPAVEINAYTCDRCGCEVFQPVTTKQFLPMSECVSEECKT
FT                   NNSKGQLFLSTRASKFVPFQEVKIQEMADQVPVGHIPRTMTIHCHGSLTRQLNPGDVVD
FT                   IAGIFLPTPYTGFRAIRAGLLTDTYMEAQHITQHKKSYNDTAMDSRTLRKIDQYQKSGN
FT                   MYEYLSRSIAPEIYGHLDVKKALLLLLIGGVTKEMGDGLHIRGDINICLMGDPGVAKSQ
FT                   LLKYIAKVAPRGVYTTGRGSSGVGLTAAVMRDPVTDEMVLEGGALVLADNGICCIDEFD
FT                   KMDDSDRTAIHEVMEQQTISISKAGITTTLNARTSILAAANPLYGRYNPRVSPVENINL
FT                   PAALLSRFDVMFLILDTPSREADEELASHVTYVHMHNKHPEHEDAGVMFTPQEVRQYIA
FT                   KARTYRPVVPSAVSDYMVGAYVRMRKQQKKDEAEKKQFSHVTPRTLLGVVRLSQALARL
FT                   RFSNEVVTEDVDEALRLVEVSKASLANDGQSGLDQSPTSKIYYLIRSMMESGAAAVGDG
FT                   DGSELSMRRIRERVLAKGFTEDQLNVTIDEYENSNVWQVLGGGTRLVFVDAMDM"
FT   CDS_pept        join(complement(1115303..1115649),
FT                   complement(1115025..1115076))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163127" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15902893"
FT                   /orf_name="An16g04900"
FT                   /protein_id="CAK42917.1"
FT                   /db_xref="HOGENOM:HBG328570"
FT                   /db_xref="InterPro:IPR013091"
FT                   /db_xref="UniParc:UPI0000EFCF7F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V6"
FT                   /transl_table=1
FT                   /translation="MHLPTTTFVFLLTSTLTLASPNPSPPTCGTCNPLSGENHCDVTTS
FT                   CINTGTRFHCACRAGYKASRQNNDITKQFRLNVPGYQFLVFTPEFTQCDTLCDNPYGAS
FT                   AQLCSEVPIYGRYSIMHVVLLDYSMPFI"
FT   mat_peptide     join(complement(1115303..1115592),
FT                   complement(1115028..1115076))
FT                   /db_xref="UniProtKB/TrEMBL:A2R7V6 "
FT   sig_peptide     complement(111559