(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_13

ID   ASPNC_13; SV 1; linear; genomic DNA; GRV; FUN; 594599 BP.
XX
AC   AM270996_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 18)
XX
DE   Aspergillus niger (strain CBS 513.88 / FGSC A1513) chromosome 5L,
DE   complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus niger (strain CBS 513.88 / FGSC A1513)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Aspergillus.
XX
RN   [1]
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A.E., van den Berg M., Breestraat S., Caddick M.
RA   X., Contreras R., Cornell M., Coutinho P.M., Danchin E.G.J., Debets A.J.
RA   M., Dekker P., van Dijck P.W.M., van Dijk A., Dijkhuizen L., Driessen A.J.
RA   M., d'Enfert C., Geysens S., Goosen C., Groot G.S.P., de Groot P.W.J.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.T.W.,
RA   van den Hondel C.A.M.J.J., van der Heijden R.T.J.M., van der Kaaij R.M.,
RA   Klis F.M., Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X., van
RA   der Maarel M.J.E.C., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N.M.E., Ram A.F.J., Rinas
RA   U., Roubos J.A., Sagt C.M.J., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J.J., Wedler H., Woesten H.A.B., Zeng
RA   A.-P., van Ooyen A.J.J., Visser J., Stam H.
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88.";
RL   Nat. Biotechnol. 25:221-231(2007).
XX
CC   This Genome Reviews entry was created from entry AM270996.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..594599
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88 = FGSC A1513"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 5L"
FT                   /db_xref="taxon:425011"
FT   CDS_pept        join(789..1242,1298..2548,2606..2955)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000250947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890631"
FT                   /orf_name="An17g00010"
FT                   /product="Catalytic activity: RCH(2)NH(2) + H(2)O + O(2) [ "
FT                   /EC_number="1.4.3.6"
FT                   /function="copper ion binding"
FT                   /function="primary amine oxidase activity"
FT                   /function="quinone binding"
FT                   /biological_process="amine metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK47131.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0008131"
FT                   /db_xref="GO:0009308"
FT                   /db_xref="GO:0048038"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG325455"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR015802"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="UniParc:UPI0000EFCEEF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R940"
FT                   /transl_table=1
FT                   /translation="MVLERLQQLTHQVQATSPPPHPLDPLSTVEIDTAVALIRKEYGKV
FT                   NFNAVTLYEPRKAEMMAWLENPQKAPRPTRAADIVAIAPGGKVYDGIVDLDNKKILRWE
FT                   HTPGVQPLITMEDLQEVESIVRQDPKVIEQCAIIGIPKEEMHKVYCDPWTIGYDERFGN
FT                   GVRLQQALMYYRPHIDDSQYTFPLDFCPIFNAETKQVIHIDIPPVRRPISKAPPNNYHP
FT                   ASIEKDGGYRTDIKPIHITQPEGVSFGINGRTIDWQKWNIHVGFNYREGIVLNNITFND
FT                   NGNVRPVFYRLSLAEMVVPYGNPEHPHQRKHAFDLGEYGGGYMTNSLSLGCDCKGAIHY
FT                   MDAAFVNRAGASTIIKNAICIHEEDAGILFKHTDFRDESVIVTRGRKLVISHIFTAANY
FT                   EYCVYWIFHQDGTIQLDIKLTGILNTYAMNPGEDTKGWGTEVYPGVNAHNHQHLFCLRV
FT                   DANVDGPNNTVFQVDATRSEAEVGSAENPYGNAFYAKKTKFTTPLEAMSDYDGNTSRTW
FT                   EIANTNKLNPHSKKPVCYKLVSREVPPLLPKEGSLVWKRAGFARHAVHVTKYSDDEIHP
FT                   AGRHVPQTSGEPSHGLPAWIEAAGPNSSIENTDVVLWHTFGLTHFPAPEDYPIMPAEPM
FT                   TLLLRPRHFFARNPALDVPPSFARTPSQVAAGTGACSSCKKSDGSSVQV"
FT   CDS_pept        join(4214..4746,4927..5138,5321..5618,5771..5903)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810125"
FT                   /orf_name="An17g00020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK47132.1"
FT                   /db_xref="UniParc:UPI0000EFCEF0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R941"
FT                   /transl_table=1
FT                   /translation="MMPLSKGMYYFVDNIVEVTADMMNAAFQSVDILEYYGLPDGENEY
FT                   IPIDRRGHGAIAWCCRTCYAGIFMLRLYDRVGLIEHPSLKHSVLSSHELLQRFGQFRRM
FT                   VTIHIGLRRTLHSKVCLTRAAETEDLLFCASETLRSTEVKSLTRDKTQCIFYFSASIPL
FT                   GNILTNSLAQDHFDRLTKRCTVSSAYVAAIYATKIFESSLASLQSNRETHGQTSYKTTP
FT                   TNFPIVQCDRLPDSITFRRYQDEGTMERNALEESRTQRPEPSKPNMGIRDCRDHQHVPK
FT                   GSWLRPGKKTHSLKSSLSGSGSRAEKYYEVRLFESNKDCFIIHNNESTTAGLVVDVSGS
FT                   TSWRQLDESRESGNVTLKLSVLTIEFSLRASVCIQCHVAGMNEQDSVRSGE"
FT   CDS_pept        join(6404..6694,6752..6883,6915..7235)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890632"
FT                   /orf_name="An17g00030"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /protein_id="CAK47133.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000EFCEF1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R942"
FT                   /transl_table=1
FT                   /translation="MGAWSVICARKLVRSSSSMELLSFAQQTRYEPVCCLPAPLPVIYL
FT                   CRPLLITLLVIWQGPAVWRLWRIWCAQVTKGAILADAVGLGKTIEFIAFILTVARDKRK
FT                   KLQAGEKFTTKPTLIVVPPHLLDQWSSELRKLSNKLDTGSSLYVKNKLTKKHPMFQPDF
FT                   DGRYSMVLTTYNTLEKRHGLSAVSEWHKNKYSEKYKPTESIRSDFPHSLGGCFDLVICD
FT                   EAHYLRNRTSGNTAGLSELHIVYDQ"
FT   CDS_pept        join(8186..8287,8441..8827)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890633"
FT                   /orf_name="An17g00040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK47134.1"
FT                   /db_xref="UniParc:UPI0000EFCF22"
FT                   /db_xref="UniProtKB/TrEMBL:A2R943"
FT                   /transl_table=1
FT                   /translation="MATAGFLRALMVFGSLEVSNLASAGLHGDPLLFRAELGKIQRFRV
FT                   LCVDQFRNLILTSRQANDSENAVVRQCFCSYTWVISSAVNPVHNTSILMFDGAAHSSLR
FT                   QGIMYEEIPFLQDFNVTLVVHIIFTGHTDCQAIFRQNLEKTLHCPPTVRFEAELLWAS"
FT   sig_peptide     8186..8257
FT                   /db_xref="UniProtKB/TrEMBL:A2R943 "
FT   mat_peptide     join(8258..8287,8441..8824)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R943 "
FT   CDS_pept        join(complement(9560..9580),complement(9388..9488),
FT                   complement(9273..9332),complement(9086..9167),
FT                   complement(8923..8997))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657463"
FT                   /orf_name="An17g00050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK47135.1"
FT                   /db_xref="UniParc:UPI0000EFCF23"
FT                   /db_xref="UniProtKB/TrEMBL:A2R944"
FT                   /transl_table=1
FT                   /translation="MTGWDCKVDEQKQEGHIEMNSPVTEKVFVSMKCSRALDSTLANDN
FT                   ANVESGIFVWRSAQFSLGTCGVSFHPGFFMHSAQGIWYSFVTEEVNIQLGEIHSSAAHQ
FT                   PAYAGLMD"
FT   CDS_pept        join(10955..11031,11120..11236,11309..11492,11537..11889,
FT                   11932..12271)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890634"
FT                   /orf_name="An17g00060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK47136.1"
FT                   /db_xref="UniParc:UPI0000EFCF24"
FT                   /db_xref="UniProtKB/TrEMBL:A2R945"
FT                   /transl_table=1
FT                   /translation="MGQWAKGPPTYTLETIAAELVFVCTCNTGTAPVVKNPWSDHAQSI
FT                   RAVMFELTLSSTTAVPLTPDLASSHQPSLFARLYSSRGLFMCGPYPFHSRLHHASQLPS
FT                   SSDSSGHMPLWAMLSSIDSKELMSDLRGPSIVTTWSVVIQQDVVHLRVLLAGCHIFVIY
FT                   RPNLKALTRYCFFIKLALPAFAGILLDLDIYSPILRRSSYPHVTLCYKDDWGRPYKPSF
FT                   TGTSTQMPRLHTITTVFFNDLRKCGDYYGLSILFTKQKHSVTRDGPGYLSYVPLRDGYL
FT                   RRWKRGIRSEITTLCALSVEAKPFLWNKGELRRHNLNPALALYRHGESYRAIYSLSLAA
FT                   IQQLDPSWKKFLKPRL"
FT   CDS_pept        join(13437..13867,14151..14349)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657464"
FT                   /orf_name="An17g00070"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK47137.1"
FT                   /db_xref="UniParc:UPI0000EFCF25"
FT                   /db_xref="UniProtKB/TrEMBL:A2R946"
FT                   /transl_table=1
FT                   /translation="MRAAANKGARLVEAIQFMEDIKGWDTAVAGVCTIAEQALRGKPNS
FT                   IEEFNGMPRSSRREYTRKAGELHSKVSAITERNWMAIGAHLSAELITKLTFSKKVKAFA
FT                   EFPEAEQGTTIRRLNQKVYKRCAAPPGIGRNRDPVSTMQLSSQYSSCSVLRSRGRNETR
FT                   RLRPDTMFNRRRRDVPFFKSLAGAHDLQVMEMGARGSGIVWASQRS"
FT   tRNA            15286..15357
FT                   /gene_name="tRNA-Glu (CTC)"
FT   CDS_pept        join(complement(15855..16421),complement(15549..15566))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172768" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963308"
FT                   /orf_name="An17g00090"
FT                   /product="Similarity to translocation protein Sec72 -
FT                   Saccharomyces cerevisiae"
FT                   /function="binding"
FT                   /protein_id="CAK47138.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG329028"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0000EFCF26"
FT                   /db_xref="UniProtKB/TrEMBL:A2R947"
FT                   /transl_table=1
FT                   /translation="MASIDLFTQYPLHLDPTSKAISLSNTTTTPLPTPTSTITTELTHL
FT                   NALHRSLISLDPPNIPPPPLPINPKRSAQITKLRDSANTAYRKSNHAEAARLYTYAIDM
FT                   ALGRPGWEPVTLARDELAGLYANRAQAWMSQRAWPEGLVDARCSVESKPVANVKAWWRG
FT                   GRCLVEMGRWEEAKGFAEKGLEIEGRKEAAM"
FT   CDS_pept        join(complement(17886..18512),complement(17744..17838))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890635"
FT                   /orf_name="An17g00100"
FT                   /product="Putative frameshift"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAK47139.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="UniParc:UPI0000EFCF27"
FT                   /db_xref="UniProtKB/TrEMBL:A2R948"
FT                   /transl_table=1
FT                   /translation="MERPLLYPGNPEWVTSIECINSTGWALPPCIIFKGKVHIEGWYQD
FT                   SKISRDWRIEVSPNGWTTDKIGLRWLKNLFIPATISRTTGKYCLLILDGHGSHLTPHFD
FT                   QICSEKDIIPICMPAHSSHKLQPLDMGCFKSLKDAHGYLIAENIRAGLNHYVKLGFLKA
FT                   FPQAHAIAFNAKTVQISFAGAGLIPLDPDRILSELNILKTPTPPGTGKASIYCEKAPSS
FT                   TYAEPTIFTRSAIRQDY"
FT   mobile_element  complement(18113..18493)
FT                   /mobile_element_type="transposon:Vader"
FT                   /locus_tag="An17e00110"
FT                   /note="Remark: Vader is flanked by 44 bp inverted repeats
FT                   (IR)."
FT   CDS_pept        join(complement(20700..20825),complement(19741..20629),
FT                   complement(19221..19678),complement(19014..19160))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890636"
FT                   /orf_name="An17g00120"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK47140.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG330720"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCF28"
FT                   /db_xref="UniProtKB/TrEMBL:A2R949"
FT                   /transl_table=1
FT                   /translation="MSSSPDAMFRAQPVGSVKLYSILAGIMIATFLISLDVSIIATAIP
FT                   SISTHLHATTDIGWYGATYPLTMCALQPISGKLSSLLSLRWTYLGFYGIFLLGSLICGV
FT                   ANSSEMFIIGRAVAGAGGSGVVSGGLSVIALITTPQQRPLFTGLITSLYALGTVVAPII
FT                   GGALAEYTWRWCFLINLPAGAVTVVTLLLFFHPPQNTGAQRVSFLKQLDLIGCALFIPS
FT                   IIMVMLALQWGGGEYPWDSATVIGLFIGFAVMIAIFIFWECYMGDQAMIPIVLLRGRST
FT                   MLSIAFAFLFLGSFVIPVYYLPEWFQIVKSASPIRSGVMLLPSVCTQVFGSLVSGILAK
FT                   HLRYYNPWLLIGSAFLCIASGLYTTFTVSSTSASWIGYQIFQGLGCGFAAQIPLLTVQL
FT                   VLKDSPHYVPVGIATVLFTQYFGSAVMQSIGGAIFQNELKRQLQDQASLDYKQIEMLLN
FT                   TGTLRVREVAVQAFPDRLADIIIAYNKAITTIFYLPIAGSALAFILSSGIPWVNTRPTQ
FT                   EDDDMHCTEQTDKLQSDKQATV"
FT   CDS_pept        join(21182..21260,21298..21305,21462..22078,22127..22389,
FT                   22439..23043)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890637"
FT                   /orf_name="An17g00130"
FT                   /protein_id="CAK47141.1"
FT                   /db_xref="HOGENOM:HBG328903"
FT                   /db_xref="UniParc:UPI0000EFCF29"
FT                   /db_xref="UniProtKB/TrEMBL:A2R950"
FT                   /transl_table=1
FT                   /translation="MDGVNDVRDSTDTVLFQTARVGIQASGCRVPRVELSRITETPSPS
FT                   TISNTSLQPSPVPEPFDDFITRGLLNITEGEELLLKFRTDLMPLFPFVIIPEVSFVELR
FT                   KQSPFLLLCIITACLEHKPTLQQKLEFEARTVVSTRIVMNMERDMDLLRGLLVHIAWYH
FT                   YHWRIYHTQVYMLLQMAMAIVVDLGLDRYNNFKMQSISYNGKGAEELHKGQVLYLTPDG
FT                   QRAFLGCYYLCSKASIFRRQLTMKHTDWVEYCADSLGQRAEYPTDQSLKALIKIQSLAQ
FT                   QSELEFEDPIRAMSKDELFQSMDVLENQIEHLLVQETQCNTWSLRLELNAIPAIVLGHA
FT                   LRRQRDVHHQYEKQQLLAIARSAFNIVTVFLASPASVTPNLPMFSYTSIWYGLLVLSKL
FT                   SLLSDAATKGKAVEVYNRDIHNLGLAAMQKMEAMSRRNDVWDNCRAVIGSMLSWLESSR
FT                   IQPQSIQVRGDTSNTQDAENPHMLPQPIPEDPPRATESAAVVEDWDATVWQHMLQDLTW
FT                   IGSSSL"
FT   CDS_pept        join(23686..24803,24869..25199,25265..25616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890638"
FT                   /orf_name="An17g00140"
FT                   /product="Putative frameshift"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAK47142.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI0000EFCF2A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R951"
FT                   /transl_table=1
FT                   /translation="MTDTMNSFRRPIMRETTLGTNDLQLEYDGGAYVLREKHDAPEPHK
FT                   DYRTVQVEYSLLSAIKANDGYFFLCLGICQGTCEKVLCLSTDNSSIVSVPQSMLVTVDN
FT                   NDLIDAQFMSFVVADLVRQHILRLRPAVGTLLMYKPDPGLVSLLSGRTVGEGQSIVFTT
FT                   CKPSNAKRRNWIYVHERTPARTIDALIPRDVALIIDLSSTAASKYGLGTRIASLRPQAG
FT                   QKLGFSNLVHSTASPMSTPVPESIGLLLKQVSGFAQSQMNGVPDRAPLDTLTIGEAVTK
FT                   QLPESSLALIQWDPNQSVSVLVEPITVRNDLFRSDRTYWLAGLAGDIKQSLADFMIQRG
FT                   ARHIALSSRNPIICPEWQKLCQARGAHIKYFTCDLTQYASVRSTLSAIESKMPRIAGVA
FT                   NGALVLCDTPVATMSFMTSRLVLKPKVDGTVNLDSAFAHHALDWFIAFSSIVGTAGNMG
FT                   QAAYSAANCFMKALVNNRRRRGLAGTTDKEETERLMNRTGTIPMFEPDLHQLFAEAVVA
FT                   GLPGTAPGSELITGLAPIGMAQAETAFWAANPKFGLLVRDQTISLTVSTLGENGLSIAQ
FT                   VPVWIQLQDATSPQEVSTLIQGK"
FT   CDS_pept        join(26930..27059,27102..27260,27281..27822)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890639"
FT                   /orf_name="An17g00150"
FT                   /protein_id="CAK47143.1"
FT                   /db_xref="UniParc:UPI0000EFCF2B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R952"
FT                   /transl_table=1
FT                   /translation="MHCSNGSIIWLKKKIIWPLNEIFLLYSWLALVPRLHEPPTSLVRP
FT                   YFEDWTLAMHQKLDTNAGHYSTTILRKAYVTSRCEGDAQHHLAPRLRPESHRHADSPLK
FT                   NIFSDPNKERNARRQYNNLKIAPEDKFYTFISNFRYLAVEAGIDPDCWREDLYQRLPFK
FT                   LQELTISRFNDNEVDFDQYVEECARSADLIDEILKRCNCTGQTPSSGRRQSLNAPTTAN
FT                   RTSPAIKTEEAPSATSETNMDTETRNRLMNEGKCFRCQRPRISAVIVLTRNPYK"
FT   CDS_pept        28206..28502
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657465"
FT                   /orf_name="An17g00160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK47144.1"
FT                   /db_xref="UniParc:UPI0000EFCF2C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R953"
FT                   /transl_table=1
FT                   /translation="MPAPLNSSHPGAFVSGMLLRVSYVERFVPNVQDTIEKFIHEAEAR
FT                   FIEAINSLQAAKNSLQLIGPLSGMPGTLLSAQERHSGLVMGHRQLRSSAEGQS"
FT   CDS_pept        join(complement(30190..30345),complement(29766..30118),
FT                   complement(29319..29715),complement(29143..29287),
FT                   complement(28969..29039))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890640"
FT                   /orf_name="An17g00170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK47145.1"
FT                   /db_xref="HOGENOM:HBG328929"
FT                   /db_xref="UniParc:UPI0000EFCF2D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R954"
FT                   /transl_table=1
FT                   /translation="MRIARPSFNPGRTKNLIHGFQGFIIFLAWALTIAVFTKGGGIDGR
FT                   SAWYFALCWFSIPGLIYLVAVPMWPRARRFGNVYAFATVDCLYAILWFSAWVCVASYVA
FT                   EGKSKGKSDSSSDSSSSSSSSSSSSSRRDTSSSDSSSKSGCDNWAYGSASKCKVSTATV
FT                   ILGVVVFLLFCVTAFMSFRNVSHFRRTGTLPDAVSDPTFAAQTKAAFSSNPAHDFEEEE
FT                   DDFRSRAGIGSSVRGDRDEDYALLQQSEVDEFGNSHAARSALSGTYDPTVSGGSVLHDY
FT                   NTSYGGAHGQHYGGASEFGSSLVVFCVYLFETTMERCLWAHSCCITLLIEILREVLNCP
FT                   FLSAASTGDDYSICSVNVYGLCQFLAYLAKALL"
FT   CDS_pept        complement(32553..34139)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172746" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963309"
FT                   /orf_name="An17g00180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK47146.1"
FT                   /db_xref="HOGENOM:HBG328936"
FT                   /db_xref="UniParc:UPI0000EFCF2E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R955"
FT                   /transl_table=1
FT                   /translation="MAVGHPIRLRRALSTATTKSRSLSTPRFSILQLQVLVHLFRVALS
FT                   LALLPLDNTILLAAYAAGFFPFSLTDSNKAGARRRAAALRSSNFKPRTVLVTGIDTPYG
FT                   LAIARGWYYSGHRVIGAEVVGGDESGVACGESMSRVLSGYYRINSTTSASTATKGYAAQ
FT                   LLDVVMKENVDVWIPCCEETEGEEDAVAKGVIEARTGCKCVTLDRGMADILSQSSSNRE
FT                   AFLAFLVEKGLPVVERHEVLSRDAVHKILHRSPTKVWNMRRADEREVMLPKRTLSLTYS
FT                   EVSEIRISRERPWMLQQQTRLGGFYAEMAVVAGKVKATKIYPAEEDGDGGWGQSPMDRG
FT                   LATAIQALMERFASQMGARLTGHLRLKVMVDEEVSDNSLRYVILIDSCTHGASAVKYLI
FT                   LEDDLKTLVDGYLEALTPQTNGVAEGEAVMNGTAGAASASASLKADITTPPPRQRFSLF
FT                   RTAKKANVKVFGSLGKQVDRALHEGSKLLFFWKNQKFSQLDPLPWWWHAHVYQPLRELE
FT                   MIVKPKRVKRA"
FT   CDS_pept        join(complement(36056..36167),complement(35801..35956),
FT                   complement(35603..35673),complement(35338..35502))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890641"
FT                   /orf_name="An17g00190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK47147.1"
FT                   /db_xref="UniParc:UPI0000EFCF2F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R956"
FT                   /transl_table=1
FT                   /translation="MESREQISDAIPSRVAEALVHDIAKPRAVGDGYHIGPVGIGNVSP
FT                   HLGDSDGRVRRPMWARIMHGGVQNRNRETMELPLQQYRTGGPAPALTPTLKPEPVQATP
FT                   RSTSTPPQLGSRLAHEHAMVSAKVRAPYRIYPFVRIRRRPWNLRRTIGNVTVRLLHWVY
FT                   CEQL"
FT   CDS_pept        join(36399..36452,36514..37329)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114343"
FT                   /orf_name="An17g00200"
FT                   /EC_number="2.1.1.6"
FT                   /function="catechol O-methyltransferase activity "
FT                   /protein_id="CAK47148.1"
FT                   /db_xref="GO:0016206"
FT                   /db_xref="HOGENOM:HBG328951"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="UniParc:UPI0000EFCF30"
FT                   /db_xref="UniProtKB/TrEMBL:A2R957"
FT                   /transl_table=1
FT                   /translation="MGDSATPEAPSHPPVERSREDGRERKLLHFIYDQPNRDEIQGNPA
FT                   KVLDLIEEFGKTYHFMNIGRAKGKFIIDIIEEKKPEVMIELGGYVGYSAILFGDAVRRA
FT                   GGRHYYSLELNPEFAAIANMLLELAGLRDFVTILVGRSDLSLDKLFSSGHVKHVEVMLI
FT                   DHYKPAYTADLKLCEQLGKIVPGVSVVVADNVLYPGNPPYLEYVRSTVEQKREAAKKGP
FT                   VQAYDTTNLPQRSVGSFMPADATPSFELTGNPNLVYDSKLVKPETTRVSLPGISEERGG
FT                   NFTDMRVL"
FT   CDS_pept        join(37743..38025,38094..38189,38252..38655,38725..38812,
FT                   38869..39080)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227438" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890642"
FT                   /orf_name="An17g00210"
FT                   /product="Similarity to A. niger EST sequence BE759508 in
FT                   EMBLEST"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK47149.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG322267"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCF31"
FT                   /db_xref="UniProtKB/TrEMBL:A2R958"
FT                   /transl_table=1
FT                   /translation="MASKTWNVGIVGYGFSAKTFHIPFIQEVPQFKIAAVVQRTPKPDD
FT                   DAEKDHPGIKSYRTTEEMVKDEGLQVVVITTAPDSHYALAKLALENGKHVVCEKPFTPT
FT                   TQEADELVALAKKQNKLLAVYQNRRWDADFVTLSKLVKNGSLGRVVEFETHFDRHRPQE
FT                   PSPDVSKWKNKVIPGGSAIYDLGAHLLDQAVHLLGKPERVTGFIGSQREVNTSGFEDSF
FT                   TVLLHYPKGVLVTAKAGVVSPEEEQLRFWVRGEKGSFKKFHLDVQEEQLKAGVKPGDSG
FT                   YGREPSERYGTLTTIQDGKPVKEVMPTVEPPTWTEYYRKLARALGGEGDLPASGAEARE
FT                   VIRLIELAQESSKQGKTLDV"
FT   CDS_pept        join(39401..39457,39565..39858)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890643"
FT                   /orf_name="An17g00220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK47150.1"
FT                   /db_xref="UniParc:UPI0000EFCF32"
FT                   /db_xref="UniProtKB/TrEMBL:A2R959"
FT                   /transl_table=1
FT                   /translation="MFLGNPRLIDDCSSLGGNEASDLIVSCPDAKPEAEFPLPNANIMS
FT                   GRKMSWTSQQKGVFPFFPGHQWPSPTQRCIPALCPLSSAEILVVTMYESSFCVPTFPPS
FT                   SQCWPDGPILVF"
FT   CDS_pept        join(40071..40113,40210..40574,40643..41221)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172835" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890644"
FT                   /orf_name="An17g00230"
FT                   /product="Similarity to hypothetical protein slr0789 -
FT                   Synechocystis sp."
FT                   /protein_id="CAK47151.1"
FT                   /db_xref="HOGENOM:HBG397776"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniParc:UPI0000EFCF33"
FT                   /db_xref="UniProtKB/TrEMBL:A2R960"
FT                   /transl_table=1
FT                   /translation="MAIGQNLHLSFLLEWWRAVLRALGLSGLVAGSTEAMSAQNPQSAS
FT                   MLQRIDFSRLHVDIDAFLNPYLPPPPWRHLPRPISRFFGYRKTLAPKPLGNLVIAFWSL
FT                   IGVFCGVLVVAEVSEHIPSFQAHHAPIIVASFGAAAVLEFSAIESPFAQPRNAVLSQIV
FT                   ASFVGVAIGKLFALNENAHSMPQVGGALACAITTAIMTITNTVHPPAGATALLAVTQSY
FT                   DVGWYLILIMLLGCVLMQAVALVINNIQRRFPIYWWTPQSLERPKPDDTESAREAKEGS
FT                   VASVQTNDTFPGVPTHIVIEKGSVMLPDNVTVTEQEMVVLKRISERL"
FT   sig_peptide     join(40071..40113,40210..40271)
FT                   /db_xref="UniProtKB/TrEMBL:A2R960 "
FT   mat_peptide     join(40272..40574,40643..41218)
FT                   /db_xref="UniProtKB/TrEMBL:A2R960 "
FT   CDS_pept        join(42234..42806,42872..44140)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114344"
FT                   /orf_name="An17g00240"
FT                   /product="Similarity to many A. thaliana patent EST
FT                   sequences"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="CAK47152.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0000EFCF34"
FT                   /db_xref="UniProtKB/TrEMBL:A2R961"
FT                   /transl_table=1
FT                   /translation="MVSASKAARLAKRAADGDKKKATKGKKDDPVVDGEAGDDQPATTD
FT                   EKMKEVEKLTAQMDKHGLSDRVTTGVLASLPSSRDVKVTSASLVFHGKVLITDSTLELN
FT                   FGRRYGLLGENGCGKSTILKSIATREYPIPEHIDIYLLNEGAPPSELGALEWVVTEAQN
FT                   QLDRMEKQAEELLETEGPDSPILEDLYDRMDKMDPSTFHTRASLILTGLGFNKQTIHKK
FT                   TKDMSGGWRMRVALAKALFVKPSLLLLDDPTAHLDLEACVWLEEYLKKWERTLILVSHS
FT                   MDFLNGVCTNMIDMRMKQLLYYGGNYDSYHKTRAEQETNQMKAYNKQQEEIAHIKKFIA
FT                   SAGTYANLVRQAKSRQKILDKMEADGFIQPVIPDRVFSFRFADVEKLPPPVLSFDDVSF
FT                   SYSGKWEDTLYEHLDFGVDMDSRTALVGPNGVGKSTLLRIMTGKLSPIGGRVSRHTHLK
FT                   LGMYSQHSAEQLDLTKSALEFVRDKFPEKSQDYQYWRQQLGRYGLSGEAQTALMGTLSE
FT                   GQKSRIVFALLAIESPNMILLDEPTNGLDIPTIDSLADAINAFSGGVVVVSHDFRLLDK
FT                   IAKDIMVCENKTITRWDGTIGEYKNHLRKKMISEGAV"
FT   gap             45075..45174
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(45394..45726),complement(<45177..45332))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197843" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890645"
FT                   /orf_name="An17g00250"
FT                   /protein_id="CAK97385.1"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="InterPro:IPR015432"
FT                   /db_xref="UniParc:UPI0000EFCF35"
FT                   /db_xref="UniProtKB/TrEMBL:A2R962"
FT                   /transl_table=1
FT                   /translation="MIEDEIYRSSSQFRLWSFTEASLKQLRATTNSVASDRVRAALRRA
FT                   QEARRSATSSTTGTPAPGSDAENKATEEKQIECLTPEEEQQVVDYYSEQIIQLGENYKP
FT                   PLPTIVRATAIQYLRRFYLTNSPMTYHPKQIMPCALFLATKTDNYYLSLRQFAEGVPGQ
FT                   "
FT   CDS_pept        join(complement(46852..47112),complement(46479..46783),
FT                   complement(46252..46426))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114345"
FT                   /orf_name="An17g00260"
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAK97386.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015368"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000EFCF5B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R963"
FT                   /transl_table=1
FT                   /translation="MSANRARRIAKEIADIHADTQSQITAEPLHGGEDLTHLRGTFPGP
FT                   PGTPYEGGTYTIDIKIPNDYPFRPPHMKFVTKVWHPNVSSQTGAICLDTLSTAWSPVLT
FT                   IKSALLSLQSLLSTPEPKDPQDAEVATMLLRRPQEFARVAQEWAVMYAGAPRRHAGEGS
FT                   GGVTDETLRLQEIKSKEEQEQEDLSKYDGYNKDLIDRFCNMGFDVERVVAAFKYYGIDR
FT                   MDGEDYELEEAYMGDITARLLGEP"
FT   CDS_pept        join(48101..48103,48182..48247,48312..49380,49430..49683)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963310"
FT                   /orf_name="An17g00270"
FT                   /product="Complex: the S4 chain is a component of the 26S
FT                   protease multiprotein complex"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="peptidase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK97387.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0000EFCF5C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R964"
FT                   /transl_table=1
FT                   /translation="MGNQQSNIGGGPGGDGRDEKDKKKDKPRYEPPPPPTTRLGRKKRK
FT                   AAGPSTASKLPDIFPTSRCKLRYLRMQRVHDHLLLEEEYVENMERLRKTKAQAALDSAN
FT                   RNDLDIMDRNADERSRVDDMRGSPMGVGNLEELIDDDHAIVSSATGPEYYVSIMSFVDK
FT                   DLLEPGASILLHHKSVSVVGVLTEESDPLVSVMKLDKAPTESYADIGGLETQIQEVRES
FT                   VELPLLHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKY
FT                   LGDGPRLVRQIFQVAAEHAPSIVFIDEIDAIGTKRYDSTSGGEREIQRTMLELLNQLDG
FT                   FDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDQNTKKKIFTLHTSKMSLGDD
FT                   VDLDEFINQKDDLSGADIRAICTEAGLMALRERRMRVQMDDFRAARERIMKTKQDGGPV
FT                   EGLYL"
FT   CDS_pept        50092..51870
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172867" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114346"
FT                   /orf_name="An17g00280"
FT                   /protein_id="CAK97388.1"
FT                   /db_xref="HOGENOM:HBG407789"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0000EFCF5D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R965"
FT                   /transl_table=1
FT                   /translation="MDGFDEEAFKKFFPTSFGKQEKKADVSSQIDRTKRAEVSVNPDGD
FT                   GKKAGSIGETTTEAIPAAEEDNQKNDSESDDGSDDSDDDSDDEDEFPVSHELTLKTHDR
FT                   AVTTLTVDPAGSRLITGSTDCTIKLHDFASMTPSTIRAFKSVDPSAKKQSAAQEAHAVH
FT                   YAAFNPLSPSYVMVVSATPQPRILSRDGDTITEFVKGDMYLRDLHNTKGHISEVTGGVW
FT                   CPTDENLCATAGTDSTVRIWDANIGRSQKEVIVHKSKMAGSAGRSKMTAVAWGSPKQGG
FT                   PNVLVAAALDGSLLMWSGNGPYTRPSAEIRDAHTKDTWTSGIDISSDGRLVITKGGDDT
FT                   IKLWDTRKFKQPITTVAHPSSTRYPSSNIIFSPTSANVLTGSETGHLHILNPATLKPEL
FT                   VTPVTPGSPLISVLWHEKMNQIITGSANAETHVLYNPNMSTKGAALIMSKAPKRRHIDD
FT                   DPSLTMDLTQGISGDSVVVGSNGVPHYSSSTWSARHPTIGLTASGRPRDPRRPHLPAQT
FT                   PFAKSQPDEKHIRENIPLSSMRDEDPREALLKYADKAEKDPVFTRAYKETQPTPIYRDI
FT                   SDDENEQGPDKKRTKR"
FT   CDS_pept        join(52927..53213,53514..53941,54015..55513)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810126"
FT                   /orf_name="An17g00290"
FT                   /protein_id="CAK97389.1"
FT                   /db_xref="HOGENOM:HBG328989"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniParc:UPI0000EFCF5E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R966"
FT                   /transl_table=1
FT                   /translation="MAYLHEVPLAAGLLTALASSAVPTPTPTPYHYFPSSSQPSPTFTS
FT                   SPGSDNGDGGSGGGMHEWSSLIGIVTALAGNVLISLALNIQRYAHIRIDKDERLRRKSY
FT                   LRSPYWWVGIVLMSLGEVGNFMAYGFAPASIVSPLGVVALISNCVIAPFMLKEKFRQRD
FT                   LWGVLIAIAGAVVVVLSAKSSEEKIGPHDIWEMITRWEFELYLGVSAVLIVGLMWASGK
FT                   YGSRSILIDVGLVALFGGYTALSTKGVSSLLSFTLWHVITFPVTYLLVFVLVFSALMQI
FT                   RYINRALQRFDSTQVIPTQFVLFTLSVIIGSAVLYRDFESYTAERACKFVGGCVLTFMG
FT                   VYCITSGRVRADNESTFSIDDEEEAIGLLGGDRYHDRVDMSPPAPQARAHKTGRRARTP
FT                   ADDHLQSPSGSLLSHGIEDVDDDQRTPRGVLSAAPSSPRGSLTAESLEQPSSEPSSPMH
FT                   ARSLLTNPWADSLESAIQPPNAEPPVHRPATPPAQSELTAHDSPFLLRFPPAPGAEDAP
FT                   EGPIPGHGRTPSNVRKAIVPQTPPARHLRNSISKFSPGPLLPTISAGFSAVVAETLRRG
FT                   EISPNKGRRLRHRMDRRKQLSTTVLEGFPRQRNGDARGGEYEADGNLENAHDLGFPLST
FT                   SRLPGTGALATAPVSTGDLTPAVDSEDGPISQHEDNTTSLSRLRSLSDSWSGGLAWLGG
FT                   VLHKPGANRGSEATTSIQENEGEDGAESQGNQEGQGTGAGTRA"
FT   sig_peptide     52927..52989
FT                   /db_xref="UniProtKB/TrEMBL:A2R966 "
FT   mat_peptide     join(52990..53213,53514..53941,54015..55510)
FT                   /db_xref="UniProtKB/TrEMBL:A2R966 "
FT   CDS_pept        join(56471..56648,56755..56847,56896..57003,57063..57139,
FT                   57193..57300,57357..57535,57585..57653,57707..57922,
FT                   57971..58578,58658..59438)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890646"
FT                   /orf_name="An17g00300"
FT                   /product="Putative frameshift"
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK97390.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EFCF5F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R967"
FT                   /transl_table=1
FT                   /translation="MVAGLVAKALLLLQLGSGVVAAQNASRPLYKNPHAPVEARVSDLL
FT                   SRMTIEDKMSQLMQGDVGNWMDSTTGAFNYTGLVENMEMKAGAFYVGYAVPWDWLATNI
FT                   KRAQDYLLQNTTLGIPALVQTEGIHGFLLENATIYNSPIAYACSFNRELVEKMGRLIAQ
FT                   EARAIGTTQLFAPLADLARELRYGRVEETFSEDSYLAGEMAYHYIVGLQSLNVSATVKH
FT                   FVGYSLPEQGLNTAPVQGGERYLRSTWLPSFKRAIVDAGAWSIMSAYHAYDGIPAVADW
FT                   FTLTKILRQEWNYDYYVISDSGATDRLCTAFKLCRSSPIDMEAVTTQALPAGNDVEMGG
FT                   GSFNYQKIPELVESSQLDIEVVNTAVSRVLRAKFEMGLFENPYPAAPQSEWNKLIHSPE
FT                   AVELARTIDKESIVLLENHNETLPLKKSGNIAVIGPMAHGFMNVRPQYLLLPRANAQMP
FT                   SIMLTTSVRRLRDLRQPMARVTPLDGIKAAVGDAATVNYAQGCERWSNDQSGFDEAIAA
FT                   AKKSDVAIVVVGTWSRDQTELWENYNATTGEHVDLDSLALVGAQGPLIQAIRDTGVPTI
FT                   VVLSSGKPITDVTWIANSTSALVQQFYPSEQGGNALADVLFGDYNPSGKLSVSFPHYVG
FT                   DLPIYYDYLNSARNIGDAGRAYPNGTLEFGHQYVLGDPHAVYPFGYGKSYSTFEYSDIK
FT                   VSKTNVSASDTVTVGLEVKNLDESREATEVVQVYVVDEIASVVVPNRLLKGFEKVVIPA
FT                   GGSKSVSIDIKVEDLGLWNNKMEYVVEKGEFGVLVGSSSVDIRGRVAFWVV"
FT   sig_peptide     56471..56536
FT                   /db_xref="UniProtKB/TrEMBL:A2R967 "
FT   mat_peptide     join(56537..56648,56755..56847,56896..57003,57063..57139,
FT                   57193..57300,57357..57535,57585..57653,57707..57922,
FT                   57971..58578,58658..59433)
FT   CDS_pept        join(complement(61651..61674),complement(61465..61590),
FT                   complement(59691..61394))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810127"
FT                   /orf_name="An17g00310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97391.1"
FT                   /db_xref="HOGENOM:HBG328991"
FT                   /db_xref="UniParc:UPI0000EFCF60"
FT                   /db_xref="UniProtKB/TrEMBL:A2R968"
FT                   /transl_table=1
FT                   /translation="METAPLTLAHTHARNAVLETRKSNPVAASEEHDLAAGEFATAAQN
FT                   SSDKEALRTLHLLEQHHKKLAQILRIQHENPPSNADTGANAQLSTESGARASPSTTDPQ
FT                   HLPRLSGHPRLPSRESSSIASNLASARGIPAHRASPASPTIAPQQAGAKMTDGPSKIRT
FT                   SESRLRGTAQMQGMRERERERERHRTPASARQPWIPPTPSPTDITSQQYAPAEPSEPSR
FT                   PRASLTEEPFQKFYSTFEGLISKISAPLAFAGLPLGTDPSSTQPSTSRKSAPDTKTDRY
FT                   NAVPDRTAEPDINKLFSRAALQAIKDNTGGAGGGTGSAAESFYVVPTTGGTVSYAGILT
FT                   RAEKEARRSSFEDAAEEDFVDARETPPSPELRQSLSGAAAAPMGSKAAARNNNTSQSEK
FT                   FSRLTQNPKTMEELQMENQALRHLSDTLSKRLHMWEVNAQSSSMALQQSLRAMHHTQNV
FT                   PSLDQPHNQSQGSSPVTTTGGGGVGGGGISSPPVPATDYDQRIKDLEEMVRRGEKELGK
FT                   VGRENDKLRDVLGRYRERWEKLKEGAKSRRAGATGTAAAGATTSAGAPGATTRPGSSSR
FT                   RSSTQQGVADTEDGSSKAGGGETTTTTENADTSNGEREGSD"
FT   CDS_pept        join(62753..63195,63264..65866,65918..66630)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172890" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657466"
FT                   /orf_name="An17g00320"
FT                   /product="Similarity to hypothetical membrane protein
FT                   YDR326c - Saccharomyces cerevisiae "
FT                   /protein_id="CAK97392.1"
FT                   /db_xref="HOGENOM:HBG328993"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="UniParc:UPI0000EFCF61"
FT                   /db_xref="UniProtKB/TrEMBL:A2R969"
FT                   /transl_table=1
FT                   /translation="MEANPIPEPPPVPDTDVPSISKVNRTKTTPVDLETMGSSSRSNGR
FT                   SSIDSTSDRPKSQAGEADSAKAGSSGFSKLLAARRKKKKDKNQKQSDESSTQLDTESSK
FT                   DVQESRSTESRDGLSTTSSVGHEHLSPPDHDTPNLLTDDSEPERTPPLTSHNSHVGFYT
FT                   SSSPLIRTTSVDETEEDGNGDAEAAAPESQQETERPPSQHGSSLSVPSDRGKKRGISPG
FT                   RRFKNAFGSNPDKKASNRDRASSTSSSKGSRRGSLSAKRAQTVVAEPPPPLPAPIRTDL
FT                   KEDKPLPSLDFPAPRTPPHTAIPHPQTTVTPPTPNTEFPKLFTSPDVTRSPDSIHSKDS
FT                   PGGIVVSPSGNMISHRRVRSASAASHKPSKLSNSISALGPTIEETKASAKSPGAMQTGF
FT                   FSSVFSAAQNAASTLSSSLNSQSKGRNVTQGALSESENQPASEGAPGPSQPINSKTEEK
FT                   KPLAVDTLGSGDLDFSHLDIAIPPGGSVSTPDGVVITKPDLPLEKRKVSQRDEEAARLE
FT                   DSRAARAVTMAYEKPSETSLVPSTDDGLDLQSSASFTKEGAGDQTPPSGSILDGEIGHT
FT                   RPYRSGSVRSRLARRRHRGSSAATTSTLGAIGASAITLGAPAANASMPRLTGFAVASKK
FT                   RNRDFHQLFRSVPEDDYLIEDYSCALQREIILAGRIYISEGHICFSSNILGWVTTLVIS
FT                   FDEVVAIEKESTAMVFPNAIAIQTLHARHTFRSLLSRESTYDLMVNIWKINHPSLKSSA
FT                   NGTRVTDGTGDKTEKAGESDDESEEEDEIYDEDEEGDNADSLFEAAGASVNGSDKSMPT
FT                   KPVSRKASGALANANGAGQAGANSSGDGKGSKSGSPADGDTDFPGPPTHPPTEYTDPAG
FT                   QYDKVVKDDVIPAPLGKVYSYVFGAQSGAFMTKFLVENQKSGELQFETGNKGLTNDSRT
FT                   RNYSYIKPLNGSIGPKQTKCISTETLDFLDLEKAVLVTLGTQTPDVPSGNVFLTKTKYL
FT                   FTWAPNNQTRFLMTCTIEWSGKSWLKGPIEKGAMDGQTAFGNDLVAALKAAVVPRGRTG
FT                   GGKGKGKGRRKKSEVAQEAAAAAAKAAEEERAQQANSWGVLEPLHGLLGPVVDTVKPLL
FT                   GGNVAIVLVGILLFLLFFRRPSQPSVVSHDIGCPGYSLPQRLAAYEEMWRREESELWSW
FT                   LEDRVGMDGLAIPTVSRSTGSRTQQYSRKVQSERALASKVNEEKMSDLEMDHAIRTTRE
FT                   RLDTLEKILLDRRSQPAADQGVVHSEL"
FT   CDS_pept        join(complement(69088..69727),complement(68645..69028),
FT                   complement(68515..68574),complement(67685..68457))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810128"
FT                   /orf_name="An17g00330"
FT                   /product="Similarity to hypothetical protein related to
FT                   ahmp1 - Neurospora crassa"
FT                   /protein_id="CAK97393.1"
FT                   /db_xref="InterPro:IPR021369"
FT                   /db_xref="UniParc:UPI0000EFCF62"
FT                   /db_xref="UniProtKB/TrEMBL:A2R970"
FT                   /transl_table=1
FT                   /translation="MDPIEPVNGSPDPHEGQPPSATPSPGPTSYPRQRAASLRSRRPSI
FT                   RLQRLPSLEQANLSTLRSQQSQQNGDTSRTPGTTLSPLPAIPAASPEDESWQGNRRRSN
FT                   SEPRPGRWSTPNPAALARVTTGGQMRPVQEETSHPIVSSASNQQMPEDVPPLPEIPRRG
FT                   SRTPMRWASGMGVNRFTRNRASTVGGSAPAQNHEVDDEYRSHIVDVLDVIDPEVSALST
FT                   LTNVQNSLFIPNLGPLLNRNQTYTLSPPSPMRELESTSDEERADEIKEPEVRPSIEHTL
FT                   TSVIGEGEEPRFAVLPEGSNLAGWSPEEIEELNDHVRHMLHSRRSKFKRSMKGFRKYVS
FT                   KLTLYATLITLFGLAWVLFLIGWINVGGRQSYIINVIDNVLVALFAIMGDGLAPFRAID
FT                   TYHMIFVARYTFLTWKIRRKRHLPDLKNKNDLPSRRETDVDVELGDTPKGEEYEFTVLD
FT                   PVRQLKLIHHQNKLSKSHTFYKPHETFTHYAFPMRLLIAIVVLLDCHSLFQIALGTCTW
FT                   AISYHVRPFALTTVILCCSICCNITGGVLIMIGDRMTRKKDVVERLFRQQLTEEAMKKI
FT                   RKKKRKEEERRNAENGGVSRSHSISSQRKLSLSQPREDEYES"
FT   CDS_pept        join(complement(71531..71689),complement(71394..71472),
FT                   complement(71205..71342),complement(71041..71154),
FT                   complement(70793..70987),complement(70443..70738))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890647"
FT                   /orf_name="An17g00340"
FT                   /product="Similarity: belongs to the fission yeast
FT                   pyridoxine 4-dehydrogenase family. "
FT                   /EC_number="1.1.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK97394.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0000EFCF63"
FT                   /db_xref="UniProtKB/TrEMBL:A2R971"
FT                   /transl_table=1
FT                   /translation="MVKTLPFQDIQVPSPGFGAMGLSFGLGSNLSLEEAEPVLLKAIEL
FT                   GCTFWDTAVIYQAGVNEKLLGDFIRKHNVRDKIFIASKCGFKVEDFTVTNSASHIKEYI
FT                   EGTIERLGFTPDLYYLHRIDPNTPLEESIPALDEIRKAGKTKYIGLSECSAATLRKANS
FT                   IAKIDAVQAEYSAFETLHETDGLIDTARELGVAYVAYSPLGHGWLVDDFPFQTPDDFAP
FT                   DDFRRGSPKFQGENFYANKKIVDEIKKIAIKKGCSISQVALAWVAAQGMIAIPGTTKAH
FT                   RLEQNWASREIDLTDEEKAEMRKIIDAAKPQGNRYGERHQALVGH"
FT   CDS_pept        join(72813..72905,72980..73070,73162..73214,73364..73495)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890648"
FT                   /orf_name="An17g00350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97395.1"
FT                   /db_xref="UniParc:UPI0000EFCF64"
FT                   /db_xref="UniProtKB/TrEMBL:A2R972"
FT                   /transl_table=1
FT                   /translation="MCAVDASCGALGWQPHIVAVRIGLIQESTQRALAELLSTQNAATF
FT                   PQGRHIMEPLDMGSSCYTLPSPESDAFVGTEKKKLKIHTRFSVSGVDLLGVPIGDYESA
FT                   DSKGAISVHWIYYTRYDL"
FT   CDS_pept        join(74082..74140,74323..74374,74429..74525,74649..74780,
FT                   74859..74910,74953..75045,75130..75216,75311..75366,
FT                   75458..75717)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890649"
FT                   /orf_name="An17g00360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97396.1"
FT                   /db_xref="UniParc:UPI0000EFCF65"
FT                   /db_xref="UniProtKB/TrEMBL:A2R973"
FT                   /transl_table=1
FT                   /translation="MRIAADKHTILNANLTTEYKESEYYNDSDNYGCSVTNGGRGKEGK
FT                   LKLKVAWWQTAPKPRPKDSTDKKENYTSLILKANNGTSRAVAGRNIMGIVWDWAGVGRF
FT                   RGTEIDWLKGVTDDTLQLIDRAFQHPMNYSLIREKYCRYYYDHHQQEGVQLIGKNTAGL
FT                   TNEDELATAGQGVRVSSNDTIVRKIEEFSDLGSNDASPQQPLVLVERKVPEGRPDRRTE
FT                   SPRRAPQNSLAPYGTGTAGQLQGIFRQIWADPGIFRQEPAPFGIGPPPPSLPALFLSPS
FT                   PFPPPPSTSSFLSR"
FT   CDS_pept        join(75983..76197,76478..76784,76842..77075,77126..77455)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172912" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890650"
FT                   /orf_name="An17g00370"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK97397.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG328997"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EFCF66"
FT                   /db_xref="UniProtKB/TrEMBL:A2R974"
FT                   /transl_table=1
FT                   /translation="MSTAVENTTDNVASAPATTAPEATTNGTAPAPAQSTDAAAASADE
FT                   GRRLYIGNLAYATTEGELKEFFKNYKIESVSIPVNPRTNRPVGYAFVDLATAQEATAAI
FT                   EELSGKEILQRKVSVQLARKPEPAEAKAEGATSGGEGASGNEGRKRAGGRGRGRGRGRG
FT                   RGGRLPRAGRSAPVQNGQEAAEPTNVPAQAAPLTEVTNQNETAAATESKQAGKPRAPRP
FT                   QKQRGPPEDGIPSKTKVMVANLPYDLTEDKLKEIFVDYQPVSAKIALRPIPRFMIKKLQ
FT                   ARNERRKGRGFGFVTLGSEELQNKAVVEMNGKEIEGREIAVKVAIDSPGKEDDAIAPAE
FT                   TETTEQATEAPAQENAAPAAA"
FT   CDS_pept        join(complement(79844..80257),complement(79323..79482),
FT                   complement(78892..79268))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890651"
FT                   /orf_name="An17g00380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97398.1"
FT                   /db_xref="UniParc:UPI0000EFCF96"
FT                   /db_xref="UniProtKB/TrEMBL:A2R975"
FT                   /transl_table=1
FT                   /translation="MHISSPTLRRLRDSLSNRQRKIIPEPLLSRHYSQPPLSNIVGNPQ
FT                   DFFRYTSGRWLWDEKQQLQERYREFNILELQKIAIQASSSERCLSMAKIGKGSYNKSVK
FT                   LIMDNRKTVIARIPNPNAGPTILTTASEVATMDLKDTLPGSQPAIVEGDNYPLEVRQKI
FT                   AERFSIGPVVDTAFWSNERGNMNIDRGPWTSAIDYIRALADRVISWIKEHAMPRSPDDP
FT                   LFSSYSQNDPAEHISLLQKYLTVTPHLIPQDKDILGSFLWHTDLRTPNIFVDNSGHITS
FT                   IIDWQSTWAGPLFLEGRHPHFLDYTGDLLLKPPKG"
FT   CDS_pept        join(complement(81756..82140),complement(81539..81705),
FT                   complement(81108..81485),complement(80900..81042),
FT                   complement(80675..80846),complement(80550..80624))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657467"
FT                   /orf_name="An17g00390"
FT                   /product="Similarity to aminopeptidase from patent
FT                   WO9628542-A1 - Aspergillus oryzae "
FT                   /EC_number="3.4.11.-"
FT                   /function="aminopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK97399.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG328999"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI000004F622"
FT                   /db_xref="UniProtKB/TrEMBL:A2R976"
FT                   /transl_table=1
FT                   /translation="MRTSTLLLLWSTAGAALASPYPLPDSQVVFAADHEVPNTQGKHVV
FT                   DEAILSALNAHSDPVAAMVSLRPETAAFLAEPRLLHIRGEEKAEWMTEGDKLRLRQRGK
FT                   KFMDITEHQDFYAEQAMASFAGDPNLPKLSHKGLVKPLFSQIETERMHDILQHMTSYYN
FT                   RYYGDYHGEMSSEWLHDYIAAIISKSPFRTHISLEYFTHPFRQSSIIARFEPKVRSFSQ
FT                   PLTIIGAHQDSANYLFPLLPAPGADDDCSGTVSILEAFRVLAENGYTPKDGPVEFHWYA
FT                   AEEAGLLGSQAIARYKKEQGAKIDAMMEFDMTAFIARNATETIGFVATQADAALTNWAL
FT                   NLSREYISIPAEVYELGPNAGSDYMSYTKLNYPAAFASEGNPLAGGSFPGEMDPYVHGI
FT                   KDRMDVDDETGVFSIEHMARFSELAIAFVVEQAGWDNTWR"
FT   mat_peptide     join(complement(81756..82086),complement(81539..81705),
FT                   complement(81108..81485),complement(80900..81042),
FT                   complement(80675..80846),complement(80553..80624))
FT                   /db_xref="UniProtKB/TrEMBL:A2R976 "
FT   sig_peptide     complement(82087..82140)
FT                   /db_xref="UniProtKB/TrEMBL:A2R976 "
FT   CDS_pept        join(83728..83769,83880..83948,84066..84809,84842..85243)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172923" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963311"
FT                   /orf_name="An17g00400"
FT                   /function="ARF GTPase activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of ARF GTPase activity "
FT                   /protein_id="CAK97400.1"
FT                   /db_xref="GO:0008060"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032312"
FT                   /db_xref="HOGENOM:HBG329000"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniParc:UPI0000EFCF97"
FT                   /db_xref="UniProtKB/TrEMBL:A2R977"
FT                   /transl_table=1
FT                   /translation="MSRMWEVDPETRAKLLQFSKTNGNDKCCDCGAPSPQWASPKFGTF
FT                   ICLNCAGTHRGLGVHISFVRSITMDAFKTSEILRMEHGGNEPWKAFFDSHPITQSEGRT
FT                   FEDSTIKERYEGEVGEEWKERLAAKAEGREYVPGQPKPQQPKNKEPTSRSSTPLAARGG
FT                   SPASHDGVPEMSKKERNEAYFARLGNENSSRSESVPPSQGGKFTGFGGGMPVTNTPKSS
FT                   GSGAAIPGFDDFQKDPMGALTKGFGWFATTVGKSAKTVNDSYIQPTAKTVHFPSILISV
FT                   RYVPIAESDLAAQARIHAATLGQNMQHGVRGAADQFHRFVEGPDEAAAAAAARRGRVEP
FT                   ERKDFWDSFSSVAAQDSHRRTASRSSAIGTAAMKTGPSGAGTSSTSSAAASSATTGTGA
FT                   GSSATARKSTDDGGWDDNW"
FT   CDS_pept        join(complement(87737..87828),complement(87315..87667),
FT                   complement(86768..87258),complement(86614..86712),
FT                   complement(86452..86516),complement(85972..86110))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890652"
FT                   /orf_name="An17g00410"
FT                   /product="Similarity to hypothetical protein EAA64027.1 -
FT                   Aspergillus nidulans"
FT                   /protein_id="CAK97401.1"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="UniParc:UPI0000EFCF98"
FT                   /db_xref="UniProtKB/TrEMBL:A2R978"
FT                   /transl_table=1
FT                   /translation="MPSISGKLFLYIPLDISVKAIEVKIVGSLKIPRPEIIAGPCQGGT
FT                   TVERSQTLASSRDNSFRLPRGRYEFPFELPLAREMMDTVTGVGHEYHSYEVRGVVHRHF
FT                   YSDIESSSPLRIHRTPNVFYANLLDQVVPVSVSPTTPFRLPPRIIEEHLNERLNLRYRI
FT                   SIPMHIPFGASFPLQVEYSSLSDQPQKGQSRSDIHPRSITIHITETHALKVTPTASDAI
FT                   NYNNPLPLIFRKEHVILHQSYTVQPPARALLPESLDFDYSSTIPVHLPQDFHACTQDVQ
FT                   SELIKVHHNLRYNVEFGREREDETESSQQNKSRCGVSLNEPRTNRANSKHSSQGPFRSE
FT                   YTCPHTERAFSSPSSVRKSANLAVKASISERILRYYNYTDTDEDETRARADTSAEMVIK
FT                   AMEEAAMQLLDRS"
FT   CDS_pept        join(88633..88644,88779..89648)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657468"
FT                   /orf_name="An17g00420"
FT                   /product="Similarity to hypothetical protein YBR094w -
FT                   Saccharomyces cerevisiae"
FT                   /function="hydrolase activity"
FT                   /function="tubulin-tyrosine ligase activity"
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAK97402.1"
FT                   /db_xref="GO:0004835"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG329003"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="UniParc:UPI0000EFCF99"
FT                   /db_xref="UniProtKB/TrEMBL:A2R979"
FT                   /transl_table=1
FT                   /translation="MHILVVNDDGPPSRDGSPFVHSLVNELKAQGHFVTVVLPNRQRSW
FT                   IGKAHFVGEIVRPTYYYPDRLFQSNDPLPLDHSSNEGNHHEHPWVLVNSTPAGCVQIGL
FT                   YHSHALHRHDQGEERPNPVDLVISGPNLGANTTTLFSLSSGTIGGALEAALCGKRSIAL
FT                   SFEPPSKLPSYDSDMITEASRHSVRLINYLYHNWDEGVELYSINVPLQPATTAAGERKV
FT                   MYSRIRPNRWLSESPFREVSSGDTTTALDDNDKIQSPPLLRWEPDLADIHGSTDRTSDM
FT                   DDDWMVRGGKTR"
FT   CDS_pept        join(complement(91949..93387),complement(91502..91862),
FT                   complement(91112..91447),complement(91017..91050),
FT                   complement(90572..90709),complement(90310..90503))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890653"
FT                   /orf_name="An17g00430"
FT                   /product="Similarity to hypothetical protein EAA71271.1 -
FT                   Gibberella zeae"
FT                   /protein_id="CAK97403.1"
FT                   /db_xref="UniParc:UPI0000EFCF9A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R980"
FT                   /transl_table=1
FT                   /translation="MGYFIRQASAGIGLVSETVKAQKAKYQEKKHKEQQQHAEAGAESL
FT                   PPLEETESVAPSYHTEDGGHSRPSMQNGRPSMQNISPPPMENYPPTHNAYPPTQNGQSP
FT                   LQNNYPPPMDNRYSPPIGNSYPPVQNGHPPMQNNYPPLMENNHPPTYNTYPPAQNGQPP
FT                   VYNGQPIHNSQSPMHNIHPPMENNYPPMQNGYPHPMGNNQPPVQNGQLPVQSSYPPMEN
FT                   NNPPNYAAYHPWKHGQPPMQNTYPPSEYGYPPPDSHPPMENSYPPAHNVYPPPQASREV
FT                   SDPLPPTEKSPSPKDEKSTTKVHEYDTESTYSREYDEVDKDIERQWELDEAQEHLRGVT
FT                   YPTTTPNYEDDADYSTKLAESFVRDYPVPANWSYYDTSIDFGPPKLDYPVVLPQRRPKD
FT                   RQRGFVRAYAPELEKFGIDQKMFLDYVDQANKSCVGSQWFQVINLANNVGGYFVNPTIG
FT                   FVMGIVADAAVRIGMAVDGRRRSGNFFDKINKDFFMPRGLFCLLMTYAPESKEAILDLD
FT                   VNNTIISARTPEKGFHRIKQKYQTANATANSTFDQFSPLIFPDLNHPDVDEATKKKHQV
FT                   LLSKVHRAMEGVEEYYDKRDQAKFIAKNPESNLAMGRKPEFTSRYADPTNKAASGSLLA
FT                   MATGGKFTDDTILGWMGIEGRSARGAKPSFFGGLADAALRKAKGDKELEKARAEGKPVP
FT                   HQSTKGFVGGGLNKLLKRKVIYMMIVNMPRFKHVASVIRKLQGHSVWLKYCSEEHAKLD
FT                   QQQMLEIVVERDASKVAHGDDIMHFHRSGNFQSVLRPFALGNIASSELGWGSRLSQKLP
FT                   GYADEPQRTVLQLHIDNTAEW"
FT   CDS_pept        join(complement(96625..96693),complement(95286..96565),
FT                   complement(95053..95185),complement(94937..94990))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890654"
FT                   /orf_name="An17g00440"
FT                   /product="Catalytic activity: cytochrome P-450 enzymes
FT                   catalyse the reaction"
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK97404.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0000EFCF9B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R981"
FT                   /transl_table=1
FT                   /translation="MAIVMDELSVLFLLKAFAWAFVPYSILCIIYNIFFHPLKHYPGPR
FT                   IMASSRLPIFFLVLIGRSVNTLEKLHAKYGPVVRVAPDELSYTAASAWKDIYSSSAAWP
FT                   LAIPRNMVFFRAMAGEYGFHSLVTANNQDHARLRRLYSRAFSKQALAAQEPLIIQHIDK
FT                   LIKKLYAEIDHTAKPVDINLFLNLVLFDMINDLQFGEPLNLLDDTTHRAFARASLIIVP
FT                   SAAVIQALADFPLARIILKPILREVFRMRRLYFSTTDERLEKRLASNSYRADIVQFLTD
FT                   AKSDNISLQEIQANAPLMNIAGSGTSAVALSGLIANLLLAPHILKELQNEIRSKFHTSS
FT                   DITMKNMVDMPLLDACIKEVLRVFPAVPVTPGRLVPSPGVTIAGKWVAGGTRVYVTPLA
FT                   AFHSTDNFHDPETFAPQRWYNTKEESSFTTKDVKDAYKPFSVGPYNCIGQYMAHYIVSL
FT                   FICNLLLHFDFKIATDPKTWLSNQRAWIVWHNPPLNTGTGEAARLDERDGGSE"
FT   mat_peptide     join(complement(96625..96633),complement(95286..96565),
FT                   complement(95053..95185),complement(94940..94990))
FT                   /db_xref="UniProtKB/TrEMBL:A2R981 "
FT   sig_peptide     complement(96634..96693)
FT                   /db_xref="UniProtKB/TrEMBL:A2R981 "
FT   CDS_pept        97942..98901
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890655"
FT                   /orf_name="An17g00450"
FT                   /product="Catalytic activity: 2-trans "
FT                   /EC_number="4.2.3.6"
FT                   /function="trichodiene synthase activity"
FT                   /protein_id="CAK97405.1"
FT                   /db_xref="GO:0045482"
FT                   /db_xref="HOGENOM:HBG329006"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI0000EFCF9C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R982"
FT                   /transl_table=1
FT                   /translation="MGQIFSSDQAPTEAATSDPSREFFTVVSAFLKEVFLTIPEVPSND
FT                   LFDDEVFNRFKHCGLPSEVVYRYSKGAAFMARCFYPHLDRDTQLSIGVWTSYIFSIDDL
FT                   CEGPEFREQLKEYRAHLLGANQPKWAYLRGLFSSLQDLCDRYDPFVGDMILKSSLDYIS
FT                   VNVFEVEQKGRLNVDSNTRLFPEFLRQKSGIGEAYAFANFPKGSLDIASYITLIPDLAA
FT                   VVPQLNDVVSFYKESIIGDEQDTNLMLVSAVEGCSATEALKMTVDRCLDSVRRMRAACL
FT                   KNEGLRNVVNAFVQGFALYHLKWSRYHMEDFGDYRDWL"
FT   CDS_pept        join(99484..99517,99550..99639,99704..99802,99877..100058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114347"
FT                   /orf_name="An17g00460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97406.1"
FT                   /db_xref="UniParc:UPI0000EFCF9D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R983"
FT                   /transl_table=1
FT                   /translation="MLKMTCLRDQLDRNPSTPGLHTGASVTLLERNLDFGAIAKLRGEG
FT                   IIVGQGVGYVGGIGKRHKTPGGSSGYLTIVHSKDMQAMVCSEPTISGRSIPVDSEQSFK
FT                   TDKVYEQDANHSQLPKRGNMPSSRVLCSRY"
FT   CDS_pept        join(100593..100629,100760..101160,101234..101911,
FT                   102004..102141)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114348"
FT                   /orf_name="An17g00470"
FT                   /product="Catalytic activity: ATP + a protein [ "
FT                   /function="cAMP-dependent protein kinase regulator activity"
FT                   /biological_process="regulation of protein phosphorylation "
FT                   /cellular_component="cAMP-dependent protein kinase complex "
FT                   /protein_id="CAK97407.1"
FT                   /db_xref="GO:0001932"
FT                   /db_xref="GO:0005952"
FT                   /db_xref="GO:0008603"
FT                   /db_xref="HOGENOM:HBG736470"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI0000EFCF9E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R984"
FT                   /transl_table=1
FT                   /translation="MFRDDYSRRRIKFMPGRIEAEHCSHVSGSPTLAPEGHPEVSVPLS
FT                   FQDPFTLCPRASTLPGSGDDMPPSTDTSHYPLPRRNSVSAESFVPGQQSLPSTSFDMTE
FT                   EQAHRLVRAVKEVFLFSALDKEQYAQLLSAFVGKAVPIKGTNVITQGDIGDNFYIVEKG
FT                   SFDIYITLASTPQPTTPSIGTKHGSAHPGDFFGELALLYNAPRAATIISTEPDCHLWAI
FT                   DGVSFRRIMAESAFARRRVHTSFLERVPLLAGLSGRQRSRIAEALQTRRYCAGDTIILQ
FT                   GDLGSDFFLLVSGEARAYKVGFVGSVKTYTSGGWFGERAFRKNAPRAASIMAITDVVVA
FT                   VLDRDAFARLLGPVEEIMGNTQYEGVVDEEEVLLSDGQSSENIPPPFHDESKKMTGSQK
FT                   SCPSSSDASKWLTLARGC"
FT   CDS_pept        join(complement(107152..107209),complement(106855..107013),
FT                   complement(106544..106660),complement(105901..106007),
FT                   complement(105562..105783),complement(105209..105271),
FT                   complement(104720..104861),complement(104595..104626),
FT                   complement(104350..104513),complement(103817..103961),
FT                   complement(103284..103349),complement(103077..103226))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890656"
FT                   /orf_name="An17g00480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97408.1"
FT                   /db_xref="UniParc:UPI0000EFCF9F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R985"
FT                   /transl_table=1
FT                   /translation="MKAYVDILGHDRPGVTQAEVSQNNSQPIRAVNHGRGYTGAAAENG
FT                   CSLRVPASRVANGGPIDSLGRHMIPVAATTGITATATQNLNGEREKNYIKEGRHMLKVP
FT                   RLVAFIWGFPRACLWLCLIPYLEGLNDKIAFTSVDTVAKTVDRLSGLAIFAPRIPDAKL
FT                   RHYFNLLSEGTAPPTNLISAHLLGCGSADHWATRAKYDPLSGHRPQGDLCKVYGVAKAI
FT                   KHPIIFAFDRIRLPYDHTCPGSLHFRPNASPPFLLLFRPRVSDCVPGSTYMLDLKEPTS
FT                   TIQAFRRKSMGWEAAPTVMSINGGGAVRIVVREDPRRRIQNPWRLAASWRLHDRFSRIP
FT                   PSTLRLFLPIPYLSGGTGSGGGAIRLILRLDRGLEMCGLRIYITTSASGGGGLAVCMCQ
FT                   RRYEGWPVRPGVTVADPVRHARGPAPTGSASFGNTCHKICPTLGAHLLNGVVKRIDKGA
FT                   VPTLETVTKERYRYKD"
FT   CDS_pept        join(107510..107851,107910..107961,108011..108104,
FT                   108161..108443)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114349"
FT                   /orf_name="An17g00490"
FT                   /protein_id="CAK97409.1"
FT                   /db_xref="UniParc:UPI0000EFCFA0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R986"
FT                   /transl_table=1
FT                   /translation="MAFAGSSVGRTKGYLDFLGKEQDYHTMVLYRSYDGLASSNFSSFP
FT                   QEVSFEDIRGKETEFSIQEQGFCLYSLSTKMSYIDFDDDFEIRATLYPEVKRILQRLTG
FT                   ASIVKIYFHWVRGKHPSGSGPVGYAHIDTTGPSGAYMFETYRANSGVDIAPSRKYEFYT
FT                   FWVPLLPVQDYPLALCDQRTVKPEHLLPVTHYDSSATSQNCFLQHDPEQRWYFINNQQP
FT                   SEAWIFYQGGNRVENKPGMSAIVFRLLLHWLSLI"
FT   CDS_pept        complement(108898..109653)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810129"
FT                   /orf_name="An17g00500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97410.1"
FT                   /db_xref="UniParc:UPI0000EFCFA1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R987"
FT                   /transl_table=1
FT                   /translation="MDFIKNHEHQHEQSTNDPREVKEKLCQLMKDSLHTTANGSTEAEK
FT                   QAHQLGSSPPLDVSPTNSSPNPDNDNQTDKEGDKPRTEAKEATGSNNDPSPSPNDDNKT
FT                   DKEADEDADETTTPAKEATKPDDQLPQPSEDQSNTPEPDTSEAEGLRLQKREHNRVYGE
FT                   NMHAESCCVIPDEDCFGHLNPKETGEDEDEELQRQKREFHEEIYTLIERGCGITLTPSG
FT                   RELMAKLSSEEELNANADIGINPIVFSIL"
FT   CDS_pept        join(complement(111533..111613),complement(111371..111494),
FT                   complement(111222..111244),complement(110939..111151))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890657"
FT                   /orf_name="An17g00510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK97411.1"
FT                   /db_xref="InterPro:IPR003014"
FT                   /db_xref="UniParc:UPI0000EFCFA2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R988"
FT                   /transl_table=1
FT                   /translation="MSYRRVSPLDPVNCKEELELVGESADKGNWRSVRSPPMVVKKGME
FT                   ATTREGKTVIVIVVQDTGPKDAAYGIYTVIDIPVYRTGANNDLGSDSPLLDIAECMHQC
FT                   SQIPKCRMVYFYKKLRTCFFATIPGTLSGHAPDYGAAWFLGS"
FT   CDS_pept        join(complement(114547..114553),complement(113819..114425),
FT                   complement(111923..113765))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963312"
FT                   /gene_name="bglI"
FT                   /orf_name="An17g00520"
FT                   /product="Probable beta-glucosidase I "
FT                   /EC_number="3.2.1.21"
FT                   /function="beta-glucosidase activity"
FT                   /biological_process="cellulose catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK97412.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0008422"
FT                   /db_xref="GO:0030245"
FT                   /db_xref="HOGENOM:HBG749096"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="UniParc:UPI0000EFCFA3"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R989"
FT                   /transl_table=1
FT                   /translation="MARVDFWHTASIPRLNIPALRMSDGPNGVRGTRFFNGIPAACFPC
FT                   ATALGATWDAHLLHEVGQLMGDESIAKGSHIVLGPTINIQRSPLGGRGFESFAEDGVLS
FT                   GILAGNYCKGLQEKGVAATLKHFVCNDQEHERLAVSSIVTMRALREIYLLPFQLAMRIC
FT                   PTACVMTAYNKVNGTHVSENKELITDILRKEWNWDGLVMSDWFGTYTTSDAINAGLDLE
FT                   MPGKTRWRGSALAHAVSSNKVAEFVLDDRVRNILNLVNWVEPLGIPEHAPEKALNRPQD
FT                   RDLLRRAAAESVVLMKNEDNILPLRKDKPILVIGPNAQIAAYCGGGSASLDPYYTVSPF
FT                   EGVTAKATSEVQFSQGVYSHKELPLLGPLLKTQDGKPGFTFRVYNEPPSHKDRTLVDEL
FT                   HLLRSSGFLMDYINPKIHSFTFFVDMEGYFTPTESGVYDFGVTVVGTGRLLIDNETVVD
FT                   NTKNQRQGTAFFGNATVEERGSKHLNAGQTYKVVLEFGSAPTSDLDTRGIVVFGPGGFR
FT                   FGAARQVSQEELISNAVSQASQASQVIIFAGLTSEWETEGNDREHMDLPPGTDEMISRV
FT                   LDANPDNTVVCLQSGTPVTMPWVHKAKALVHAWFGGNECGNGIADVLFGDVNPSAKLPV
FT                   TFPVRLQDNPSYLNFRSERGRVLYGEDVYVGYRYYEKTNVKPLYPFGHGLSYTTFSRSD
FT                   LKITTSPEKSTLTDGEPITATVQVKNTGTVAGAEIVQLWVLPPKTEVNRPVRELKGFTK
FT                   VFLQPGEEKQVEIVVEKKLATSWWDEQRGKWASEKGTYGVSVTGTGEEELSGEFGVERT
FT                   RYWVGL"
FT   CDS_pept        join(complement(118305..120336),complement(117995..118256),
FT                   complement(115486..117922))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890658"
FT                   /orf_name="An17g00530"
FT                   /protein_id="CAK97413.1"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR021726"
FT                   /db_xref="UniParc:UPI0000EFCFD6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R990"
FT                   /transl_table=1
FT                   /translation="MYAEWTSGQTSRLPDIKSAFDQAKAETKDVLKRLSKTNIRPMARA
FT                   LAKIAYANPGIVISVAINQIESYENLIEVVVECARYFTYLGYDILTWVMISSLGQKGRS
FT                   RVQEGGLLTSRWLNALATFAGRTFKRYSVMDPTPVLQYVVEQLRQNNSTDLIILEQIIS
FT                   SMAGIITDNNFNDAQIQAMAGGEILQSQTILQLLDKRHESKTTSRRLMKSLTVSKLAGQ
FT                   LLIAIAQERLICVFRETEGASELKLLGNIFDEIHRILVQYLDLLRSNLSVEEFDSFVPD
FT                   LASLISDFGIQPEVAFWIRRPSVAKKVADIEKTMQDEESAKTPAALVSSRESEETSPSK
FT                   PEADEMETTEDGEANVTEGEQPSENAMDVDTEKAETANNTDSNAATVPAGSVTAEVPAL
FT                   NPVMQDLQDQVKAVLSPETWGVVGLQFYVTFWQLSLYDVHIPQKSYEDEIDRQKRKVMA
FT                   ISNDRSDISMAGTQRKEREKKQITQLQDRILEENKAHLKAYGQTRTKLQKEKDRWFAGM
FT                   RGKHDSLNVALLEQCFLPRLLLSPIDAFYCFKMLKFLHTTGTPNFRTVGLLDQLFREQR
FT                   LTALIFQCTSREADNLGRFLNEVLRDLGRWHADKAVYEKEAFGTKKDLPGFAKNVDSDG
FT                   KPAIYLEYEDFRRLLYKWHRLFSSALKTCLNGGEYMHIRNAISRDMLTSMNSLSQNDER
FT                   DDVKIPAASLIGDLNRREKKWLLPQAFMSASPPVPGRPGAAAKPTTPRPSSTTPTPLNA
FT                   TAVEFKPTSTNGSQGEAKPESGATKAEVEDGEIEDAKMADVPLADRTAQKPAETKVSST
FT                   SQRDSPATSAQGTEIQASANREQNSNEKDVASARGAHLEADLPARPQAPASPAASQAAS
FT                   KISDSGRPANVPKRPEPERAPSGAQNARAQAQGPHRFNREDKLPPRPDLLEDRRDRHQD
FT                   YPRGGRFGGDHDYSRPFDPAMGDGRPYPRGDRDYPRQPMDEPFRGFPHRDGRPARDADW
FT                   PDRSGRLRPDAREGPPNVRSVPPTHPDRAGMIDDHPEGFRRGETGRQDRDDRRNLQQRA
FT                   LSPPRMEPLGRPERFPADDRRGANFAHPHARNEDMPTGPRSERYGRPSMDGADSRDTVT
FT                   GIDMNHGRLRQPEPPTDVPSGPRGRNNAGRGGRNVPGSQHSQGQPAAGAMAPTERQPPT
FT                   GPGRQGLRNAPDQPAPTGPSSPGPEKLDTSGIHPDRLKVLQQQPQENTYGGGQRPHHGS
FT                   SPASIVPPSGPRSGLGPPSGPAAMPRGPPSGPGFGGERGRGDKRFAGINNMLQQSGGLP
FT                   DRGPGPTIRGRGANRQSGAMNAPSPQSARPPTPVAQEEGGRGGPASQGRPDLMAGRSSG
FT                   APYGEEDGHPRSRPGGSRGEPAEESSAESRRSQRFSSGTYPERERERERDRERRGGDEE
FT                   GSRSSSRREEHRDRNRDYERERSRRSDAGGAPGGPREERYESREASRRGPGAREDNRRR
FT                   RDREEGSDIAPSSQEHEGRLRPPSSLGGQGPPPPPPPPLAAGEDDRRWGGGRELRDRER
FT                   DRNRDRPRERDYHREGAPSGPHRKRNRPGDEGGHGDGGGRGGMRMGSESKRPRRGA"
FT   gap             120483..120582
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(121722..122709),c
FT                   omplement(<120586..121493))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890659"
FT                   /orf_name="An17g00540"
FT                   /protein_id="CAK42982.1"
FT                   /db_xref="UniParc:UPI0000EFCFD7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R991"
FT                   /transl_table=1
FT                   /translation="MSPPSTTPAKDVSDQSQANGVPPTTDHQKPPPSPSPSSSQPQTHI
FT                   NPSPAPTPMPAPAPQAQASAPQPPPGPPPPYDYEYVTQNAIDEWATTGKKHLVERGIQV
FT                   KDAQDAAALASIYQELIRSALYGRLSPEEAGAAVRDIIGEEVAAEDVDMQNEGQAQALL
FT                   DTRSLFLDTLSILTDSDTSNSALRPLVFSTGINSALMRLQLDTQLLQSLGLVRETFTRM
FT                   GIRKQTNLLYRQSNYNLLREESEGYSKLLTELFTTSNNEPPSSEVVEDTFERVKAMIGA
FT                   FDMDVGRVLDVTLDVFAAVLVKQYRFFVKLLRASSWWPKEDAFRTVDAEEKEMRKWIEE
FT                   TGTLPPKGSRVAAQLLGFKLRFYSSRARAKSDVLPDNLIYLAALLIKVGFISLRDLYPH
FT                   LWRPDDSMDALKEEKLKEKADRERAARPGGGINALMMAGALSDDTLPIPRIRESETRSA
FT                   TPGKDQETDKSTGAKTEEDELPEPSDQKVMLLKSLLAIGALPESLFILSKFPWLMDVYP
FT                   ELPEFIHRILHHCLGKVYSSLRPLPSVEVLKEQKQILNHDQSGVPKGQIRLAQAPPRRV
FT                   LRWAQLDKEDTNDGTDYRFYWDDWADNVPICQTVDDVFALCSSFLNLSGHKIGQDP"
FT   CDS_pept        join(complement(124689..124711),complement(124418..124623),
FT                   complement(123548..124347))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142393" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890660"
FT                   /orf_name="An17g00550"
FT                   /product="Similarity to dTDP-glucose 4 "
FT                   /EC_number="4.2.1.-"
FT                   /function="NAD or NADH binding"
FT                   /function="lyase activity"
FT                   /function="oxidoreductase activity, acting on the aldehyde
FT                   or oxo group of donors, NAD or NADP as acceptor "
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK42983.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016620"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG532399"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCFD8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R992"
FT                   /transl_table=1
FT                   /translation="MAPQKVFLTGVTGYIGGDTFYDVYQAHPDWQYSVLVRNKDKAAQV
FT                   TSKYPNVRIVLGDLDSADIIEEEVKNADIVLHCADCDHVAAAEAIAKGATHHTPDRPVW
FT                   WIHTSGTGILTVEDFRSNTWGLERAKQHDDWDGVDELLNLPADSFHRNVDEIVINAGKR
FT                   APDSVKIAIVCPPTIYGPGRGPCNQKSVQAYWLASAVLKRKKGLQVGEGKNIWHQIHVQ
FT                   DLSDLYLLLSEAAAAGGGKATWNDKGYYLAENGPFCWGDIQKQVAQVAYEKKLIPSPEV
FT                   EPLTDEQVTETNQFGLYAWGSSSRGTSYRGRKLLGWNPHRPSLKELIPEIVDIEAKALG
FT                   LL"
FT   CDS_pept        join(complement(126981..127415),complement(126467..126920),
FT                   complement(125539..126410))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890661"
FT                   /orf_name="An17g00560"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /cellular_component="retromer complex, outer shell "
FT                   /protein_id="CAK42984.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0030905"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG395467"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR014461"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI0000EFCFD9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R993"
FT                   /transl_table=1
FT                   /translation="MDYSAISNDPDHPAGTSPWASPRPTQTTFPASVTSDIPPAPLPPQ
FT                   DPYNAESQPTETPGFQENEIGSPDLSARLQGAQLGEPGYVDEHSQHTQQQHGQQPRSQL
FT                   PARYQTGPRQNPRQPAPVYRIQAKVTGLERTGKKDPILRFDTNIPKFRTTQYRDVRRTH
FT                   AEFVKLADHLISANPEALVPAVPPPLTPAGAGTEEDEIRVKSSLQRWLNVVLSNEVLIH
FT                   DDEVVLFVESDFGYSPVVRMKQPATGVRRKVLKQFAPPPDDTPELQNARPIVKMFYLGT
FT                   MDTSHKVDRVVKARRGLGLAESDFGVKLGQMHVQETHPGLSNAYRKLGKIIQTVGDFHA
FT                   VQATAEATTLGDPLSYHSSDAFIVKETLTNRHILLRDLIQAQQATRSKRAAADRLKVSS
FT                   SVRPDKVDEAINALDEAQGHEDYLTKRTQRVTSNLLAEKQRWFDRTTNDMLASLREYTL
FT                   RQIESERRTLATLESVRPDIRAIDASGGLSRLGRESHPTARRPNLGSSQGPKGDAWSGI
FT                   PRRSDSLGRSLSGSFVAPTPTEDDEEVNGHGTGKGRLRSASGVSSIVEEDDDDRLDARN
FT                   AASRLATSTF"
FT   CDS_pept        join(127922..128318,128382..129061,129167..130675)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890662"
FT                   /gene_name="mef2"
FT                   /orf_name="An17g00570"
FT                   /product="Ribosome-releasing factor 2, mitochondrial "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAK42985.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000EFCFDA"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R994"
FT                   /transl_table=1
FT                   /translation="MVTALFLRASHQTVRPTGLRQCQAAASRLGCNASLIPGVKKGQFP
FT                   KIQMLSTSASKLQADTLDRTRNIGIIAHIDAGKTTTTERMLYYSGFTRRIGDVDEGSTV
FT                   TDFLPAERARGITIQSAAITFHWPPQAAVNLIDTPGHADFTFEVMRSLRILDGAVCILD
FT                   GVAGVEAQTERVWHQASTYRIPRIVYINKLDRDGAAFGRTVREISSRLAGYPAVCQVPW
FT                   FEGGNGRFVGVGDAINLQGLRWQDGDGKAVKMFNLQELDGEEPGLAQEIKRARTALVEL
FT                   LSEHDETMIEKFFEHDEDHLAVPPNDILDSLRRCLLQEQGRKIIPIFAGASFRNIGVQP
FT                   LLDAVTNLLPSPLETPDAEKKSVTQAESQNAIEKLQSCALAFKVVNDAKRGVLVYVRVY
FT                   SGSLDRNSAIFNTNLKITERAPRLLKMYANDAVEVDSIPEGHIGVVAGLKHARTGDTLV
FT                   SYAGNKLTPPEPLDTLQLRPIQVPPPVFFASIEPHSLSEEKKIHECLALLLREDPSLHV
FT                   TVDEDSGQTLLSGMGELHLEIARDRLINDLKAKATMGRIEIGYRECPLGESPVVTKMFD
FT                   KEIAGRKGKAGCTAVVEPFDPDNAPPVPEDALSVETKEGNQIIIIAPELQVETNRKGIE
FT                   ESPVLPPGLDMQSFRASLHNGCLAALARGPQFTFPMHHTRVTLTINPTEHLFGTDTTPA
FT                   ALSSAARLATSAALRDLLSSGPGTSLMEPVMNVIISIDEASLGAVVHDISSSRGGHIVS
FT                   LDEEIPLTSTDLSASPQPVEDLPPIDPKKVYAPADPFESGSVGASLPDTANRPRTITAK
FT                   VPLKEMVGYLKHLRSLSAGHGTFVMSVDRFEKMSTPRQKAVLTELRGGF"
FT   CDS_pept        join(complement(132302..132587),complement(132093..132232),
FT                   complement(131878..132038),complement(131165..131807))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890663"
FT                   /orf_name="An17g00580"
FT                   /product="Similarity to hypothetical protein T22A6.50 -
FT                   Arabidopsis thaliana"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAK42986.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG333814"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCFDB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R995"
FT                   /transl_table=1
FT                   /translation="MGSISGDKVALVFGASGISGWAVTRSLLEYPTRSTFSRVIGLTHR
FT                   PQTRVQLGLPDDPRLEVYSGINLRGSLDEVMTQMRETIPQLDQVTHVYYLAYSNATAYT
FT                   ENVMDIKDINVVMTYNAVHACDTLCKNMTFFVLQTGTNHYGVAAFQHIDKLTFNTPLRE
FT                   DAPRVPSPYGDEIFYYGQVDLIREAAQGKSWRWANEKSTYPGHVPSTTSMTTVEPIALY
FT                   LSLYRYVYGYGATVPFPGTPTNYVYTFTDSSQDIISRAEIYLSVVKPDEANGEAFNIAD
FT                   TATPGPWCVKWPILAEYFGLKAIRPTQTDYAAIDKWWYDHQDDYDRMCKEYGLQKRQIG
FT                   PDTWLFVYAGFKLLDRNREFSLDKIRSIGFMEERSVGKGHLLAFDRMARVGVIPARTQL
FT                   LPSAGVQSNL"
FT   mat_peptide     join(complement(132302..132521),complement(132093..132232),
FT                   complement(131878..132038),complement(131168..131807))
FT                   /db_xref="UniProtKB/TrEMBL:A2R995 "
FT   sig_peptide     complement(132522..132587)
FT                   /db_xref="UniProtKB/TrEMBL:A2R995 "
FT   CDS_pept        join(134049..134276,134423..134449,134595..134933,
FT                   134991..135045,135138..135242,135302..135582,
FT                   135848..136097,136193..136851)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890664"
FT                   /orf_name="An17g00590"
FT                   /protein_id="CAK42987.1"
FT                   /db_xref="UniParc:UPI0000EFCFDC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R996"
FT                   /transl_table=1
FT                   /translation="MLSRSLGKGTSFTGQQTTVLGIGVAFMAFTSVVIALRVYVRTLLL
FT                   RAWGADDGEPTIVPRSFDKSNEHAVLMVIGTLHTMGLENTCIWATRLLYVLGLCFIKLS
FT                   LLWFYLRLETRRFMQWLVYSVIFIVLGVSISSFFVDTLSCIPPSKFWNSTKSGHCMSTA
FT                   SQQKFYEVNGILVIVMDILIWAVPIPMLWRVRISLRKKIAVLGVFSVGLLSIAAACVRY
FT                   NTVLQLANNPDETYVLAASLNWCGIEAYVAIFCGSTPALYVFVKRYLPQILGPSYAHNP
FT                   TYPGQSNAKRFSAPFCRVSRQDVSESRLGESQDALHDGDGIMLKTDIHWEVTDIDAEGR
FT                   VDSHHSRLPSCISAVCPTERCRIIFPNYYRFTVLSTLICKYQTHYYLTPNIPTASDPSG
FT                   YTKFEACYHNRSSPTNSRHSGIPAITMNSFFHSTKHAKTSYYHIPSTVNLDDVQQILHN
FT                   HSTLANIFWPQTVNDPENLIFENQTGPSTTEIQIGPASGSNPGPSATKCKARMISHHEA
FT                   REVVVEEEMPLGLRMTLVYRVSDEPPQGISAEEGDGLLALADSQPSTSLSPSGSRIGLY
FT                   LEVERSVMAPRPLSMLVKTTEGPVVKTKNLLFVLDELGNGRDLDAVLGALNDGLGESDD
FT                   EGEGVLEKYKAD"
FT   CDS_pept        join(138516..138587,138637..138857,139017..139751,
FT                   139814..139951,140045..140152,140332..140344,1
FT                   40563..140955)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890665"
FT                   /orf_name="An17g00600"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An08g09690 - Aspergillus niger"
FT                   /protein_id="CAK42988.1"
FT                   /db_xref="UniParc:UPI0000EFCFDD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R997"
FT                   /transl_table=1
FT                   /translation="MSLWATVGTCTATRTFRQILAPTHDAKPVPPKMPKEAEMRDESTQ
FT                   VGWTTDLRPKVSTTTGTIVIQAFEPVYLKPEMGNSFWKFATADGQTIAESTIQSCIASS
FT                   LIYAYNLLRRLNVYRNTQYPTSKLFRIMPRNMDTATLRYKWFSQGDIGPRSIIKLNNDW
FT                   VVQQAISEHTFQKDHDDHLARRGPSWTAIRLLVEDRSARTKAYMRTYKQLMHGGTEAEP
FT                   ARVRTRQANSSWCPVELKAYRSLPNKRPLIVPRLLGERVTKQDASGWVPDGFLIYIVWE
FT                   IVPGIQLGDPCGSKVFWTLERAERDLIREKFKEGYMKLYEWGFDPRPGCGQNLVWNAKT
FT                   STLYFVGWFLAYEDIEKKEWTPRFWYFWDLVRAPEKRQRHENPDDSWMWPLQGIEDILF
FT                   ILLLSSDHLYHSIWSVKHPVDSKEKRFFMGNITFSFSWTTSVVDVQEPLPAHSHGLSYV
FT                   WVYVGDEHGVQGQFNLLIGQAATCTKKKAMRPNQTLRNFYGILCKVVHKRQCSLRARNP
FT                   KPSGTEITAYNILGKSIRAWPDLEWGYNVSREIFFSRILCPD"
FT   CDS_pept        join(142726..143358,143484..143537,143716..143935,
FT                   144338..144433,144464..144606)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810130"
FT                   /orf_name="An17g00610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42989.1"
FT                   /db_xref="UniParc:UPI0000EFCFDE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R998"
FT                   /transl_table=1
FT                   /translation="MRFWSWLRGEPRREYYYKKRLQEIKDHIGYDTPKDPVKKWISEFN
FT                   DEETLGFAIIQRQRRLENEKKTAEEQQQREERRQFRRRRCEQCRYQEEMCSACHEATQA
FT                   ADVPPPYSSRSPEDFKQDLAKLREEFVKNRIRLEAIKQKLTDSRSWWVTYAMAPRWHRD
FT                   DTGRTFKWIEGRRKCADLGGCCGRTCGCCEKVLIEYQRPKFWRKTHSKTVPSSNINNSL
FT                   NGRQTIVIVMAEAVDANATLSFWQKLDPSHARWLFLAVFVIVICNVLFGAVRLYLELLI
FT                   KRHHIEKLRAMPPSRRRDVEMGHRFIFSSRLDGSSPMGFIGVQGVLETIWINAIEPFSI
FT                   INLILTSPCDSNLRNHGSEAQDDDLERRVKVYTGGKGDKRR"
FT   CDS_pept        join(complement(146767..146820),complement(145468..146715))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890666"
FT                   /orf_name="An17g00620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42990.1"
FT                   /db_xref="UniParc:UPI0000EFCFDF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R999"
FT                   /transl_table=1
FT                   /translation="MEFSTKRRTSFSFLFGSQKPTLITQQSQPAHNQPTRYWDFVDSPG
FT                   TYQPPSPLVDRPNIPTDVEEQIRNACSLLVYKIGKGQQSGSSKRSRAVTTNTTMHESST
FT                   APQIDSMYVSPKVGADVAALKNKYDSGVALTQQPSMQAMRVLHSQTSQNLKCDSLKSGR
FT                   ATSSHSALPSDGTQSSSAPPSRAGYDNQVIGSGKWSRDRGQSVKPFLDGSESESHSNED
FT                   GPQFVDAVCGDDVEVYLDPETTLMSTGVPSFHSPHSVPSNISPGLGKSVEPSPNGHCGV
FT                   AGLETPTVQPPEYTAPLDLGSSAVEESKQHPGIIIDSSGLAHVLTAADESERDMNIQQA
FT                   VMAKMRTGTIANASSPHLPVYTESTDNVSNLRPGSNASRLKTSWSTMSKATSRKLRSRG
FT                   TEDAPVNDKTVFRRLKNLFSKRKPVNVVPPVGTH"
FT   CDS_pept        join(complement(150821..150854),complement(150367..150757),
FT                   complement(149274..150309))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246301" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890667"
FT                   /orf_name="An17g00630"
FT                   /product="Catalytic activity: Acetyl-CoA + L-homoserine [ "
FT                   /EC_number="2.3.1.31"
FT                   /function="homoserine O-acetyltransferase activity "
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK42991.1"
FT                   /db_xref="GO:0004414"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="HOGENOM:HBG692920"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="UniParc:UPI0000EFD010"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9A0"
FT                   /transl_table=1
FT                   /translation="MVAQATAPGQFQRADSQPENPYSALITDQTIVTIPSFTLESGVTL
FT                   HNVPVAYTTRGQLSPERDNALVICHALSGSADVADWWGPLLGGPGQAFDTSRFFVVCLN
FT                   SLGSPYGSASAVTYKDGDPSKGLYGPEFPLTTVRDDVKIHKMVLDDMGIRQIAAVVGGS
FT                   MGGMLTLEYAYFGKDYVRAIVPIATSPRHSAWCISWGEAQRQSIYSDPKYEDGYYPFDD
FT                   PPATGLGAARMSALLTYRSRNSFESRFGRNVPDPSKRQTINGQERSPTPPNEHWAIHND
FT                   GHKSGRSSPGPQSDAQHSEVQFQDPQFSGAKTFSKTIETNGSQKRLPTYFSAQSYLRYQ
FT                   GEKFVKRFDANCYIAITRKLDTHDVSRHRASPSAENPVREALSQIQQPALVLGIESDGL
FT                   FTFDEQKEIAAGIPDSRLKRIESPEGHDAFLLQFEQVNRYILEFFREVLPDIMSKAPAE
FT                   GVQAVDGVNKLTKSSTFGEAEVEDITAW"
FT   CDS_pept        complement(151761..152795)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657469"
FT                   /orf_name="An17g00640"
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42992.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326376"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFD011"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9A1"
FT                   /transl_table=1
FT                   /translation="MAPTNTAAWLKSEKAYPLEIDTAPYTHPGENELVIRNHSIGLNLV
FT                   DYARQDLGSALFAWTPYPAILGSDVAGEVVEVGPGTISSRFKPGDRVLGLTGELKSTRS
FT                   CQGAFQTYVVLKAHMTSPIPSNLSYADAAGIPLGISTAACGLFQKDYLALQHPMAPQAP
FT                   STGQTVLIWSGSSSVGSNAIQLAVAAGYEVITTASPRNYDFVKSLGASHVFDYNSETVV
FT                   EDLIATFAGKSSAGALAIGTGSPEKCGEIVARVEGRKFVALVSPPSGPLADGVESKFVF
FT                   GGDLAENEVGPAIFVDFLPAALKEGSFVSAPKVEVVSEGLESVQEALNVLKKGVSAKKL
FT                   VVSL"
FT   CDS_pept        join(153116..153249,153322..153954,154000..154218,
FT                   154280..155273)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890668"
FT                   /orf_name="An17g00650"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK42993.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG326419"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EFD012"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9A2"
FT                   /transl_table=1
FT                   /translation="MDQSPTDQSPTEYDLAPAPYGRACMNCSQSKCKCILPKGGGRCQR
FT                   CQRLNKECRPSAFHRRQNARKPSKTGRLEKKLDDLVTLLRAQAPSHAHAGDYAELIDDL
FT                   RREPDEDLHHHPPPPRSQIKVTRTVSTAEKSIDCEFLNHFAQVGANTSSRDESNASAAE
FT                   PSWSQAEEYLSMFVTQKLPYLPFVYFPPGTTAQHLRSDRPFLWLCVMAVTAKSPSQRRT
FT                   LCDRIRDTVAQRMVLDCYGRDLDFLLGLMVYIAWSNQQIFKRLNMTIYSQFATAVVFDL
FT                   MLNQAPGGDKPSLLTILQTHPDEDPSPPRARTMDERRAVLGCFLLTSSISLFLEKSEPL
FT                   RWTPHMDECLHHISEHPECLNDEILAQQVRFQLINERINTTATTTTDFYHTSLLSPSPF
FT                   RPPLSIYTHAIDTHLQQTQSKLTPHSQRYRILQLHHSNTHLTIHESALLKPFPNPSTTQ
FT                   PPNPPLTINHHLHHLESLHACLSAVNAWITSFLAIPPAEYAGFPFPIFSQLVRHLAALY
FT                   RLSTLDDPSWDRGFVRRTVDLMSVMDRLIGNLGQAAALARLEAQGEDEDEDVFFYSIGK
FT                   YESVRLKWGGVFGGSAPGNGNGNGVNGGVVEGQGVQDGVGGSNGLGLGLGQAQGHAQAQ
FT                   AQEMGGWGAGYDDWLSEFLNSMVH"
FT   CDS_pept        join(complement(156820..157087),complement(156460..156749),
FT                   complement(155793..156381),complement(155468..155715))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158582" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810131"
FT                   /orf_name="An17g00660"
FT                   /product="Similarity to hypothetical oxidoreductase
FT                   SMc01972 - Sinorhizobium meliloti "
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK42994.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG328055"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI0000EFD013"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9A3"
FT                   /transl_table=1
FT                   /translation="MGSNTATNTMLPPDNPITPFWRTQLDPLDDIRSTPDLPPQSDIVI
FT                   IGGGYSGVTLAYYLLKQLSKQGDKSTSITLLEARQICSGATGRNGGHLRPDIYGHIPTY
FT                   IERSGLEAGLEIAEFEYAHIQALKDLLREENIDCDLNITRNMNVYLDEESAEKAKLAYE
FT                   MLQARGVKLAEDLHYTGKRDAEVISGAHNAKACISYTSGTLWPYKFILGLLSKIIKFPQ
FT                   LNVQTYTPVTSITSEDNINIISTPRGSLRARKIVYATNAYTAGLLPEYSANIIPCKGIC
FT                   CHITVPEGEGKKPAPFLPYSYAIGYGSDVVGGGSYLISRPDGSIIVGGAQATFKDKREE
FT                   WYGIVDDTTLIESAKSYYDGYMQRTFRGWENSGAYVKEIWTGVMGYSSDSHPHIGEVPN
FT                   KPGQYVCAGFNGHGMPVILLSAKGLAEMIQSGKKFEETGMPRLFKTSVERMEKARNGPE
FT                   GGDIFA"
FT   CDS_pept        158296..160260
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890669"
FT                   /orf_name="An17g00670"
FT                   /product="Similarity to hypothetical protein EAA63916.1 -
FT                   Aspergillus nidulans"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAK42995.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG329019"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI0000EFD014"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9A4"
FT                   /transl_table=1
FT                   /translation="MTDYSKWKVTDLKAELKRRGIAQTGLRVKQQIIDRLVEEDARDEK
FT                   DAVANGEPAAEQDVAPQEAQPVDAEQPVPEPEPAADAPAQPEATESEVIDKQTEEPAQE
FT                   QEQQQAQTEEQGDAVPESKPQPVTDEAPAEQAAEQGQQQEQPEQPVQESPKPEEPAQPT
FT                   DTTTVNQPADTSIPQDQTENDTAAAPVEQAPGEAAPEQSEDMEPNPAEPAASGETAAPP
FT                   AAVPSEMNTGLSTPLPTEEMLEDRRKRKRRSQSPVPTPEALASKKAKALDETPRVVLPE
FT                   DRAAVDKEHESRPDEALSGPQGTPEERAGREAAPEEAPPVQDETSKKGAPLKHDVRFKG
FT                   LFAAKETEQTRPVSPPPADAVMEDADVEPAVHAATAALYVGGLMRPLQPVALKNHLVSL
FT                   ASPPDASPNPDVVVDFYLDPIKTHCFASFRSVSAASRVRTALHGTVWPNERNRKTLFVD
FT                   FIPEDKLSLWIEKEEGSRQRGGPPARWEVRYEPTDDGVEAVLEEVDPRSASSQHMRAPD
FT                   ASGFSRPPPTGPRAELGAPRRPSGPVTADSSSRPGQGFKPLDELFMSTTTKPKLYYLPV
FT                   PREVADRRLDRFDDLLRKGEFPRRGGDERRRITFEDEDFFVDNGPDFGGGRNRRGRGRG
FT                   GRGRGGFGDSWRDDRRSRY"
FT   CDS_pept        join(161371..161455,161495..161645,161715..162012,
FT                   162070..162195,162242..162391,162446..163282)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172979" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890670"
FT                   /orf_name="An17g00680"
FT                   /protein_id="CAK42996.1"
FT                   /db_xref="HOGENOM:HBG329020"
FT                   /db_xref="InterPro:IPR005178"
FT                   /db_xref="UniParc:UPI0000EFD015"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9A5"
FT                   /transl_table=1
FT                   /translation="MGWPVCNSTSEDETSRQPPPLRLVDCDSVTEVDLWDGGITFHQLC
FT                   LIMGGAFGLMAILVSFYLIGMHATHYSKKIEQRHIIRILLMVPVYSVVAWLGTYFYKND
FT                   VYYDLIGNCYEAFAISAFFSLMCAYIAPDLHSQKEYFRGVEPKPWVWPIPWLQKCTGGE
FT                   KGIWRTPRSGLTWFNVIWVGVFQYCLLRVLMTIIAVVTQKFNLYCEESLNPAFSHIWVL
FT                   LIECIAVSIAMYCLIQFYIQIKDDISQYQPFLKILSIKLVIFLSFWQSTLISFLTSAGA
FT                   IKTTSKIQSPDLKVGLPNLLINIEMAFFAVLHLWAFSWKQYSLKNQPSEITDFYGNGKG
FT                   SYEGGPFGVKGILDALNPMDLIRAIGRSFRWLFVGRKRRTMDPSYHQTANDAFNMNATE
FT                   SGIDSHGTEYGGAGVMMAGGRYSPPGEEGQVLLSHAQPSPGGPPPPIDDETDPNRFYNH
FT                   NRLSAASLLEPTATHTARPYSPYEEDACNPYLVNSHLEQDHYHEPVHANPPYPDHPTTT
FT                   LQEQPPIPLPESYQPPPPNYDSDHQQQQQRR"
FT   CDS_pept        join(complement(165032..165302),complement(164531..164969),
FT                   complement(164020..164416),complement(163833..163889))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172990" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114350"
FT                   /orf_name="An17g00690"
FT                   /product="Complex: COPS6 of M. musculus forms part of the
FT                   heterooctameric COP9 complex"
FT                   /protein_id="CAK42997.1"
FT                   /db_xref="HOGENOM:HBG329021"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI0000EFD016"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9A6"
FT                   /transl_table=1
FT                   /translation="MSDQPESLLSPKNSDSGLHIQLHPLILLTISDHITRHAARSQQGP
FT                   IVGALLGQQNGREITLEHVFECIVNEGPNGDLQIPQDWFVERVKQFKDVHKAPALDLVG
FT                   WWSTAPPSGPNTVHLPIHRQILHNHNESAVFLAFHPSLVQDASSNGGKLPVTIYESVYE
FT                   GENATENSKTMQVDGEEQSLTIRFRELPYSVETGEAEMIGVDTVARTARNAAADTQGTA
FT                   SLTKQSAGKEPSKDHLTTRLNAIKTLESRISLIKSYVASNSTSDPETPTSTTTLSHPIL
FT                   RNINALLSHLSLLTPDERSAFTAEAIAQSNDVHLVSLLGQLGQSISAMRELGKRTALMN
FT                   SVRRTMMSRKTQQLSWQNRFTEPFSTGDGTCTTTHFINIYNLLLLPL"
FT   CDS_pept        165536..167485
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173001" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890671"
FT                   /orf_name="An17g00700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42998.1"
FT                   /db_xref="HOGENOM:HBG324932"
FT                   /db_xref="UniParc:UPI0000EFD017"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9A7"
FT                   /transl_table=1
FT                   /translation="MAVPSTYDEVRQHLEQVQREPSTPLDTTLLDKLKLELTENVDRRV
FT                   PATLLIQISQLLPVLQEDPTPLTALGVKATTYLSFADLHSVDPPINFIAGFKAPSEPIN
FT                   LLALSLLRKAGHVASDAAIVAGDPELVSSLVELWLSTSSTAVAQAAFDTIWELLEVDSA
FT                   SPLENSGHEGEEATGGQGLVWRRIFTDKDVYGLLFSLCSLKENGSGSLSKRDKTVAQGR
FT                   LMGLLVKAGRLHWDIISKPQVPEVERKYQSNGLLHFAACHMVDKDDVLMHMTLINFFHD
FT                   LLEIDAPGLIARTIVQSASTFSSPALDFLISHKIHSTLLEYYLDESKLDAVDLAYLCGP
FT                   IMTYVAQYAELYPNHFLQNPQYLLDRILSRIAASVAVSSSQWAHGPVPSGQLNVLSCLP
FT                   RVLLVEASKQGLNPVLALPTSPPNKEALDVLAKILHGPIKQDLTDSMELNASGQMPTDW
FT                   HKEAAAARTLYFMYTNHHANFWTDVVATADILAMKDVSLASISLMKSLITANWQILTGE
FT                   VTSSVPGTSRYQLPTEQALESLSPATQGVLPSSGAWAALTPPALTILLPYLFKPPRSYA
FT                   EFVGGGAGDSQHAVWKVATAKYEVLVALYDCLKENGGQMEGFEDIMRTLRQRVNEGPWG
FT                   PVSQTTNQVATIGL"
FT   CDS_pept        join(167930..168037,168214..168487,168554..168954)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173012" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890672"
FT                   /orf_name="An17g00710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK42999.1"
FT                   /db_xref="InterPro:IPR016264"
FT                   /db_xref="UniParc:UPI0000EFD018"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9A8"
FT                   /transl_table=1
FT                   /translation="MSRFGAKKGRKLPGAEFTWEADPSGEPDTAPTPLFPVLIMSLYNQ
FT                   KYTVPRARPLTSQEQLQVDFYRTLRERFHDGPYYSILEGAGSTMKKDSAARVNFDPFHG
FT                   MPSYSGKYQKKKRALPRLQGRQYVMKFFPRELWQTIQPTFKPDAAMDGYVPQVARAGVK
FT                   RGFEDDDEEEDEDAAKRAKAGGEEGEGAEDDDDGDGDILDPEEEQEGEEEIEDDDFEDD
FT                   DDEMGGDYNAEQYFDGGDDEYGDDGFGDGGGGGEEDTY"
FT   CDS_pept        join(169437..169592,169699..169874,169942..170040,
FT                   170100..170315,170376..171615)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890673"
FT                   /orf_name="An17g00720"
FT                   /EC_number="1.-.-.-"
FT                   /function="FMN binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43000.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG736048"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="UniParc:UPI0000EFD019"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9A9"
FT                   /transl_table=1
FT                   /translation="MDGNPSTPPRRSALVLYGSETGNSQEVAEELGALAERLHFHTHVG
FT                   EMNEYRPEVLKSHTLVIFVVATTGQGDFPANARSFWRSLLLKRLPGDFLDGVQFASFGL
FT                   GDSSYPKFNWAARKLHKRLLQLGANEIYDAGEADQQHPEGLEGTFIPWLTGLRTHLLET
FT                   YPLPEGLEPIPDDVQLPPKWILKLQEGNAATAQEGHAVPGTHENLPAPEENPKENKRLT
FT                   PQKHWQDVRHVSLTVPEHTSYVPGDMLCITPKNFSADVDALIQMMGWEDKADQLICLVP
FT                   NSHIPADDLPLPPIRGLDSYPQLTLRALLTDYLDIQAIPRRSFFAEIAHYTNDEMHKER
FT                   LLEFTYTSPEYLDELWDYTTRPRRSILEVLHEFDTVKVPWQHAISVFPVLKGRQFSIAS
FT                   GGELKRGPEGGTKFELMIAIVKYQTVIKKIRQGVCTRYISALRPGSTLKVQLQRGGLNS
FT                   SVNQLVGPTVLVGPGTGLAPLRSMLWEKAAIIKAYQEENPGVELGIGPTLLLYGGRNRE
FT                   ADFFFEDEWQQLGQLTKLNVLTAFSRDQKQKVYVQDVIRQNYALLFKLLHDMAGSVYIC
FT                   GSSGQMPKAVREALTEAFQHGAEVETDRFNEQGAEQYLLGMEKTGRYKQETW"
FT   CDS_pept        join(172095..172145,172336..172996,173057..173139)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890674"
FT                   /orf_name="An17g00730"
FT                   /function="electron carrier activity"
FT                   /protein_id="CAK43001.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="HOGENOM:HBG716515"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniParc:UPI0000EFD01A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B0"
FT                   /transl_table=1
FT                   /translation="MSGLRILVPVKRVIDYAVKPRVNKANTGVETAGVKHSLNPFDELS
FT                   VEEAIRLRERGAKNQSPMKVENILALSAGGAKCADTLRTAMAMGADRAFHVDVGESPDG
FT                   GPEPLTIAKMLQGVVKSENINLVLLGKQAIDGDQGQTGQMLAGLLGWPQATQASKVDIK
FT                   DADGTVEVTHEVDGGVETLRAKLPMVITTDLRLNEPRYATLPNIMKAKKKPLEKKTLAD
FT                   FGVEDKKRLKTLKVTEPPARQGGGKVEDVDGLIGKLKELGAL"
FT   CDS_pept        join(complement(177313..177458),complement(177053..177147),
FT                   complement(176918..176966),complement(176572..176838),
FT                   complement(176333..176453))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890675"
FT                   /orf_name="An17g00740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43002.1"
FT                   /db_xref="UniParc:UPI0000EFD01B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B1"
FT                   /transl_table=1
FT                   /translation="MRQSIIAGAVAVVDEDGPSNSHKVPMRPGMYKRQQTGATEVGMTT
FT                   EECGPSLEWVASSWRTGDIRGKEGGEPWDGQMGFGDETAANFRVRSKQEQGQDVGWMYD
FT                   RELMQSGGGGGRKSKQASKQKGKRRTDPLTECERGRQELNGRSLESRGCEPGTNTHTAG
FT                   SEGHGWTGKWEGSKWLAGDGTAGLVPDAWHHGSISVIAFAAPDKPIGLDFSTFIICPSA
FT                   VRM"
FT   CDS_pept        177544..179541
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890676"
FT                   /orf_name="An17g00750"
FT                   /product="Similarity: the Sh3 domain is outside the
FT                   homology region"
FT                   /protein_id="CAK43003.1"
FT                   /db_xref="HOGENOM:HBG329025"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniParc:UPI0000EFD01C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B2"
FT                   /transl_table=1
FT                   /translation="MPSTLWEKTKGTSKKGFDKAWHTLDKLGDPVNRLSYKVGAEAFWP
FT                   MTLDKESDKAARILRSFCKDGFYSNDEAERKSTDSSISKESGKIDRPKGKQRVLKKIPA
FT                   RVIQRAKGLAIFTTMRTGLWVSGSGGSGVLLARTPDTNEWSPPSGIMLHTAGIGFLAGV
FT                   DIYDCVVVINTYEALEAFKKVRCTLGGEVSAAAGPVGMGGVLDSEVHKRQAPIWTYMKS
FT                   RGLYAGVAVDGTIIIERTDENERFYGERISVTDILAGKAKRPPASIQTLLNTVKAAEGN
FT                   PTVDENLLPPGETPGDVELAPGPGSFGIPDPEDPDPFGVKALEAEGLFIREAGSKSRPS
FT                   QEAFEFKPGPNSPIFATFRRSIDSSPRNSWRASVQSYASMDRGTQTDDGPTTAPTSISR
FT                   ASSRSYRDVSDRAETSPWDNEEGRWETVIPEHDEYHGRDDVEEDVDLEDDDVEIHEVSS
FT                   ATVSKRESAAHSPVPIEDSIAPVEFKRHSPTFTRARLVTIPKRIPPALPPRNPQRTPAP
FT                   VSTSTPSSPTANPYAHSRRRSVASSPGHATYGFTGMPLYHKSDSESDLSSAGAPESSNK
FT                   PSPDREEFHSVSSLHDSDVASEKETEAKEAKEIETEENHEPSSDASTPTYVHESDVSPW
FT                   AKSDTDLAPTKTITSDDHVKVDSTAQPQAV"
FT   CDS_pept        join(180349..180507,180574..180960,181018..181508,
FT                   181536..182370)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000157125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890677"
FT                   /orf_name="An17g00760"
FT                   /product="Catalytic activity: Peptide + H2O  "
FT                   /EC_number="3.4.16.6"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK43004.1"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG323860"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI000004F621"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B3"
FT                   /transl_table=1
FT                   /translation="MPFPFSSALLGYILTTSTTLTSLVAGQYYPPTPEDLTVIHSEIFP
FT                   GARISYKQPLGICTTTPSTPSYSGYIHLPPHTLTNLSIPGISISQPYPINTFFWYFPSR
FT                   HHHNNDTSPLTIWMNGGPGGSSMIGLFQENGPCTVNTDSNSTAYNPWSWNEYVDMLYIE
FT                   QPVQTGFSYDVLRNGTLDLNETFLVGTLPSQDVHGTVNGTVNGGRALWVALQVWLGEFS
FT                   EYVSSVDGNGGGDDRVSIWTESYGGRYGPAYTALFQEMNERIESGEVSTGKKIHLDTLG
FT                   IINGCVDLLVQVPSFPEQAYNNTYGIEGINRTLYDRAMDSWSKPGGCRDMIIECRDAGE
FT                   LGDPLIICEEASDYCSREIKSLYTNTSGRGYYDIAHFTPDAALVPYFVGFLNRPWVQKA
FT                   LGVPVNYTMSSEAVGNSFASTGDYPRNDPRGMIGDIGYLLDSGVKVAMVYGDRDYACPW
FT                   RGGEDVSLLVEYEDAEKFRAAGYAEVQTKSSYVGGLVRQYGNFSFTRVFQAGHEVPFYQ
FT                   PETAYEIFNRAQFNWDIATGGISLEQNQSYGTEGPSSTWHIKNEVPESPEPTCYLLAMD
FT                   STCTDEQRERVLSGDAVVRDWVVVDDIEAESSFSGVGDQLAQVPLGH"
FT   sig_peptide     180349..180426
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B3 "
FT   mat_peptide     join(180427..180507,180574..180960,181018..181508,
FT                   181536..182367)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B3 "
FT   CDS_pept        join(183127..183274,183342..184027,184081..184377)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114351"
FT                   /orf_name="An17g00770"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAK43005.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0000EFCCBB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B4"
FT                   /transl_table=1
FT                   /translation="MVAETKLYDALSIRPDASQDEIKKAYRKAALKYHPDKNKDNPTAS
FT                   EKFKEVSQAYEVLSDPEKRKVYDQFGLEYLLRGGPPPTSGGGGADGPNPFEGGMPGGFS
FT                   FGGMPGGGGGGTRTFHFSTGPGGGGSGFRFSNADDIFRNFAKGSMGGMGGGMGGGMDDD
FT                   DIFSMLGGGLGGGRNFRSSRGPSGFKQSSQRAPTPEPTVMEKELPLTLEELMRGTTKKV
FT                   SVKSKTFDASGKRTVQDVTLEANIKPGLRTGSKIKYRGVGDQEEGGRQDVHLIVTEKEH
FT                   PNFKRQGDNLVTTVELSLKEALTGWERIVRTIDGKSIRVSKPGPTQPGHEERFPGLGMT
FT                   ISKKPSERGDLVVRVNVRFPASLSASQKDILKDVLP"
FT   CDS_pept        join(184890..185042,185133..185345,185417..185755,
FT                   185841..186647)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172779" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114352"
FT                   /orf_name="An17g00780"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAK43006.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="HOGENOM:HBG329026"
FT                   /db_xref="InterPro:IPR013233"
FT                   /db_xref="UniParc:UPI0000EFCCBC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B5"
FT                   /transl_table=1
FT                   /translation="MKTRITYLQPPSSPFTSTQATLTPSSLKISDLDAAKEVRVTVDLS
FT                   EVDDDEVRSILTNLHEVHIRWAREQPYGIVSPFGSRVSAGLGVGVSPLQGGDDGDGEGV
FT                   CRLLRRMFGTGIECANYMDSFTSPPVVSTRFASTSTYQFHSSLPEHNLGEYIVKNICRE
FT                   EGAACAAEWGAADSIDVDYDAVSRALVVSGYWGQPVTPEGWTEEIRAPGRDRDRVEVGL
FT                   LGTEKAVEAEEIKWCANCSEPTLFSFPSRHHVLPREATFDVSFPRPTGTHPTMTISLSP
FT                   AALEYPAAPEDTTCALHAYLTLPSYIFGDKYQLSTDDPLFLESHHLVALRAVSGATDLE
FT                   APDWFVPHWGSNWLLELATPSAGQVPEEWNVTVPLHLRYLRPSESGYRSAGVPWPVVFW
FT                   ACTAEEGTKMGTNPFDRLNLGWDGMFGPRTMFYQVHPSGEKTRHVEDLDVPVLRLEEGG
FT                   FFSSKTVELGTMAAIVLGLLWVLWKLGSVARSSGRKKSDKEKKSQ"
FT   CDS_pept        complement(186695..188431)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114353"
FT                   /orf_name="An17g00790"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43007.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG325572"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EFCCBD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B6"
FT                   /transl_table=1
FT                   /translation="MTEPSRKRSRVACTLCQSRKRKCSGDQPCTTCAQFGSDCHYDLQS
FT                   RRKRDARLFQLQSAASAESPVAPDAAHPPRHEHKISPEETAARLSSLDANSGAAFARRL
FT                   GLKVDPTNAPKMHLFAWNVGARHLPPPSMPPSSAPKAVPITDTISQDEMRSLVAIFFDK
FT                   VDPCYPFVDRDTLLRQVSRRWLPPTAESALLYSPYDAVLSGVAAFGYLFSRRQSSSTEL
FT                   QLAETARLILEQTLLSDTTPTLDTVTAWVLRVAYLRLTSTPNLAWTASCTLMHLIEATG
FT                   LHLEQPSSDAINQLPTPVDPDLRRRLFGMARHLNVWISFELARSRVVLHGATSLPPTPR
FT                   VPGTPEIFTLLPMSESLDPNTIKTPDPPELESALRNVLDQSHVLPQLILVQCNLMLCIY
FT                   RRLRALNCIISGDLLDRVLALSVKGLQAAREMVATTCPWHQIANVPFQVVCTLLAIDNR
FT                   ASLVMLGGAMRTLREVAAAYDTEVMREAYSTAYLLILLHQRRKEEDTKALKDVLRVNSG
FT                   ASAEQFEMGQEVSPAADGGGGSMEPHHSLADYPGFSWLSDLLIDIPSLGSFDMERFMYT
FT                   DV"
FT   CDS_pept        join(188915..188997,189045..189831,190103..190163,
FT                   190209..190738)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890678"
FT                   /orf_name="An17g00800"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43008.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EFCCBE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B7"
FT                   /transl_table=1
FT                   /translation="MPAVRACTNCVRAKTRCALSGASGTCERCVRLRKACQPSPPVRKR
FT                   RVVAKASAKDVQKLEEKLDGLYSILQGQTGLLNGPMQPAQEPVIPAPHTDETVSLPIPL
FT                   TQDLSGTTCSPAAPSLEQPRATSYEPNDDDAELYLARFRSDFIDHLPFLDIPVSQSAHQ
FT                   LHEESPLLWLAIMTVASTRTTQQKAMSRQMREAFGREAFVEGTRSIDFLLSVLVYATWD
FT                   RYYALDKPLFTSLMQLAIAIVYDLGLDKPPVQDPSLLLSYDLKGHNRPSHYSRLPTMQE
FT                   RRALLGCFLSFQKQIRTFRSQIPLELTNNKILQMELYSAEMMIHEIGFSSDPTIFPRQS
FT                   NQQFECLCACLQTIKSWTDNILALQPVEYVGLSCLMCANMARSFINLYRLTVCDYPVWD
FT                   RKLVQETIDVSWVLERAAQRFTQVKDAAGLDPEGTQELDFFMIMAAKMEAMKMSWDTAV
FT                   MPMMEDSWEPTLDDLDMFSSEFRNMWSW"
FT   CDS_pept        191074..192009
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15890679"
FT                   /orf_name="An17g00810"
FT                   /EC_number="1.1.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43009.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCCBF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9B8"
FT                   /transl_table=1
FT                   /translation="MPFHPTKDIPDLTGKTILITGANSGLGKTSVLEFSRHNPSQIWLA
FT                   ARNLTKAQSAADEIKQQVPTARIHLLELDLSSFASIQKAVEVFLSTATRLDILMLNAGV
FT                   MAAPPGMTPDGRYEVQFGTNYMGHALLTRLLLPIMEKTAKRDDAGVGGRVRIVAVASHG
FT                   QRYAPPGGLQFETFKTNGESMGPFARYGQSKLALVLWVRMLAQLYPWLTAASIDPGVVG
FT                   TTLGDGATGAPRYIQFLFKVALVLRLAASLENGVRNQLWAAVSREVNSGEYYDPVGVVG
FT                   KSALGRDEELARRLWVWTEGELDNYLGVRD"
FT   CDS_pept        194004..195365
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000038087" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657470"
FT                   /gene_name="cpa1"
FT                   /orf_name="An17g00820"
FT                   /product="Carbamoyl-phosphate synthase arginine-specific
FT                   small chain"
FT                   /EC_number="6.3.5.5"
FT                   /function="ATP binding"
FT                   /function="carbamoyl-phosphate synthase (glutamine-
FT                   hydrolyzing) activity"
FT                   /biological_process="arginine biosynthetic process "
FT                   /biological_process="glutamine metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK43010.1"
FT                   /db_xref="GO:0004088"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="GO:0006541"
FT                   /db_xref="HOGENOM:HBG286341"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001317"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI0000EFCCC0"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R9B9"
FT                   /transl_table=1
FT                   /translation="MFARVFKAMPARAPAFTSVNASIQSRFMATVRQGRPATERATFTI
FT                   RDGPIFHGKSFGARSNISGEAVFTTSLVGYPESLTDPSYRGQILVFTQPLIGNYGVPSA
FT                   ERDQHGLLKYFESPNLQAAGVVVADVAEQYSHWTAVESLGEWCAREGVPAISGVDTRAI
FT                   VTYLREQGSSLARITVGEEYDADQDEAFVDPEQIHLVRQVSTKAPFHVSAADPQCHVAV
FT                   IDCGVKENILRSLVSRGASITVFPFDYPIHKVAHHFDGVFISNGPGDPTHCQDTVYHLR
FT                   RLMETSQVPIFGICLGHQLLALANGARTIKLKYGNRAHNIPALDTTTGRCHITSQNHGY
FT                   AVDASTLPSDWKPYFVNLNDSSNEGMIHKTRPIFSTQFHPEAKGGPLDSSYLFDIYLDS
FT                   VVKYKNHQLAFHPNRNTVPSPLLVDLLAKERVGVQPTIGMQNVAAAAAAAVAAA"
FT   CDS_pept        complement(195826..197574)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963313"
FT                   /orf_name="An17g00830"
FT                   /product="Catalytic activity: tannic acid + H2O  "
FT                   /EC_number="3.1.1.20"
FT                   /function="tannase activity"
FT                   /protein_id="CAK43011.1"
FT                   /db_xref="GO:0050318"
FT                   /db_xref="HOGENOM:HBG325297"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="UniParc:UPI0000EFCCC1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C0"
FT                   /transl_table=1
FT                   /translation="MRSKMSLLAGTAALSFAQATSLADVCTSSYARSVAPSSPLMGVTV
FT                   DTTSITANPVYNYSSASTAFWPASTFDFCNVTLAYTHDGLDDQVLLQFWLPAPADFKNR
FT                   WLSTGGFGYAINGDSADLPGGVMYAAASGQTDGGFGSFSTEFDAVFLKANGTIDRQALY
FT                   MFGYQAHYELSAVGKAFTKNFFNLGSSKLYSYYQGCSEGGREGWSQVQRFGEEWDGAVI
FT                   GAPAIRYGQQQPNHLYPGLVEYTMGYYPPPCELEKINNLTIAACDALDGKKDGVVARTD
FT                   LCKLHFNVNSTIGAPYYCPAETTTTVLKKRLSTSNTTPAQNGTVTKEGAAVAAKILDGL
FT                   KTLDGKRAYIWYQPSATFDDAETEYNSDTDSWELDITSLGGEWVAKFLELRDVDNLSTL
FT                   DNVTYDVMTNWMSLGWQRYEDVLQTTWPDLTPFHSNGGKIIHVHGESDPSIPTGSSVHY
FT                   HESVRKTMYSSLSFNESSDALNDWNRLYLVPGAAHCSYSTDQPNGGWPQSTLPTLFDWV
FT                   ENGQKPDRLNATVQEGENYGQVQQLCAWPLRPYYVNNGTELTCVFDEESYQTWVYDFDA
FT                   YELPLY"
FT   mat_peptide     complement(195829..197505)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C0 "
FT   sig_peptide     complement(197506..197574)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C0 "
FT   CDS_pept        join(complement(200163..200191),complement(200058..200086),
FT                   complement(199983..199997),complement(199896..199920),
FT                   complement(199506..199824),complement(199337..199446),
FT                   complement(199141..199286),complement(199029..199086),
FT                   complement(198812..198976),complement(198541..198748))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890680"
FT                   /orf_name="An17g00840"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43012.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG631304"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="UniParc:UPI0000EFCCC2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C1"
FT                   /transl_table=1
FT                   /translation="MVNITEKIKEIEDEMRRTQKNKATEYHLGLLKGKLARLRAQLLEP
FT                   TGGSGGGGAGFDVSKSGDARVALVGFPSVGKSTFLSKITKTKSETAAYAFTTLTAIPGV
FT                   LEYGGAEIQILDLPGIIEGASEGKGRGRQVISAAKTSDLILMVLDATKRAEQRALLEAE
FT                   LDAVGIRLNKEPPNIYLKQKKAGGMKITFQTPPKYLDEKIIYNVLRDYKMLNCEVLVRD
FT                   EYATIDDFIDVIMKDHRKYIRCLYVYNKIDGVSLDFLDQLAREPYTAVMSCELDLGVED
FT                   VVDRIWKELRLIRVYTKRKGEEPDFSEALICRSNSTIEDVCDNIHRTLKETFKYAMVWG
FT                   ASARHIPQRVGLGHVVSDEDVVSIVAK"
FT   CDS_pept        200535..201761
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172735" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810132"
FT                   /orf_name="An17g00850"
FT                   /product="Complex: Cwf2p of S. pombe is associated with
FT                   Cpc5p in a 40S RNP complex"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK43013.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG626362"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EFCCC3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C2"
FT                   /transl_table=1
FT                   /translation="MAEATPPTETVTPPTEEVVEDQQQTQQQENETTEETTALTTTADG
FT                   AVEPQKKTKKIIRRKRRPARPQVDPATIKSEPPPQVGTIFNIWYNKWSGGDRENSYLSK
FT                   TAAPSRCNIARDSGYTRADKVPGSYFCLFFARGICPRGAECEYLHRLPTLHDIFNPNVD
FT                   CFGRDKFSDYRDDMGGVGSFMRQNRTLYVGRIHVTDSIEEVVARNFQEWGQIDRIRVLT
FT                   SRGVAFVTYTNEANAQFAKEAMAHQSLDHNEILNVRWATVDPNPLAQKREARRLEEQAA
FT                   EAVRRALPAEFVAELEGRDPEAKKRKKIEGSYGLQGYEPPDEVWFSRAKELEDANAIAQ
FT                   LEAPEQPLMIEGASETAAAAPQEEQAGGIFSSSAVAALKGLAGGAVTTQQAPKAAGPLV
FT                   AYGSDDDSE"
FT   CDS_pept        join(complement(206809..207027),complement(204705..206750),
FT                   complement(204320..204649),complement(202837..204270),
FT                   complement(202344..202785),complement(201984..202291))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172724" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890681"
FT                   /orf_name="An17g00860"
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of translational initiation"
FT                   /protein_id="CAK43014.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006446"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG397659"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR016255"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000EFCCC4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C3"
FT                   /transl_table=1
FT                   /translation="MPHKQKKNFSNAPKHGSPRAEKKQQLRPDSPSFSPPVVAPTNYQE
FT                   IHQNEVEALRSIYGDDFEEVQHRRSAWQQSSEVSFKLHLRASSNPDVHLELLVELPTTY
FT                   PKTYPNLSLENLDDLRKGARSRIQDIIQNKPKTLLGSEMIYELAVSIQDVLEDVAEAQA
FT                   QDKDLPSLEEERMEQEAAANQRAELERQEEIRKQEAATAEEERALQQLLEDKVRERAKA
FT                   RLSRRKSRTPGLDANGDADAVENIPGAITFDPPLAMTDSDQATLVFRAVYGKSLLQIGP
FT                   GKETYTVRPVVSDNRSHAPLLVLREISLDEKGVEPLLFREKMRSSEDRLEGLKKLRHPN
FT                   LVDFVGFKITRPLSMQDAQDSIWTVYALQEYSNKGTLAEFLDIVGTVPVEVLRSWTIQL
FT                   LEALEFYHRSGFVHGNIHCGRILLFRTRTGGTIVKLRAGIEEALPDSPASKRLLTTSKS
FT                   PFWMPPELTHGTAPLTMKTDVWDLGIVFLQMGFGMDVLQRYTSANALMGTLGLTTALQD
FT                   LLHEFFRPDPKKRPTAFQLQPSEFFRVDTPLISRTSASNSISLPRRPRLDSLNGLPAFS
FT                   RYNQDFDEAGRLGKGGFGQVVKARNKLDGRFYAVKKITQKSTAALKDTLSEIMLLSRLN
FT                   HPYVVRYYTAWIEEDYDYVDEEAISSTESDVFASRDTHAYDYSTGGLDFISSSGYPKIE
FT                   FGSDSEEDNDGTLSNGDKGDTPSTFETESATGKELSRVRSGSQGRPVLTTLFIQMEYCE
FT                   KHTLRDLIRNGLYDDVDRSWRLFRQILDGLSHIHGHGIIHRDLKPDNIFIDVANNPRIG
FT                   DFGLATSGQFTTAVRSSTTADFEGNFTRSLGTTYYVAPEMKSGFTGNYNEKVDMYSLGV
FT                   IFFEMCHALSTGMERDQTLRAIREPNHTLPSTFQSSEKVVQGRIINSLLSHNPSERPTA
FT                   SDLLRSGKIPLQVEEETFRRAIMHLLSDPNSPDYKKILSGIFSQSPKKFEDIAWDMDSR
FT                   GTPGATELLIQGLVKEKLTSIFRRHGAVETQRQMLFPRSQHYNNGAVRLLDSSGNLLQL
FT                   PFDLTLPNARAIPRQDPSLEKTYAFGTVYRELPHGGEPRTHKEVDFDIVSHNTLDLALK
FT                   EAEVIKVLDEIIEEFPPLRSSPMCFVINHSDLLQTIMEFCRITPSQIPRVKEVVSKLNV
FT                   GKWTMQKIRSELRSPAIGVASTSLDDLARFDFRDSPKQVQKRLRAIMQGTIFAERLAPI
FT                   FARINLLVAYLQNFDVKRKVYMNPLGSLNDKFFRGSILFQCVFDSKRRDVFAAGGRYDS
FT                   LVQEFRPKVLASRSQTHAVGFNLSWDRLSSAMLEYLGTPAKTPAKSFDMEAGAFWKTRR
FT                   CDVLVASFDPTVLRTMGIKIVQDLWLNDVSAELAVDASSLEELLNKYRDDSHGWIVIAK
FT                   QDSQERGFKVKSLSPREEFDIRGSELVPWLRNEIRARYQREGADPLRQSRLPSQADPGP
FT                   SFNERFSDVRILVPQHRSKKSNRRNIVETALFRSREVVEDALNGPVAAIDTRDELLEAI
FT                   RNTRLSDPESWRTVIQNAPLTERKYLTQVHELLLDLANESRVDGMESFSNAFIYNYRTG
FT                   SCIYYDLGSAADR"
FT   CDS_pept        join(207537..207576,207788..>209661)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890682"
FT                   /orf_name="An17g00870"
FT                   /product="Remark: the ORF is C-terminally truncated due to
FT                   end of contig."
FT                   /protein_id="CAK43015.1"
FT                   /db_xref="HOGENOM:HBG023702"
FT                   /db_xref="InterPro:IPR021589"
FT                   /db_xref="UniParc:UPI0000EFCCF6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C4"
FT                   /transl_table=1
FT                   /translation="MLGWITGQEDQVADNSRAGEPPETPAPVFAIRAFKSALFGTPGAD
FT                   DDESTHRTTTATTAVKTKNPSTNQLLNDHITLKPSSGNTGDAFKASKADLDLAMNAMAS
FT                   PTKSILVTPGTASNRRKTVSFGDGVVDNERKREDPFTKPNKTPTSSSNNFSSQWSATSS
FT                   DGKFKPRSKLTQALMDSREKSKGTGLFSSQDLEPNPSSEGSRPSPTEDDNDDTINLDEP
FT                   RSQSGKYWKAEFDNYRTKTTWEIKKLIQYRSAAKTYAKKKDEEASRLADKLREEEIKVS
FT                   EMERHVTHLASTMVGESANADKEKLVQDLTKQTALALQYKHRVNSLRKLLERHGVVGNE
FT                   VDDIAEQSESESSSEKTTEELRKTQQALDEAKAKIDDMKLQQSDFTKLQDLARSSEQKA
FT                   CELQKENASLKQTLARVKQEMSKYEGRRKEKEAKLKQREAKLETRIQEYRERLKNASQQ
FT                   HRDHEESLKESFNEERHRMQEQIDQLKIKLTAIESLPHTQVRARHSESPRKNYTGVHVF
FT                   DFGQNSPQKDPEDDNTADIDEPPSPSPRAKERRSYPSRYTTTAGDLDLKRAMKAMGITD
FT                   EDQLAYLGESLKPPKSRYQNENHDDEEPATIPPSSPPDYPHHHHHPPPSTRPRPKQKSN
FT                   NTN"
FT   gap             209663..209762
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(211827..211949),complement(211634..211764),
FT                   complement(211458..211570),complement(210551..211404),
FT                   complement(210262..210492))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890683"
FT                   /orf_name="An17g00880"
FT                   /protein_id="CAK48790.1"
FT                   /db_xref="HOGENOM:HBG696796"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI0000EFCCF7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C5"
FT                   /transl_table=1
FT                   /translation="MTAPLPAAQTNPAFPSAAQYLTSDKSSFASVSAHERWPVILTGAI
FT                   DDLHRSVADVTDEEKRQEGKAIIGSLAAFKYELQHNRQLTPLPDDGQPDIAAYNQELEQ
FT                   RGNPSWHDVAWLYSECYLYRRLSTFFSLSKHWKGYDVFARQKMSTFKSSRPAVLELAAR
FT                   YKELAEEASKGTEGKTPEQIEQADRILFSEMCEICLWGNATDLSLLTSLTYEDIQKLQG
FT                   SEARKASEKNILVNDLNASFDVLHQARRDRKNQDRRVDIVLDNSGFELFVDLILAGYLL
FT                   SAGLATTVVLHPKNIPWFVSDVTPPDFAALIAALSDPQAFYTAPDESGKSFDPLSEKEV
FT                   SEVKFLFDHWSHLHAEGKLIIRPHTFWTTPGSYWRMPYVAPDLFSDLKDSELVLFKGDL
FT                   NYRKLTNDAAWDPTTPFTEAIGPLGPQSGVRVMAFRTCKADVVVGLPKGVDEELRQMPN
FT                   GGGDEARKWAWSGKWAVVSFCDGKA"
FT   CDS_pept        join(complement(214090..214242),complement(213939..214019),
FT                   complement(212705..213871),complement(212613..212651))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172698" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657471"
FT                   /orf_name="An17g00890"
FT                   /product="Function: when expressed in E. coli "
FT                   /EC_number="3.1.3.16"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK48791.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011236"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013235"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000EFCCF8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C6"
FT                   /transl_table=1
FT                   /translation="MASPDLEAATALKVQGNKAFAEHEWPTAIDFYSRAIEKYDKEPSF
FT                   FSNRAQAHIKLEAYGFAIADASKALELDSNYVKAYWRRALANSAILNYKEALKDFKAVI
FT                   KREPNNRDAKLKLTECEKLVRRLEFEKAIEVGDPPSAFEDLDIDAMVVDDKYDGVRLEK
FT                   EMTQEFIDDMIERFKNGKKIHRKYAFQIIKAVKDLVYAEPTMVEVGVKEGTRLTVCGDT
FT                   HGQFFDLLEIFRLNGYPSDTHAYLFNGDFVDRGSWSTEIALLLYAYKWLRPNGIFLNRG
FT                   NHETDDMNKVYGFEGECKAKYNETVFKVFSESFSALPLATLIGNKYLVLHGGLFSDDNT
FT                   TLDDIRKLNRHNQRQPGQQGLMMEMLWTDPQTAPGRGPSKRGVGLQFGPDVTKRFCEKN
FT                   GLEAIIRSHEVRMEGYEVEHDGRCITVFSAPKYCDTTENKGAFIKIGPELKLEYQVFEA
FT                   VPHPDIKPMAYAQNSLMSSMM"
FT   CDS_pept        join(214669..214746,214832..215056)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810133"
FT                   /orf_name="An17g00900"
FT                   /product="Cofactor: SPT4 of S. cerevisiae requires metal
FT                   binding for its function"
FT                   /protein_id="CAK48792.1"
FT                   /db_xref="HOGENOM:HBG623003"
FT                   /db_xref="InterPro:IPR016046"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="UniParc:UPI0000EFCCF9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C7"
FT                   /transl_table=1
FT                   /translation="MSFYVAPSQQRTLRACMVCSLVQLHSKFMREGCPNCDNVLGLRGN
FT                   NDAIQECTSQVFEGLVTLRDPTTSWVARWQRLDSYVPGTYAVKVTGSVSTLAHPY"
FT   CDS_pept        join(complement(217200..217450),complement(217095..217130),
FT                   complement(215857..217019),complement(215758..215804))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020208" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15890684"
FT                   /orf_name="An17g00910"
FT                   /EC_number="2.6.1.19"
FT                   /function="4-aminobutyrate transaminase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="gamma-aminobutyric acid metabolic
FT                   process"
FT                   /protein_id="CAK48793.1"
FT                   /db_xref="GO:0003867"
FT                   /db_xref="GO:0009448"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG483813"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00004ED5E6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C8"
FT                   /transl_table=1
FT                   /translation="MAAIFRSSLRLRPTTRLSAVRTLTTTPHMRAAEKPYFPDEPSAPK
FT                   LATAIPGPNNKAAAAKLDKVFDVRSLNMLADYYKSNGNYIADLDGNVLLDVYAQIASIP
FT                   VGYNNPHLRKVAESPEMVNALINRPALGNFPSHDWADILDTGILKAAPKGLNQVFTALA
FT                   GSDANETAYKAAFMYYRQRERGGAETEFTEEELETTMKNQSPGSPQLSIMSFKSAFHGR
FT                   LFGSLSTTRSKPIHKLDIPAFDWPQAPFPSLKYPLEEHAQENAQEEQRCLQETERLIKE
FT                   WHNPVAAVVVEPIQSEGGDNHASPAFFRGLREITKRNNVLFIVDEVQTGVGATGKFWAH
FT                   DHWNLETPPDMVTFSKKAQTAGYYYGNPALRPNKPYRQFNTWMGDPARALIFRGIIEEI
FT                   ERLNLVENTAATGDYLFSGLERLAKQYPEHLQNLRGKGQGTFIAWDTPKRDEFLVKAKG
FT                   VGVNIGGSGQSAVRLRPMLVFQKHHADILLESVEKIIKQL"
FT   CDS_pept        join(complement(219121..219245),complement(218662..218762),
FT                   complement(218290..218379),complement(217917..218131))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810134"
FT                   /orf_name="An17g00920"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48794.1"
FT                   /db_xref="UniParc:UPI0000EFCCFA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9C9"
FT                   /transl_table=1
FT                   /translation="MAYKVLTRGHRHLNLARSATLKPSGINHGDMGGEKKGNINAMACS
FT                   KSSGSPGSACAKMTRACLFKACDLILLVLKSHSVNKKQRHVQPKVERGSHSIFAEIQFS
FT                   STIGYLWNGGDGIGVRSERWAAYRPPLPLISDADLICSQHIDQSHLMAIATPPSSAAGG
FT                   RGKQIASTENIFI"
FT   CDS_pept        join(219407..219711,219794..219901,219949..220117,
FT                   220183..220368)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18114354"
FT                   /orf_name="An17g00930"
FT                   /product="Remark: during fruiting body development "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK48795.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFCCFB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9D0"
FT                   /transl_table=1
FT                   /translation="MSTYLVTGASRGIGLELVRQLAAKTSETVQTISAAARTSGGPLFQ
FT                   ELLQQHPDRVIFVPLDVTEKESVKNAVTHVATALNGKGLDVLINNAGVMTPGTVENMDD
FT                   LEDTLRVNVGGVHLVTREFLPLLRNGNKKRIVNIFLFSSTSVGSIQLQPTYRAMPTPSY
FT                   KISKAALNMLTVLYSQELEAEGFTVFCVSPGWLKTDMGSDDADLPVDTGVSAVLDAVLT
FT                   TGKEKNGRFLNILVPGWENNPGMNQYDGKELPW"
FT   CDS_pept        join(complement(224424..224624),complement(224064..224368),
FT                   complement(223682..224006),complement(223189..223629))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657472"
FT                   /orf_name="An17g00940"
FT                   /protein_id="CAK48796.1"
FT                   /db_xref="UniParc:UPI0000EFCCFC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9D1"
FT                   /transl_table=1
FT                   /translation="MLLPPAEVLATWPTPNYVDPVTRGPAVNIVNIVLISIAFVVTVLR
FT                   LYTRFKITCTPGLDDFFIVIAFAIAVGMCAVTSLATERWGANRHVWDVPLSWLPVVTKY
FT                   NLGFQITFSLSCSITKLSVLWFCKRLIGTGSKGLYRVYNIVVIVSFIFVALCCIVFLLV
FT                   SIFQCSPIHAYWDLEPMYPYHCVNYGAAVFSASVVNIFTDFLCTLVPMPLIWNLKLPAR
FT                   QRMAVISIFGLGIFVNVAGTVRTVYVWKSMMASYDTTWMAWPILLAGSIEINLALICAS
FT                   APALRPLIGFVLPHLLPSARGYGSSFGNRELKGWSSTGPSKQSRASKMIEDRQYGYQGD
FT                   TTVDRMEVLRTVEMETWTENRRPSHSNNSQVTSNHTRVATPTHHVDLKNTGVVYTSPGS
FT                   DVSSTSLTRDSKEQHTFYEHQNPV"
FT   CDS_pept        join(225020..225379,225457..225810,225942..226202)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963314"
FT                   /orf_name="An17g00950"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48797.1"
FT                   /db_xref="UniParc:UPI0000EFCCFD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9D2"
FT                   /transl_table=1
FT                   /translation="MDLFNFRSNIPAKREVNSSNETGSGPTSTADHFIQPMARRSRRTE
FT                   DCRGTKPAQDNDRQIHRPVVHGLLHMPGGRSEHFEPFEWACWAEMSIGIRDLNWTRTRK
FT                   SNQLARLKFAGRGALLFGNGGRTTAAEATEEAHGGNSGPSDSGRERENQLEQRMRDPQS
FT                   NYRMGKVSVELRGGVAIDLARAERVRVRTNYPGGAAGAGVCQKLQDKGRLNEERPPPAA
FT                   VTPPESHLLAARQSILIAPHAFFPPKILPESLPLIRPRWLVSPIPTISGISQKASECHG
FT                   GLSCTLNDLDGTSPTETPYYGDISLITLLYAPLAWCITSIAIS"
FT   CDS_pept        join(complement(226951..227165),complement(226751..226768),
FT                   complement(226635..226692))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810135"
FT                   /orf_name="An17g00960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48798.1"
FT                   /db_xref="UniParc:UPI0000EFCCFE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9D3"
FT                   /transl_table=1
FT                   /translation="MFIDIEVSCLLRVNSEISRLNHGTGTVSVAWIRAQGISSILSFSG
FT                   KPGPLWNVMTKVLTPSRTGALRTTHGCLAGLVRYVETESRQLIVCPNCIAG"
FT   CDS_pept        join(230588..230947,231000..231054,231107..231898,
FT                   231962..232180,232250..232275)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657473"
FT                   /orf_name="An17g00970"
FT                   /EC_number="1.2.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK48799.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000EFCCFF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9D4"
FT                   /transl_table=1
FT                   /translation="MLRPLFSPAQRSIAKKRPLCSPARAQFLFSTFANVIDGKTRDSSQ
FT                   IHQSINPSNCQKLWDVPIASRDDLQDAIASAQKAFTTWSAVSGSDRQGSIAQLRDSLLS
FT                   CKEDIAELLMKEAGKPRMQATLEVDHACGFLDYFANVKLPSEEVIHEDASLKLSLQYMP
FT                   LGVIGAIVPWNFPLVLAMAKVAAALAAGNTVIVKPSPYTPYSILKVAELAIPILPRGVF
FT                   QAINGDDMTGPEMTLHPDINKISFTGSTRAGKHILAATSNTLKECTLELGGNDPAIIFP
FT                   DVDIQAVAQQVALGAFFNSGQFCLGSKRLYIHEAIYNDFRDALVDVVRTWKVGPVDEDV
FT                   MLGPIQNEMQFNVVTDIFKDCKAKGYNFALEGGPSNGPGYIFHPTIVDRPPDGSRIVTE
FT                   EPFGPIVPLLSWSDESGLISRVNDTKTGLGCSIWAKDVEASKRLAPKIQSGSVWLNSFA
FT                   KPHPQGYLSGRKESGIGGFCRTQYN"
FT   CDS_pept        join(complement(233905..234020),complement(233405..233561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963315"
FT                   /orf_name="An17g00980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48800.1"
FT                   /db_xref="UniParc:UPI0000EFCD00"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9D5"
FT                   /transl_table=1
FT                   /translation="MALICIRLPLTSGINPGDGTVLRQDRDPDYGVCLAAGTAKRNLNR
FT                   PNLTMIVMIDNSGGPKTPCHTLAGNTSAANFSNVLPSARSGNHKD"
FT   CDS_pept        join(complement(234478..234552),complement(234294..234383),
FT                   complement(234090..234203))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963316"
FT                   /orf_name="An17g00990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48801.1"
FT                   /db_xref="UniParc:UPI0000EFCD01"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9D6"
FT                   /transl_table=1
FT                   /translation="MVVTSIHSKRYARMPVCQYGMLRVPQEPTAGNAWRSAHWVHLANN
FT                   GCGPDPLFQAAFVAPHESISLRLGIAAETKSEPSQRIKFPPWTVREI"
FT   CDS_pept        join(234897..235100,235162..235309,235362..235446,
FT                   235495..235620,235670..235734,235846..236019,
FT                   236073..236246,236298..236644)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114593"
FT                   /orf_name="An17g01000"
FT                   /product="Similarity to hypothetical protein sll1024 -
FT                   Synechocystis sp"
FT                   /protein_id="CAK48802.1"
FT                   /db_xref="HOGENOM:HBG329036"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniParc:UPI0000EFCD02"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9D7"
FT                   /transl_table=1
FT                   /translation="MGDEASHDNHLAPAADHDVPAGVGANELREPPRGRLTPRPSFLEN
FT                   LASSREKQFMLGRRNSSEIDRYFHGPRDLDRHSKWPIFLRMHGSIMPKMILPLTFVAAW
FT                   ATVITCISKFVHNIGINDILLTVTGFVVSLALSFRSSTAYERWADGRKYWALLNQTSRN
FT                   LARTIWVNTAERAGEEGKEDLLAKLTAMNLILAFAVSLKHKLRFEPVGEYLGVSFAESN
FT                   PRKLVKRSKKPLGHLPLEILNHLSAYVDRCIANNTLNVSLHQGQAITALSTLNEVLTGT
FT                   ERVLDTPLPAAYSISIAQIAWIYVLVLPFQLYDFLEWVTIPASVVAAYIILGLAFIGSE
FT                   IENPFGQDVNDLPLDTYCRQLAVELDIITAMPPPKLDEFGTREDNFVLFPLSTSGYPEW
FT                   KDRSVEEIRAALRAKVVANYPSAAMSDAATMIGSVRSKQSV"
FT   CDS_pept        join(complement(237656..237774),complement(237256..237580),
FT                   complement(237060..237125))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963558"
FT                   /orf_name="An17g01010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48803.1"
FT                   /db_xref="HOGENOM:HBG324940"
FT                   /db_xref="UniParc:UPI0000EFCD03"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9D8"
FT                   /transl_table=1
FT                   /translation="MSTTTTSKRKSPTTTTSDSSPKTIHFTSRTPTWTYLKLQLVTNPP
FT                   STSTSPLDPLTARTYLSAALSQFLGLMGTTIPLDILKVSPPPSSSSSTEGGKTGGSGST
FT                   VWARVPRDDAAAVVAALSSWIGGSTGTNTNGGGDAAGGSSVAWRLNGRGHSLMGSAVPA
FT                   IGLECV"
FT   CDS_pept        join(complement(238327..238548),complement(238084..238242))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000019209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963559"
FT                   /orf_name="An17g01020"
FT                   /protein_id="CAK48804.1"
FT                   /db_xref="HOGENOM:HBG324941"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="UniParc:UPI0000EFCD04"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9D9"
FT                   /transl_table=1
FT                   /translation="MSTSPLLRLIQTATTKSRPNNPLYTLQISCHVKPNASSNREGITA
FT                   IGTDRVDVCVAAVPRKGEANAAVSRVLAQIFQVPKSNVEVIRGLKSREKTLAISELVIG
FT                   KQSEDEYLRRARGILEGAVMQK"
FT   CDS_pept        join(complement(239812..239898),complement(239658..239723),
FT                   complement(239260..239472),complement(239084..239128))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891642"
FT                   /orf_name="An17g01030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48805.1"
FT                   /db_xref="UniParc:UPI0000EFCD05"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E0"
FT                   /transl_table=1
FT                   /translation="MNDEEYETTERLFTKQMKQLNLKISQEEDGMVHEQNLIVRFGGEE
FT                   FTWYTLLTISIVKQPSPISQLPPLYFSLVMTAYLSTPAINIAVTEPYRSDSTNQNPGGW
FT                   ICLSDRVHPETRGPVVTKAGMFAVNALTRGWR"
FT   CDS_pept        join(240031..240097,240144..241543)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657721"
FT                   /orf_name="An17g01040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK48806.1"
FT                   /db_xref="UniParc:UPI0000EFCD06"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E1"
FT                   /transl_table=1
FT                   /translation="MAIFSSESTNAFQNMLTQDYAMMQVSHQESIQSSYREACQAQADS
FT                   GDFTSFHPDQQDWSWDKLPDILYQLKPTGPKSKIEPPTMPYPINGKFLRDIPTLPDHIA
FT                   SDVDEFRVEAWMRLDRRIRLSDIVDRMNPEFRIAPNALQQRGGRFRQAFGMLAWDSGNK
FT                   LSRELESKLMQTLMEHGIDPNLNTTRGLTPGLIIPALGEAGGRIPLPPTYSLEKRKKRK
FT                   RCMRATGPKRPRKMPKVQEQMLVDTAKEALRVFQNVGPAPSQNGFGSEIPTTSETTQIM
FT                   MPGESVFAVEMAAPATIPVPITAIVPDVNESKVDEDWPMSDAVQVNEPEPLYKLVPAEQ
FT                   HLDRMTGPLPVFRGEVPDMELPGAVCPMDLDMTLGAKNPWSDGYRVLETVGHWTKIEPK
FT                   STNGLKPGKTGDETLFNPYEEMSLPTPIKAKGHKADIKAMQPTGGLFLMKQPLVLDALP
FT                   SPIQVALFNHCFRELNVGERYFFNLPFFGP"
FT   CDS_pept        242697..247973
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891643"
FT                   /orf_name="An17g01050"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAK48807.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG328898"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000EFCD2B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E2"
FT                   /transl_table=1
FT                   /translation="MEPGGDPLDWTVDEVVQFLCRNPQTPWSRSSSRAPRPDPITFEAT
FT                   LRENEITGEVLMHDVDKETLREDLGVRALGHRSSILMAIRYIQRKSLKFQESRNLGTLS
FT                   EDHIDYANPVVPRLVSPVYHPPPSHNLTPQRGLHESARLQTSSPKASPQEPSGNVPKAD
FT                   SERRAGSVEHHKPSEAASRPGILQRNERNAWSPSEQPPERRIRPGEDLVVDAHGKKRRK
FT                   LNLSAMTQDETGPDVSRQTNRPKSPTEWYLGPEKLNVSRLFYTSDPDSDPAEHDQTFSM
FT                   TASRLPVGRRRFVNQRLIYFHKQRPVKLSSTQSALVPYRELTKQKSKPSKKEVVIGHSN
FT                   PRPCTLYTVHNGRVTVTRDELQRWPQLVQSEEADSGGAKDHDPFAYLLQKYPAQNDDDD
FT                   GLDTLPLYGDSGSEGEFDDDIWQEIEDERREPLPRQTTLTSAEIKSIIASCISEYENNW
FT                   LQDGRTREEPKARRIWLSSRRGKTTNEQIKTITRDVSLLERRLGVFTKAIEESEYASRK
FT                   ELQLQCRSLENTVINIQKQKWLISVLELEQCPPKMAYPTRPLPPIRQSIDEDGESLGSE
FT                   TDHGAVDDDSLDDFIEDDVFRKSPTPSSDDDDIISPSGKRRKFRTTAHPFVESSSPSPP
FT                   PLPEGPIETIDLTGDDPLPEEDDFTVETPPLNPARQTPQSEHVLSREISPAPKLPPKVY
FT                   VEIPNVVIPKTEIPTPSKQDGIAQSVASSARPHLDSLEDLPEINDFNKLKGIGWRLLEE
FT                   RYDRCRLLAKLIASLADEERQRLTRMVPTYDIKSLQSLTNTALKRLWKSKETISGLTPD
FT                   EASFAMRTASLFISWINCAHYHVKGFPKTHVWEAKERVSDFPEFYKELSCRLDAYQTWD
FT                   INRQQTAATVSDSPHKKRKREVKESQAAKMNQEIAKLRVAHQEKLRQKLERKLESMGVS
FT                   NTDATRQAVSFGDPVIYLDPHIGQRVKPHQLHGIQFMWRELTEDGGKHQGCLLAHTMGL
FT                   GKTMQVISLLVTIANAAASKNPWIKKQIPDNLLRSQTLILCPSSLIENWYEEFIMWTPK
FT                   DSAIGPVNKVTSSASLAERLNTVALWNDEGGVLLISYDIFRTWVYNKETIRRGKPLSEE
FT                   EHENIKKWLLEGANIIVADEAHKMKNPASAITLAAMQFRSQSRIALTGSPLANNLVDYF
FT                   TMVNWIAGGYLGEFTEFKANFVEPIEEGLYVDSTYSERRRSLVKLQVLNKILEPKINRA
FT                   DISVLEGSLPPKVEFVITVPLTDVQKSAYDLYVQSILEGSQDFSRMKLLSWLAVLGLCC
FT                   NHPACFRDKLLSRASDAQKLDRMIDGAAIEPAPGDEPITQLGLDVEGLVSKQEQLFSTV
FT                   PDMSAATLSCRAEILNRIIAESVRAGDKVLVFSHSIPTLNYVENDILKAFGWKYCRLDG
FT                   STPMASRQAATKQFNQGSAEDVYLISTRAGGLGLNIFGANRVIIFDFTFNPVWEEQAVG
FT                   RAYRLGQKKPVFVYRFIAGGTFEEVMYNKAVFKTQLAFRVVDKKNPIRLATKSLGEYLF
FT                   PAKQTPQQDVTECLGKDPEVLDKIIRADAHADENQRLIRKIKLTELFQKDDNDKLTEDE
FT                   KNAAQQQLDDERLKRTDYEAYQRMIIERQRMALAQGTGPYGTTPAMHPGQLPPQLPPQP
FT                   FAPQPPAPAPQLTIPASAHNVGPPALAPDTSITQQAPQTPVAIPGLTLTSPDQAHALST
FT                   PVTPGNNTNSSLLTHNTSATAASAQTYNGGGSTTEGSSAIRDRSESPESLQDHNKPSCR
FT                   PQ"
FT   CDS_pept        join(complement(251142..251563),complement(249702..250931),
FT                   complement(248680..249655))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657722"
FT                   /orf_name="An17g01060"
FT                   /product="Similarity: mouse P113 is highly homologous to
FT                   human HIP116"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK48808.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG750276"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="UniParc:UPI0000EFCD2C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E3"
FT                   /transl_table=1
FT                   /translation="MGRTPGKRGFEQVDLTTDEATNNTRHHPTPRTTINGQRFGQDTTF
FT                   VPLSQSGEDEDDAQATDLIQGSQDAGDDASTYIHYGDLKAKIVGVRYYRGHATIGEHVR
FT                   IVRDPGNPYDSNAIRVDNVMGQQIGHIPRTVAAKLANRMEMDNLPLGGFKQNERNEKKL
FT                   EKEREKARKEAAKLARSLAKGKGKQFQGENALGYSNLFTGEGLVEGENLEELIGQSSTF
FT                   NPRDIGHVAEDFGMKESDLENMPMAESPAALATELLPYQRQGLAWMIAKENPSLPGDGG
FT                   DVVQLWKKNGNKYTNIATNYSMTQAPPLASGGILADDMGLGKTIQILSLIRFNSQPKTP
FT                   ESSRTTLIVAPVGVMSNWRNQALVHTHSDKAPKVLIYHGQGKKEASNLDQYDVVVTSYG
FT                   ALAMEYSPNAKAPPKKGLFSIHWRRVVLDEGHTIRNPRSKGALAACNLRAGSRWTLTGT
FT                   PIVNTLKDLYSQVRFLRLTGGLEDLAVFNSVLIRPLLSGDPDSRLLLQALMTTICLRRR
FT                   KDMNFVNLRLPPLTSRILRIKFHTHEQEKYDMFQSEAKGMLLDFKFKDKSNTNYSHLLE
FT                   VILRLRQVCNHWALCKNRLDKLADLLENNKVVPLTPENIKALQEMLQIRIESQDTCPIC
FT                   LDNLEQPVITACAHAFDRPCIEQVIERQHKCPMCRAEIQDTTTLVSPAVEMGESTDTVD
FT                   ADPDNPSSKIEALIKILTAKGQAQGTKTVIFSQWTSFLDLIEPHLFRHGIGFARIDGKM
FT                   SSISRDNSTLRFSTDPSCTVLLASLSVCSVGLNLVAANQAILCDSWWAPAIEDQAVDRV
FT                   YRLGQTRETTVWRLVMEDSIEDRVLAIQENKRKLMLEAFRETATRKKVDDRATRVADLE
FT                   KLLK"
FT   CDS_pept        complement(251938..253774)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891644"
FT                   /orf_name="An17g01070"
FT                   /product="Putative frameshift"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK48809.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFCD2D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E4"
FT                   /transl_table=1
FT                   /translation="MAGDNPPAAGEPAMPTRISYWRLLLDQGVLTQEILDYPWEGSGTE
FT                   DDPYLVTWIPNDPRNPMNFPAWRKWLYTITVAWATLAVSLVSSAYSGGVEQIMESFHVG
FT                   TEVATLGISLFVLGFAIGPLLWAPMSELWGRQYLFFVSYCGLAAFNAGITGSKNIETLI
FT                   VLRFFAGAFGSSPLTNAGGVVADLFPAKQRGLAMSIFAAAPFMGPTIGPVCGGFLGMNA
FT                   GWKWVMGFLAAFSGLLWIIGSLVVPETYAPVLLQQRAKKLTKVTGKIHRSKTEAEKGKV
FT                   PYSTVFKTALSRPWLLLFREPIVFLLSIYMAIIYGTLYMMFAAFPIVYEELRGWNQGVS
FT                   GLSFLGVMVGMNIAVLYSIWDNKRYERTDEAHKGFAPPEARLPPCLMASVMIPLGLFWF
FT                   AWTNYPSIHFMASIAACVPFGFGMVLVFLSLMNYLIDAYTIFAASVLAANSVLRSIFGA
FT                   VFPLFTTYMYHNLGVHWASSIPAFLALACVPFPFLFYKYGPAIRTRCKYSAQSDAFMRR
FT                   LMEQSTRDNRQPEPEKEEAAEKETEVSPVQASSSTLGEKSRLGDLPAVAAEDTARTHSI
FT                   ASQGSRRPGSVKAESVYEGNPYDVDRVNTRESFKD"
FT   CDS_pept        join(254887..255141,255598..257124,257337..257360)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172598" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891645"
FT                   /orf_name="An17g01080"
FT                   /protein_id="CAK48810.1"
FT                   /db_xref="HOGENOM:HBG328900"
FT                   /db_xref="UniParc:UPI0000EFCD2E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E5"
FT                   /transl_table=1
FT                   /translation="MHSLYNIHSVNAVLRKTHHFSESSPFQQHAENLQAFILNISASDT
FT                   SVSASQLKIGTPLLLVRTGEIYSDRNSTRDSPDHDAVPVSIHFVLFESSLPFLFLSLGP
FT                   TILPMAASQPPFSYRRLIHDNQAQFESLVQNGDVKPVLLWHLMLPLVLSILALLVPQQR
FT                   GGRYVRPLVLACVIGITSNVLQHRRMLTGGNGYMGGLIPVWSTIWSATILLFRDVERDF
FT                   KRIERHPLSSTMTISNGDAALNGHAKESKCMVTTHNSSAEPVSWQPYPQTLSHRLNWVI
FT                   SVATSMRGPEWNWRISTMGALPASVQAQLNNSSEHHSEEEKATTTTNTNPEPITMRTRL
FT                   RATLTLFIQSYLLLDLIKLLMIRDQYFMGSVSPPAPPPFPFHYLIPYPILIHIYRCLVT
FT                   GTGVLAALNYVTCLNPLIFGGLSLAFPNAAKSLTSVPLSAPYLYPPAFGPFFTSILDHS
FT                   LAGCWSLWWHQLFRYGFISAAHWLLSLLPSRLSTSRSVRRVLTAFVAFSLSGLVHASGS
FT                   YVQNRETYPFAGPFRFFVLQAVGVLLQGVISPLWLWMPRPARRACNAVFAVTWLLGSAG
FT                   SLVEDFSRGGLWFTEPLPIIDGESK"
FT   CDS_pept        join(complement(259684..260022),complement(257604..259622))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891646"
FT                   /orf_name="An17g01090"
FT                   /product="Similarity to hypothetical protein SPCC4G3.18 -
FT                   Schizosaccharomyces pombe"
FT                   /function="binding"
FT                   /protein_id="CAK48811.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG328901"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000EFCD2F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E6"
FT                   /transl_table=1
FT                   /translation="MAYMSMSLHAVNHRLTNVPVKQLPHLASCLASSISNCGELLSTPQ
FT                   SQKSGKTDSDNAVQIHKLITRLGSLLQDRTYEGRWTAVVLVKALVEAGQWEILRSSEPF
FT                   VRGLISILAKSDPVSTKKMCIITLTRIFHLTYQYPTLVREITTPSLPGFITSALNLISV
FT                   KPSSEPVRRLKPNTPFVEVVLQAVNELIARHPTIFRPFTAQIHSILQVIIGSTSPTFPE
FT                   HVLEIAQQLFISLHNCAPKNTGGDEWKSACRMTITSVHAASSYVLRAIVEQWESVDPSL
FT                   RQMSQPQNYSQEVGNGPDALGLEGWQGLNSGVNRLVVLLRMLSGFVGTATASTVTIPVG
FT                   AILDLTSRLNMVVYPSGGSDIQANPQIGRAEREQLLTELPRIHIACMKLLLHLVKALET
FT                   SAIPVAQNILEQALWVFRAEQFSRDVRTAVYDLVCALLTRIGPSMTKQSVSSLASMIRK
FT                   CCHDLLPPTGNQGAATEKPDPKSKNKSSQATVNADSFLNPGLKQVRQTSSSSSFPDLTR
FT                   AASELLAAALTHTPSEFMSPALRAEVDRTLILTSDKNAMLASVLNPFPAMQGRGVGTSI
FT                   LPFLARSYPAETEVECLIRPRMPVVMSGPTTNGYVPMEDDEDEDEDAAATAVPTSTATG
FT                   FLKPTPTPTLQHHDMMDVEKDIPSPPSKRSYADEVEQPAASSAVPSATTTTSSPGSQSK
FT                   KARFEPKAAAAVTQPPLDAASPATFTGTAAISVPTSSIAGPAPVQTPKPAQSSIAKPSA
FT                   SAAAGAAEDESDDEMPSLNVDPDTDDEDEDEE"
FT   CDS_pept        join(260346..260351,260473..260596,260665..260991,
FT                   261044..261660,261716..264085)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891647"
FT                   /orf_name="An17g01100"
FT                   /function="binding"
FT                   /protein_id="CAK48812.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG328902"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000EFCD30"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E7"
FT                   /transl_table=1
FT                   /translation="MTGRDSDKGHRYVTALDNARCQNKWEEVPELIRKVTKHAPQRTCL
FT                   LEVASAEYQLASHLQTHPSTPRPSSAAGLHDLIPSLLSTVNRAEGSKQEVFQAQVCLGW
FT                   VHWTVNELGLAAARFPQDFEEAVSELEQAGEELSPWTKTCLVKACYLKGSAQRMTSDPE
FT                   GALETLHSLTPWVNIQLQSSTNSPQFLYWSEKLLGQGASLACEEASKDLAAANAQTIAT
FT                   TLGFFRLWASHPSVKQMTLPQGMLMDSTTEPVSKSPTWKSYYNLLSRILQQGLPYCPPA
FT                   NGPERPQLASEIRRVESLCEASILRETKFPTADSSNPEVEAWVEQVIQNWEVLCGAGWT
FT                   DEELGEGGQNAVGRNVLDILYRAATKTYHSHLILRRLFHVHCALADYDLALRALDSYIE
FT                   IVTSAKERAAKGAESGDLENDGILLRTVSEGVTMLSCFGSEKEAEKAKDLTSLLKEFSE
FT                   KHVQDDEEQGITLIAPETASTCSQAVAPSDIAAAYRGIGIGLANWAYWTPVNEDRDDIR
FT                   AEAIDYLERSLAPELEDDANCSSLYTLAVLLAENRDLDGAIDYVKSALTSDAQHKTGQA
FT                   DFARERDLVPLWHLLALLLSAKQDFDIAERSCEAAFEQFPATVTSLAHSDRRPQKQNQT
FT                   AQDQIAGITHELIDKLRVREKERIIETRMTQLAFVELVEGPGAAVNHSDQLLSLFATLF
FT                   RSLNLEGSEKANTKTENEHLVPPKSSAGTVKSLRGSFFGRHKGPRAPDRRAEFGQEPKT
FT                   DNSAYTDSAPAIQVTDGEKSGLNEGTDSRQARKRSNTLRKGDDAHNANSSHVNGDSGTQ
FT                   AGPEAGNPVPDMVGLAVSDAAAQPQSAKQPLGPMAHNMKHNQPPAPAGHSKQPPEQDIR
FT                   LPTSYAFDSPTRAVTKVPPTQAQKHGLCILIKVWLLIAGLYRRASSFEDAHEACEEAAK
FT                   QVTRFEALVASQETSARAFRERGWGVPKSTDELWADVYAERGLQSIDQTRPHEAMEHFE
FT                   TALLHYADHPKATIGLSNLLLDVWEEKMPLQPPKPRLDAGVSTLSLSSSDQSKPSSEDN
FT                   AKRSSQEEKPQAKIVPDSDEEPRLLNRIAARERAFGLLSGLTKRGSAWDNSEAWYALSR
FT                   AYEAENQIQKLRDVLWWCIELEDRRPIRHWSNIGSGIYVL"
FT   CDS_pept        join(complement(264863..264953),complement(264728..264808),
FT                   complement(264616..264679),complement(264428..264565),
FT                   complement(264327..264375))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000140337" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891648"
FT                   /orf_name="An17g01110"
FT                   /product="Catalytic activity: NADH + ubiquinone  "
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="electron carrier activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK48813.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG714446"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniParc:UPI0000EFCD31"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E8"
FT                   /transl_table=1
FT                   /translation="MLSDAGKGEACGGVKWILTRRAICCNSTLVSDTKAGTLIGVDRYG
FT                   NKYFENMEEELPLRTRWVDYKEKEYDPSQLEPGWHAWISYMVDAPPTADKIMQTGVRSW
FT                   ELPEHRPNLTLSRAAFKTYSTTRPKYSAWTPVAAPR"
FT   CDS_pept        join(265122..265233,265404..265603,265671..266023,
FT                   266073..267015,267159..267212)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891649"
FT                   /orf_name="An17g01120"
FT                   /product="Catalytic activity: phosphatidylglycerophosphate
FT                   synthase"
FT                   /EC_number="2.7.8.8"
FT                   /function="CDP-diacylglycerol-serine O-
FT                   phosphatidyltransferase activity"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="CAK48814.1"
FT                   /db_xref="GO:0003882"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="HOGENOM:HBG737293"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="UniParc:UPI0000EFCD32"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E9"
FT                   /transl_table=1
FT                   /translation="MAGTENRSGSTSTLASLAFRPEVEAVPIRSSAGRCLSAARRVLLY
FT                   ERKFSANTCHASSSSPATSAVSPLGSITTELDRISPCFEVPASRITILNSPASFYNTLK
FT                   DKIKKARKRIYLSTLYIGKTEHDLIETLDHALAANPELKVSILTDALRGTRETPNPSCA
FT                   SLLASLVEKHGADRVEIRMFHTPNLTGLKKKWVPRRINEGWGLQHMKLYGFDEEIILSG
FT                   ANLSSDYFTNRLDRYHVFHSKELTDYYAGIHNAVCSLSFQVLPDSQNAAGYLLNWPASN
FT                   GAPSPLDDPEDFITYSSTVLSPLIQPSLKQSTLSPKSPDQTYIYPVAQFTSLFKSNDTS
FT                   TEFPAVTTILRLLSTSPAFSGARWLFTAGYFNIHPVLSSLLIASTSTSHTDSTTRGTVL
FT                   TASPWANGFYGSPGISGMLPAAYTHLSARFLDRVADAQRTNSIQLKEWRRGTVGEPGGW
FT                   TYHAKGLWITLPKEEHPSLTFVGSSNYTKRSYSLDLEVGALVVTGDAELKRQLGAETER
FT                   LQEDAKAISREDLRRTERRYGIESTSTPGNSRVMIK"
FT   sig_peptide     265122..265196
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E9 "
FT   mat_peptide     join(265197..265233,265404..265603,265671..266023,
FT                   266073..267015,267159..267209)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9E9 "
FT   CDS_pept        join(complement(268940..268962),complement(267421..268879))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172553" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891650"
FT                   /orf_name="An17g01130"
FT                   /protein_id="CAK48815.1"
FT                   /db_xref="HOGENOM:HBG328904"
FT                   /db_xref="InterPro:IPR007307"
FT                   /db_xref="UniParc:UPI0000EFCD68"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F0"
FT                   /transl_table=1
FT                   /translation="MPPRKQWIDKKTATTYQLFHRSQHDPLIHDPSADDRVLHPVYGPP
FT                   ITPSESSSASKHRGQSLAELNQTFGDAARKNEGEAANYGIFYDDSQYDYMQHLRELGTG
FT                   AGDAYFVEAKTKGKDKGKGLKLEDALKQVSLDDGRSEFGGTESVYSYDMRSTASSYVRK
FT                   PTYQDQQNVPDAIAGFQPDMDPRLREALEALEDEEYVDEDDEEDVFGQLTTRAEEMDQG
FT                   DWEDTIFDDVEEEDDGWESDATEKAPVQMDTTAAKARYQASEQEDKPGELPEHNEPAPD
FT                   MHPEDQGWMREFAKFKKDAKSGKTAGVPAGPPSVVPSHQGSTLASTVFTVGGTPIRRKK
FT                   RKGALTNPSAYSMTSSSLARTEGHRLLDDRFERVEALYSLDEEDEFDDNMSMVSGMTGM
FT                   TGMTGVSGISTASSQAPSLVDANGDAVRPSHNFNNIMDDFLAGWDDKTSSQAKRKGAKA
FT                   KRGKNGNEAIGIRMLDEVRQGLGPARVTGKVSGRA"
FT   CDS_pept        269437..271431
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172552" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810380"
FT                   /orf_name="An17g01140"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK48816.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG610636"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI0000EFCD69"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F1"
FT                   /transl_table=1
FT                   /translation="MVLAKSKNSVGLGNSLMNDRFGKGKASSMKKASHNAGIARKNEKG
FT                   ETYITNAPTEAAWVKMRSITEQAALDEFLSTAELAGTDFTAEKMNNVKIIHTDQKNPYL
FT                   LSAAEEKSAVKKHKQNKNRLTVPRRPKWDQSTTRQQLELMERESFLNWRRGLAELQENQ
FT                   DLLMTPFERNLEVWRQLWRVIERSDLVVQIVDARNPLLYRSEDLESYVKEIDPKKQNLL
FT                   LVNKADMLTEAQRAMWADHFERQNISFRFFSAHLAKERNERLQQGLDSEDESEEDIPEE
FT                   EQSAEGAKSLDIKDGEEPQEEHDGGLELNPSASSSSSRRTEILDVEELEELFLSNTPET
FT                   LPDNDSPEGPVKKKTTIGLVGYPNVGKSSTINALLGAKKVSVSATPGKTKHFQTLYLSP
FT                   EIMLCDCPGLVFPNFATTKAELVVNGVLPIDQQREFTGPAALVAQRIPKHFVENVYGVK
FT                   INTRPIEEGGTGIPTSHELLRAYARARGFATTGQGQPDESRAARYILKDYVNGKLLFCH
FT                   PPPTPEGSDPIDPIEFNKDLYDMAHLPARRQAQLAKMLQNEEVTDPELLALLKPVEKGA
FT                   RSRNLDSGFFGPGAKTSTGRLTLPFNAQYTEQGQEMRKQLTGRKERMMVALERGVDVSE
FT                   VKSGSSKKHFKANKRRAKKVRKNAADEDY"
FT   CDS_pept        join(complement(273212..273286),complement(272662..273120),
FT                   complement(271756..272562))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000131660" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891651"
FT                   /orf_name="An17g01150"
FT                   /product="Remark: manual BLASTP homologue PIR:DERTCM. "
FT                   /EC_number="1.3.99.3"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK48817.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG699365"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI0000EFCD6A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F2"
FT                   /transl_table=1
FT                   /translation="MSASTRIPVIAQPFVSDRAKRTLDQVEQFVEKECIPSEAIFRAQL
FT                   GTGSQRWSTYPAIMETLKQKAREQGLWNMFLPKNHFAQGAGFSNLEYGLMAEYLGKSTI
FT                   ASEATNNAAPDTGNMEVLAKYGNEQQKKQWLEPLLEGKIRSAFLMTEPEVASSDATNIQ
FT                   LDIKREGDEWVLNGSKWWSSGAGDPRCAIYLVMGKTDPTNPDPYKQQSVILVPAHNTPG
FT                   ITVHRMLTVYGYDDAPHGHGHITFKNVRVPVSNIVLGEGRGFEIIQGRLGPGRIHHAMR
FT                   TIGAAEKALEWMIARINDERKKPFGQSLSSHGVILEWVAKSRIEIDAARLIVLNAAIKI
FT                   DQGDAKSALKEIAQAKVMVPSMACGVIDRAVQAYGAMGVCQDTPLAYMWAWVRTLRIAD
FT                   GPDEVHLLQMGRRENKSRKEEVRRKLKWQAEETEKLLGVTAGGRSRL"
FT   CDS_pept        join(complement(274122..274270),complement(273972..274061),
FT                   complement(273817..273907))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891652"
FT                   /orf_name="An17g01160"
FT                   /product="Function: in S. cerevisiae BNS1 "
FT                   /protein_id="CAK48818.1"
FT                   /db_xref="HOGENOM:HBG324943"
FT                   /db_xref="InterPro:IPR007727"
FT                   /db_xref="UniParc:UPI0000EFCD6B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F3"
FT                   /transl_table=1
FT                   /translation="MDSHPLTDRTNTHLVQDTDKLNELKAAPAKINSMEYHRQVLQGKL
FT                   ENGDKNQASYVSPSDDIMSPCSKKLSDLKGKRFKNAGKPQSLFAKLGKKNFEQQSSAQK
FT                   ENTEA"
FT   CDS_pept        complement(274893..277382)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172520" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810381"
FT                   /orf_name="An17g01170"
FT                   /protein_id="CAK48819.1"
FT                   /db_xref="HOGENOM:HBG324944"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniParc:UPI0000EFCD6C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F4"
FT                   /transl_table=1
FT                   /translation="MTSWTASQWIPWMTLISTWIDGTTADPSQTICPAPRWQVAEAEFI
FT                   QWPQCPETRWEAEPATPIPAEQQPLLKAPEETLSAVSVSMASSESSARPDHELDTESPL
FT                   DNANFLSFEDWKKQNLAKVGQSAENVGGRGAAAAAAGKEGRRRPTGINNALDSLGEDVE
FT                   IELDFGGFGADTPEAAKPTSWGARVSTGVTGGEAGSAGDVDSLAHGVPPAGGVSRSKDA
FT                   GTTCKERFNYASFDCAATVLKTNPECTGSSSVLIENKDSYMLNECRANNKFLILELCDD
FT                   ILVDTVVLANYEFFSSIFHTFRVSVSDRYPAKLDQWRELGVYEARNTREVQAFAVENPL
FT                   IWARYVKIEFLTHYGNEFFCPLSLIRVHGTTMLEEYKHDGEVSRTDDVVADEELEPAPV
FT                   AAEIETIPTVDAAAAAGPIEQKVDEQTPETCPNPGPVVDEAVMMQLWGVPWTCSIHDSP
FT                   AAGDEGTQASLNRPSATDATPPKGDDAAPLGNEAPVKEAGEQKMTVSPNVDSAPSSATT
FT                   AGPETTSQGEADSRSTGFTKEEQSVAAETTRSTATQPPSANPTTQESFFKSVNKRLQML
FT                   ESNSSLSLLYIEEQSRILRDAFNKVEKRQLAKTSTFLEQLNVTVLHELKQFREQYDNVW
FT                   KSVALEFEHQRIQYHQEVHSLSAQLGVLADELVFQKRVAVIQSIMILFCFGLVLFSRGA
FT                   VSSYIELPSMQNMVSRSYSLRSSSPPFGSPSVSPTSSGRRAGGHRRNLSEDSQEDGPIS
FT                   PTLAYSPPTPVSDVMSSSEEAENQRGNSLALPEVAPPVRSRSSPPDLKGGEESIEESSS
FT                   SGDSPVSHGRNAAVTEA"
FT   mat_peptide     complement(274896..277307)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F4 "
FT   sig_peptide     complement(277308..277382)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F4 "
FT   CDS_pept        complement(278868..280802)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657723"
FT                   /orf_name="An17g01180"
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK48820.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG328905"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000EFCD6D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F5"
FT                   /transl_table=1
FT                   /translation="MECLKNSFVEGQLLDGRFRTVAPLNHGSFGMVFLATDNKTGQDVA
FT                   IKCLTKGGASPYDARFEELDCHRRLAYHPNIVNLIHSFETDAHMYLVLEYCSNGDLYEA
FT                   IRLNRGPLETEHVRDFMLQLVSAVEFMHANGMYHRDIKPENIFLMQDGSMKLGDLGLAT
FT                   RDTWSHEACVGSDRYMAPEQYDPSSSGYSPAKADIWAVGICLLNVLFARNPFATPTESD
FT                   ILFADYVRDRQSLFDIFPNMSQDTFEILRFALAIDPEKRSLSGIRDSIMRTVSFTTDDE
FT                   ALDEFCTDDREVVPASANREPLRTPSIQSPHINQGDSFPWAKALQASPPQQIRQLSAIP
FT                   DNESYSEDLFPPSETAGTSWFSVHQGTPSMASVLESALGDSFRPTAFRKSELRFPPPSD
FT                   PVPITGSLPTTKPLPSLSMVFGKKKDEQISKSWSDLWDEEEESETEDLAFQQRREQNSR
FT                   SWSHESSSPVEGNVPELCGPLTGLRDSVTPSMLNVRAQQPKPSVPSDETPGKSWNIPTA
FT                   PTGLKTPPRTPDSPPKNSNMDKWAALGDRRRNYKSPEASLGRKKFPLNMSWRKDWGLGS
FT                   SGFDYGSWAAKKEESSFHDRRRRPFQEKGRRRDAWESPKAANVKVPHHYDGSIDEDLDL
FT                   VGGWHDLHL"
FT   CDS_pept        join(281273..281313,281419..281458,281567..281640,
FT                   281726..281855,282005..>282136)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891653"
FT                   /orf_name="An17g01190"
FT                   /product="Remark: C-terminally truncated ORF due to contig
FT                   border."
FT                   /protein_id="CAK48821.1"
FT                   /db_xref="UniParc:UPI0000EFCD6E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F6"
FT                   /transl_table=1
FT                   /translation="MGHQMEGPRENNAAGGEVIEDGTDGYKVNEMKNRIPAPGPGCAAD
FT                   GWTTKQKEGLVGLRNSRRGWLEMSHAGCSEGQAGRQRRGRLDRRGQDKYTADWGSADVG
FT                   RSNGLVAGTLERRDEGWRIGRKRGKRRVGERREKG"
FT   gap             282137..282236
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<282237..282245,282270..282538,282580..282640)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891654"
FT                   /orf_name="An17g01200"
FT                   /product="Remark: the ORF is truncated and contains no
FT                   start codon"
FT                   /protein_id="CAK43016.1"
FT                   /db_xref="UniParc:UPI0000EFCD6F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F7"
FT                   /transl_table=1
FT                   /translation="SILARLVGWGATLGTLGEGKGNKPTQPAAMARKWANEREPPTSPW
FT                   FQGGWPAGQSRVFITVFMHTPDSPIGPSACEDGTRQPPFPLWSVVTILSRKRGRIRPST
FT                   PHPLSAPP"
FT   mat_peptide     join(282270..282538,282580..282637)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F7 "
FT   mat_peptide     282270..282308
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F7 "
FT   CDS_pept        join(complement(284109..284183),complement(283967..284029),
FT                   complement(283565..283625),complement(283365..283410),
FT                   complement(283048..283162))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891655"
FT                   /orf_name="An17g01210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43017.1"
FT                   /db_xref="UniParc:UPI0000EFCD70"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F8"
FT                   /transl_table=1
FT                   /translation="MIAIRSLGAIIACSSVSPSSPISGGGKESGPVGDHYLTIALMMKT
FT                   MGVSSMSPAQAVVYSRRLCLGAAVGVGKLAAIRTGYINGIETTRQQWQGMTQRETAEKW
FT                   RNVLAAEVIDRQPGE"
FT   mat_peptide     join(complement(284109..284120),complement(283967..284029),
FT                   complement(283565..283625),complement(283365..283410),
FT                   complement(283051..283162))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F8 "
FT   sig_peptide     complement(284121..284183)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F8 "
FT   CDS_pept        join(284591..284698,284919..284943,285021..285244)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810382"
FT                   /orf_name="An17g01220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43018.1"
FT                   /db_xref="UniParc:UPI0000EFCD71"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9F9"
FT                   /transl_table=1
FT                   /translation="MGKEAVVGRYGYCCAPIIRGDYYLLLRLEPRFRELAVPFPNPRVG
FT                   QPDNPGKPTPLNQSINQQQRQLLLHKTCVIHVDPVYRAGFPSTRPSSVTGFAGLNGREG
FT                   DYVSDRQTDSWANF"
FT   CDS_pept        join(285653..285838,285886..285948,286071..286199,
FT                   286359..286415,286617..286892)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810383"
FT                   /orf_name="An17g01230"
FT                   /product="Similarity to polyketide synthase module 7
FT                   encoded by nidA5 - Streptomyces caelestis "
FT                   /protein_id="CAK43019.1"
FT                   /db_xref="UniParc:UPI0000EFCD72"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9G0"
FT                   /transl_table=1
FT                   /translation="MVPAKCDSNSQHKNTGKATASTGSAPWLATFFPGLHEQSDAGGEG
FT                   RRCISARLTASRASVGKACLSPTRRWAAAVGRQPRDDEVAVLHASRDKPPSKTCQATTP
FT                   PPTPPPHHPSSIILLGSFGSLMVIQVTWLSPLSPFSHAIPKGGADGWNTLSWLFWAGAV
FT                   CIGGTWDKEPVREEKKVGNGYLVPGFGMEDVAPLEMIVSSLCRMVSILISMLVVYLVTT
FT                   VVYRHLQIQTQTQS"
FT   gap             287801..287900
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(288541..288867)
FT                   /gene_id="IGI22628252"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01240"
FT                   /protein_id="CAK43020.1"
FT                   /db_xref="UniParc:UPI0000EFCD73"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSV2"
FT                   /transl_table=1
FT                   /translation="MRLHFTCSAFRDECCAALRCWVVVEVEVEVHGGGGGGGECCCTQA
FT                   PGREDPCYLPTLLALLGYRWDGRYMFVVYITSLHKYIYIYIYNYINKTVMVNNSIPVFI
FT                   FVSE"
FT   CDS_pept        join(complement(292320..292536),complement(289652..292247),
FT                   complement(289514..289598))
FT                   /gene_id="IGI22628253"
FT                   /gene_family="HOG000172497" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01250"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK43021.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007810"
FT                   /db_xref="UniParc:UPI0000EFCD74"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSV3"
FT                   /transl_table=1
FT                   /translation="MALETSSGYVAPSNLAEPPDAALSMFDVRRVQLQFPLAADFVAAQ
FT                   VANNVLILALSTGRILRIDLDTPEDIDDIDLPKKSSEIGVIRRMFLDPSASHLIITTTL
FT                   GENYYLHTQSRQPKPLSRLKGVPIESVAWNPSLPTASTREILLGTTDGQIWEAYIEPST
FT                   EFYRREERYAQAIYKTPEASPVTGIWAEIIPTKPEFRRVLIATHGKLLCFSGRTGRYGR
FT                   EGGSLVYADLFQREAPVTHEIQKPSSAAPSTLAISPIVPEGQNATGQPENEFAWLSSQG
FT                   IYHGQLPYAPQKLTQPFESSNMLPRSLFPASESARGGKKLIQDPITAMTLSQWHILALV
FT                   EGRVVAVNRMNDEIVYDEAVLEPGQSALGLLTDAMQHTYWLFTSQEIFEIAVEDEDRDV
FT                   WKVFLQKEMFDEALQYARTTAQKDAVSTASGDFLASKGRYLEAAKVWGKSSKGFEEVCL
FT                   TLINRGEHDALRKYLLGQLSTYKKSSSMQRIMVASWLVEVFMTKLNSLDDNIATKAELA
FT                   EGTSTEEVKDELGSVRAEFQDFVTKYRSDLDKKTAYDLISSHGREEELLFFATAVNDHN
FT                   YVLSYWIQREKWSEALNVLQRQSEPDVFYKYSSVLMTHAAAGLVDILMRQTNLEPEKLI
FT                   PALLNYNKTVNVPLGQNQAVRYLNFIIVNHPKPSAAVHNTLISIHASSPSSSEAGLLTY
FT                   LQSQPSSPPPYDADFALRLCIQHQRVQSCVHIYSAMGQYLQAVELALQHEDIELAAIVA
FT                   DRPEGNDKLRKKLWLLVAEKKIRQPGTGIKDAIEFLRRCELLRIEDLIPFFPDFVVIDD
FT                   FKDEICSALEDYSRHIDALRQEMDNSAHTARQIRTEIAALDTRYAIVEPGEKCWLCSLP
FT                   VLSRQFFVFPCQHAFHSDCLGKEVLDGAGGKKKYIRDLQAQLNKGTLGAARREEIVREL
FT                   DGLIAEACVLCGDHAIKQIDKPFVAELNGPDDWAL"
FT   CDS_pept        join(complement(295517..295573),complement(295353..295460),
FT                   complement(294946..295320),complement(294266..294872),
FT                   complement(293066..294216))
FT                   /gene_id="IGI22628254"
FT                   /gene_family="HOG000172475" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01260"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAK43022.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="UniParc:UPI0000EFCD75"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSV4"
FT                   /transl_table=1
FT                   /translation="MSGIHRFLTRREKKNAKEEASNLLSRPHFRGFFSSDKLPTGDTNE
FT                   NQKKVNTNGDIKVLEQRVAQLGITGLRTEHISYALQSEHAKGDVDKAFEMLMILEDAIE
FT                   GIIRGYTPTTKLLGAVNREGVTCYLDALLFAMFARLDCFEAILYKSFNDEPRRKLSVLL
FT                   RLWVNMLRSGRLITTDLDALAECGWEDAAKLRQQDTSEAFTFITEKLELPLLTLKMDIY
FT                   HTGKEDVTGDHKFVNERLLEVAIPEPADGETVTLEDCLESYFNNRVEVKRHLERRYTVG
FT                   SVKSMDSIAKGCTTHVETIEVGSPLSPASSQSYSPLDDVTPVASLTEVVDSAPPPYRRS
FT                   SIVQERFIPGDENAQDGTMSSQRRGSYRKEVMMPAWQFFSLIPWYTDNTPTNDAQVAAH
FT                   FSSKRPILGMCLKRYSMTPTGKAVRLNTFIDIPTEIGLPHFIQDDSMEEEGPIYGNFKL
FT                   SLQAMVCHRGTSVDSGHYISIVRGTSAGAPPASSHGSDQEATTSDASRYWMRFDDLAKE
FT                   RVTLVDIEQALKHESPYLLFYQILPINEDAAAANLFDKPPSSELSMDFRDTENANMVQK
FT                   PQNLSVEDIGGARAEGYASGRPSFEITGPDGADPAPMDHNSRKQSVAFSEVFDPTSMQS
FT                   YAPTSPRLTPRDDDGRASFSFSRRSSRHTRSNPGSRAGSQASESRISTTFSRFTGRRSR
FT                   EKFTNDGVSEGEVDELTEKELGPTEKFSPPSGERKDKSPRRTRDSERVRDKLKDKSREK
FT                   IGRKLDRECVVM"
FT   CDS_pept        join(296278..296525,296619..297311,297409..297532)
FT                   /gene_id="IGI22628255"
FT                   /gene_family="HOG000172464" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01270"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK43023.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniParc:UPI0000EFCD76"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSV5"
FT                   /transl_table=1
FT                   /translation="MAASEPSRYLARSLPRALVPSSRAPAFCWRRNASDQASTRSPSAD
FT                   INELESTTLSTPLSQDTVKSFNPLERARARKTQLPRSRYQFRSPKYDRGPLHPHRPPPP
FT                   SDPSSRLFVPGPFSLPRVAQTWQSTVAPDLLTLLYVHNPPGFKPPPKAPRLRSWDDSSP
FT                   YHKNRSLRGPRGGDVLRLLRKPITFNNIPKIERITLHSYVKQAATNDSSWLHVAGMALQ
FT                   AVTNVKVETFKSKTSVAQWHIAPGRDTVAAKAELRGENMLHFFGKLVDVVMPRLKDWQG
FT                   VKGSSGDSSGNITFGLEPEEMALFPEIEVNYDMYPPKMIPGCHITIHTSANTDKDARLL
FT                   LSAMGVPFYGKLVN"
FT   CDS_pept        join(complement(301070..301251),complement(300937..301010),
FT                   complement(300724..300881),complement(298369..300672))
FT                   /gene_id="IGI22628256"
FT                   /gene_family="HOG000172453" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01280"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK43024.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="UniParc:UPI0000EFCDA7"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSV6"
FT                   /transl_table=1
FT                   /translation="MLAKATYNPLGVSATQTPTTSYYTGSSQKPTAIGDSQKGMMFTSP
FT                   TESSFSDAYDGLDAVRSWDEKQVIAWLHSINCGQYEALFKAPANNFNGNNLIECDQKIL
FT                   QEMGIKKIGDRVRIFVAIKQLRNKSVLNGKSRNLNQLATLEAVSYTNTSSEPSRPSNLR
FT                   QTSATSTTRRSSRAAETNALNYSANRPSSRPESPLRPQQYVANSPMEMGRMEQGQSYFS
FT                   HPSSGSSMTSRKPGTPSERSGSHLRQNPSLDGLTMGQLPMNSPVIRVIYTGGQTKMLDI
FT                   KHCRDADEVVLCVLKKLQLPEHQYRNYCFYVLDGLEPNPANCRRLTDQELMEVCESTHR
FT                   SERGRLILRKIHAGEPDPDELRRASQLAVDESQLAHMNALSSSNVRNQLKIQQLTGEPW
FT                   HNIRQPMSPVSSRHNQTPSEHDMRPPMNVERQVGKLRSFFGARPPSEMIIHEITSYFPS
FT                   HQREEIEKTMRMSVRRSQRLSRAASRLSVVSNTSYASSLRDAPPIPSIADTWLNAGPQP
FT                   ARGQRPLSVSKFNLPSATYRDSIASSSLQPLQEESPIEPNRKSYVSFDSGSDDPTTSRQ
FT                   SLVDENASVAATDGGSLNERLSILVAEDGEEEDDGLNDFLAGNNFAPKNWMKGSLIGEG
FT                   SFGSVFLALHAITGELMAVKQVEIPSATKGTEFDKRKNSMVTALKHEIELLQGFHHPNI
FT                   VQYLGTAADDQYLNIFLEYVPGGSIATMLKQYNTFQEPLIKNFVRQILAGLSYLHSRDI
FT                   IHRDIKGANILVDNKGGIKISDFGISKRVEASTLLGARASGGGGHAHRVSMQGSVYWMA
FT                   PEVVQQTIHTKKADIWSLGCLVVEMFTGAHPFPSCSQLQAIYAIGKEKARPPAPEHASD
FT                   EAVAFLDMTFQVDYEKRPSADELLKCKFLANPLA"
FT   CDS_pept        join(complement(303420..303534),complement(302984..303045),
FT                   complement(302676..302718),complement(302426..302607))
FT                   /gene_id="IGI22628257"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01290"
FT                   /protein_id="CAK43025.1"
FT                   /db_xref="UniParc:UPI0000EFCDA8"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSV7"
FT                   /transl_table=1
FT                   /translation="MNRPTPPNPELGTEMGPRSIYIDLHALLHEIKAQGRGWTRQIPRF
FT                   LVKAEWVLSKTSDKDWCNATVISIICSDINVNKAGQRHGKPDTKGRPGGSPMEGSVNTN
FT                   QIAAVSQPMNTKAVSFEGPPNAPAVTQTI"
FT   CDS_pept        join(304746..304878,304953..305007,305070..307515)
FT                   /gene_id="IGI22628258"
FT                   /gene_family="HOG000172442" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01300"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43026.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EFCDA9"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSV8"
FT                   /transl_table=1
FT                   /translation="MEDDRGTPGKVRKKSTPAHRKSLSCEYCSRSFARLEHLQRHLRTH
FT                   TKEKPFSCDICSKSFARSDLLVRHERLVHPTETAANREHRAQNSHDVPQTQPPIIQPTH
FT                   HESRMLELADAVPIHTQPVPPPPPEVQVQPPPIVETTHFNPSWGYDLNLLSHAASHVAL
FT                   EGEQESLESIRKSSQHVGTSQPLPHVPERAITDNYGVEPSILDLADLGDPVQDFTVFLE
FT                   SVGLSSDWDSGVFSTVEDPILPTTLPMDSKPPIREMARLGPELMSDPRTAADEQPSFSN
FT                   FGSRLPSLQPEPHDVDDRLGFGDEGPRPAWDISNADRQVFLSKLDEFAYILPKNFIPPS
FT                   RHALSRFFAGYINGLNEHLPFIHVPTLSVAKCSPELTLALAAAGSHYRFENNRGIELFH
FT                   AAKAILLQRLHRRDSKQVACPTWNFLSPASGFHNSRGSSAASNHTSSPFQQQHPTLYPA
FT                   DPSGYAPEDSDAHMEVIRTFLLLTVFASWERHPELLREMLSLQSTLARLVREHGLVEPP
FT                   PSPDPNNWEDWIRREGNRRTKFIVYCFFNLHSIMYNIPPLILNAELKLNMPCSHDVWKA
FT                   SNPAQWRRVLRTRHGPEVSFQEAFARLFFKSSTSSASAPISPLGNYILIHAIIQQIFFA
FT                   RQLCLSAPSMHGTSLRQEDLSALDNSLSAWKALWKRTPESSIDPQNPAGPIAFTSTALL
FT                   GLAYIRLHVDLGPCRRLITQDPMQIARALGESPPVARSPRLIMALLHSAHALSIPVRLG
FT                   IDFVARTHSFFWSIQHSLCSLECAFLLSRWLLSIPVTQAEQRLSEHERKLLLWIKSMMD
FT                   ETDMAVDPPGAPDLDFIANPYKAKQLSVAIVRVWARTFKGNTSWAIVDLVGSSLDTYAD
FT                   FLETQM"
FT   CDS_pept        join(complement(308682..309023),complement(308522..308611),
FT                   complement(308139..308462))
FT                   /gene_id="IGI22628259"
FT                   /gene_family="HOG000172431" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01310"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43027.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EFCDAA"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSV9"
FT                   /transl_table=1
FT                   /translation="MSKRSRSTSPSPSPSPSPHSSPSSSLSNRPKIPSLDPTATTTPNQ
FT                   EVMHCSLPPHRETISFTSYEDYEVHYRQAHVNRCSQCGKNFPTERFLNLHIEENHDALV
FT                   ATRRERGEKTYACFVEDCERVCSTPQKRRMHLIDKHMFHKTYNFYIVNDGIDKQTSLLR
FT                   TPHDHRRRLSSAAPGPTSPKEGRLRYRQTSISQADSGASAQKGPQATTRQDAAAAPAGD
FT                   EGIAELERSMSALRFVPASVVRSRGKQKS"
FT   CDS_pept        join(310381..310528,310642..310709,310778..310955,
FT                   311020..311610,311665..312215,312277..313311)
FT                   /gene_id="IGI22628260"
FT                   /gene_family="HOG000172420" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01320"
FT                   /function="binding"
FT                   /protein_id="CAK43028.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019458"
FT                   /db_xref="UniParc:UPI0000EFCDAB"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSW0"
FT                   /transl_table=1
FT                   /translation="MPNPASYRTALEVEKELLKSLAEKEPTFAEISHYLSELVAPLLPS
FT                   CGALDVEPRLWDAHLKINTRFRKLLSRFREESGKKKKPVERRKLEKHYLEFIKSSQRFY
FT                   RAYIQQLSSHFGGIPELEKVARKFNSDNLSAEPPIRTSEALRTHILQSCHSTLIRLGDL
FT                   SRYRETELVSKNRNWGPAIGYYDLATLIYPASGAPHNQLAVIALADGNHLRATYHLYRA
FT                   LAAQEPHPSAKGNLEIEFRKVMNAWVKRELIRPEDAGIPGRSLAPWFVYLHAQCYRGID
FT                   FPEHDELESEVLNQLAVDLKERSLEGTLQKFCLINIAAEEFSRTHTSEDSTSNARSFFQ
FT                   RINVKTFFTLLQILLAEVERFAVEDPSNKDAKTGPDKVTVVARRVLPALRNYSSWLLTA
FT                   SSLLVSYQGEKDSPLAVQIIEFWKIYANTLTLLASTFDVVNLPEIDYLLEEDEETLCFA
FT                   PLAKEATSRRYLSSNGQQKPRMNDPGVERNHPNMEMLYRIREFVIDGLDLVVSKKIPIA
FT                   LVDDEDKKTFIYQEEGLPSQFFASPSGHHHTISSASIERDDIQKAAPDPSHNIDTRSVF
FT                   GGSQAASASMSASMHRIVEGVERLVESDTYENAPAVPEQLAFARSSNQQRPSSQFFDSS
FT                   MDSIFQEDLLPRQTPAAPPGLVPPVTGSAPLVRVSSSHSYTPRPALPGIPSIWNTALSP
FT                   ELGDAPSPRTPPGLGQHYPASMLPGNITSPNHHLPTQDMIANELMLRQSMINQASRHSP
FT                   LNGPSTIPSSWMPSPSSTSHHRLSGFSWDRTLVDTAANTPGSLGVSSQPMSSGLSNASW
FT                   ANNAFIASSFPSGTGFPSSGFTNSRKSATQYGAIGQTPPCGHGG"
FT   CDS_pept        join(complement(315860..315911),complement(315738..315753),
FT                   complement(315513..315666),complement(315101..315442),
FT                   complement(314706..315043),complement(314531..314644),
FT                   complement(314409..314454))
FT                   /gene_id="IGI22628261"
FT                   /gene_family="HOG000172419" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01330"
FT                   /function="adenosine kinase activity"
FT                   /biological_process="purine ribonucleoside salvage "
FT                   /protein_id="CAK43029.1"
FT                   /db_xref="GO:0004001"
FT                   /db_xref="GO:0006166"
FT                   /db_xref="InterPro:IPR001805"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI0000EFCDAC"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSW1"
FT                   /transl_table=1
FT                   /translation="MAAPQGYPLLCLENPLLDIQAVGDAALLQKYGLKDNDAILAEDQH
FT                   MGLYDELFAKNDVKLIAGGAAQNTARGAQYALPANSVCYIGCVGRDKYAEILKEACEQA
FT                   GVHTEYRVDDAQPTGKCGVIITGHNRSMCTHLAAANEYKIEHLKQPHVWSLVEKAQFYY
FT                   VGGFHLTVCVPAIQALGEEAAAKNKVFMLNLSAPFIAQFFKDQLDSVLPYTDYTFCNET
FT                   EARAFSESHSWGTDDVVEIAKKLAQLPKKNTNRPRVAIVTQGTLPTVAATVKPNGEVEV
FT                   KEIPVREIPKSSINDTNGAGDAFCGGFCAGIVQGKSLEDSIDMGQWLASLSIQELGASF
FT                   PFPKQAYTPINRS"
FT   CDS_pept        join(316287..316598,316691..316885,317053..317091)
FT                   /gene_id="IGI22628262"
FT                   /gene_family="HOG000172398" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01340"
FT                   /protein_id="CAK43030.1"
FT                   /db_xref="InterPro:IPR013898"
FT                   /db_xref="UniParc:UPI0000EFCDAD"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSW2"
FT                   /transl_table=1
FT                   /translation="MTDPALQIPEVIQTASINPAPSPEHDVNPPTAASEKQPIVEDDVA
FT                   SEAGSIPSDVVDPHRMIKPVSRRHHLPPLPDLRFEQSYLASLRGADTWGRVAWITIRDQ
FT                   VLLPLIQGTVWTLALSGWRFWNRNASLSGQTLGSKIRRWWYEVNNWKLPPLRSARDPHM
FT                   AAKVEDFYTAQFSNAGAD"
FT   CDS_pept        join(complement(319566..319766),complement(319292..319461),
FT                   complement(319035..319164),complement(318609..318977),
FT                   complement(317728..318555))
FT                   /gene_id="IGI22628263"
FT                   /gene_family="HOG000172387" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01350"
FT                   /protein_id="CAK43031.1"
FT                   /db_xref="UniParc:UPI0000EFCDAE"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSW3"
FT                   /transl_table=1
FT                   /translation="MSNMSLSDSDLSSLSSAPPSDEETGSMAIDEPVGIAKYFKKESES
FT                   PPPKREPSPPHEYVLADNPDIAFIVMFRARFHDAFPRSTPHFGPQDVERGVAESPPGDH
FT                   IERLLCAFLGLVLNRKKDVDRNHYQRPLEEAIQTHASQWPKAWQGKNPLHGGRTFATMS
FT                   PEERLLLLRSLILWSLASSDAIQAKIKESYKQARHEDDLNQPLSVQPWGRDGLKRRYWL
FT                   IEGLDDTHFRLYREGNPALKNVTWWSVAGNIPELKAVADRLDGEKSIHSKKLSERIRNS
FT                   IPRFEGSEEKRKRRDYRIARKAAFARPEPGFSLYEGRTRGKKLKYTYSDDEDIFSDGLP
FT                   STRRSTRNTSGISTPPEPAGPRFTASGRQIRSRAGGLYGETLLSGQREDGDAGDEGRPS
FT                   RGRTTRANGYTEYEDDEMDEGSEAGQSSGNEWQGGEGEEEEDNDFEGDDEEELSGDEAV
FT                   MNGEPPSLVVQLRYNKDKAPSSPNGPAEEPLQQDPKSKEDVAKPVTATGAEDALQGQPP
FT                   PALNGQSATAQSSQPDVVAKSLPDAAASTSTSVDVSQPTATETKTQTA"
FT   CDS_pept        join(321250..321298,321382..321873,321966..322051,
FT                   322114..322251)
FT                   /gene_id="IGI22628264"
FT                   /gene_family="HOG000232983" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01360"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK43032.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniParc:UPI0000EFCDAF"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSW4"
FT                   /transl_table=1
FT                   /translation="MGRVIRNQRKGRGSIFTANTRLNKAPAQFRTLDYAERHGYTRGVV
FT                   KEIIHDPGRGAPLAKVQFRHPYKFKTITETFIANEGMYTGQFVYAGKNAALTVGNVLPL
FT                   ASVPEGTVVTNVEEKAGDRGALGRTSGNYVTVIGHNPEEGKTRVKLPSGAKKVVKNTAR
FT                   GMIGIVAGGGRTDKPLLKASRAKHKFAVKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKA
FT                   STISRYAAQGQKAGLIAARRTGLLRGTQKTKE"
FT   CDS_pept        join(323293..323590,323657..324114)
FT                   /gene_id="IGI22628265"
FT                   /gene_family="HOG000172376" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01370"
FT                   /function="methyltransferase activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43033.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniParc:UPI0000EFCDB0"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSW5"
FT                   /transl_table=1
FT                   /translation="MVPPPKLPLPKPSLSPSSTSPSTRWLAIQTRDPKFTNAFVYAVLT
FT                   TKIYCRPTCPARLARRANVRFYDTASQAELAGFRPCKRCKPEIVINNSNNLLGAVQRAC
FT                   QTIRASVQAGSKPTLRMLAAEAGLTPSHFHRVFKRVMGVTVGRYVVDVIRKSGDGEVLE
FT                   GSCRDWVGGEGEGEDAGNWPVLWNDFDVLLAAEEEDGFVVPTTVTMQDVQPVVPVQDEE
FT                   LLAWRAVGSYGVGGGCSVDETLALGHEAL"
FT   CDS_pept        join(complement(326925..326950),complement(326787..326849),
FT                   complement(326381..326645),complement(326103..326213),
FT                   complement(325802..325938),complement(325645..325692),
FT                   complement(325369..325474),complement(325001..325120))
FT                   /gene_id="IGI22628266"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01380"
FT                   /protein_id="CAK43034.1"
FT                   /db_xref="UniParc:UPI0000EFCDB1"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSW6"
FT                   /transl_table=1
FT                   /translation="MAPQPGGEKPGGTGWVLREGSKRVTGEISSVHRGMTDSNSNDHNA
FT                   IANRKRARHSAMELVARKAPHCLFKVPSGFSPPPTLDPNGPGKRIWSHDDSRCLAWSVL
FT                   IPSILSFQSVMLYWDEVYLKPSSSPIWNFQLVGWSTLAGFSQGTDAPVAQPWGSTAVDW
FT                   RSMADGRSQTWSSIGSSPLPPLEIRSIYRTDCGRLPTQVELLFLVGGAAPKDELASVGR
FT                   DHRVMMQDLSDASTIIAIGESEKLIWRKLAKGDPYTEKSGTRGPQAGKRYTDYPNTITM
FT                   LNASALKQEC"
FT   CDS_pept        join(327171..327297,327365..327532,327590..327705,
FT                   327767..328047,328100..328703)
FT                   /gene_id="IGI22628267"
FT                   /gene_family="HOG000172364" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01390"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK43035.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="UniParc:UPI0000EFCDB2"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSW7"
FT                   /transl_table=1
FT                   /translation="MNVNRKFDRFKQWAGERMGGEAKTTLSDDFKALETEMNVRHEGID
FT                   RIHKATGSYIKSISKRSEGDDKEKTLPIAHLGSSMVGHGEDFDANSEYGRCMTMLGRAE
FT                   ERLARLQDAYISQVNAGWLESLEHSLTQMKEYQTARKKLDSRRLAYDTSLSKMEKAKRE
FT                   DFRVEEELRTQKVKYEEANDDVSRRMQDIKDSEVDGVANLEAFLEAQLDYHERCRDVLL
FT                   QLRYDWPSRAQPPSTRRPGRPRSNTAHSYHERYEPLHEETDNTADLRPIIRSTRASSIE
FT                   PAAREVYPPDAFSQRPALNRTTTFEGPTQLRQEQSPGTYQWPSRAASDNYIGRRNSVQS
FT                   RTMGRSYVDPYMEQSEEPSPISGTSPERTYMGRNPSPVSSYGGAVSRKSSSTTLNGTPL
FT                   NKKAPPPPPPRSKKPAPPPPPMKRPILSAGEY"
FT   CDS_pept        join(complement(329534..329648),complement(329156..329391))
FT                   /gene_id="IGI22628268"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01400"
FT                   /protein_id="CAK43036.1"
FT                   /db_xref="UniParc:UPI0000EFCDB3"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSW8"
FT                   /transl_table=1
FT                   /translation="MWRDGELLMSMNATGSGLYLDLGDKFRDVWTRPGETQGGDGAFAT
FT                   FRAGRGNWRCSACACNEERQAARRWKKISCRVTCIHCPRPSLTQLGRTGLPALDLASCP
FT                   PSALRANIGILR"
FT   CDS_pept        join(329826..329918,330059..330278,330349..334064,
FT                   334118..334345)
FT                   /gene_id="IGI22628269"
FT                   /gene_family="HOG000172362" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01410"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43037.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006562"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR014978"
FT                   /db_xref="UniParc:UPI0000EFD11A"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSW9"
FT                   /transl_table=1
FT                   /translation="MASLQSAPSMAAGNMSLPPNITQQQIQEVFQMQEQGVRHDDPEYL
FT                   KAHNLLSAFQRQQAYHKQRQMQQQQLQVQQRQQQQQQQQQQQQQLNGSNTDAVAANGMN
FT                   GRNNSIPSATNTNIPDASATGGQQPVAQGVPQKGAPGTGNSFSAEQLATLRNQILAFKM
FT                   LSKNLPIPARVQQQLFPSKKQETPAPSENVAAAEGVLEATAQSKPDQPTTTEAPQHKDF
FT                   YQNFQAPYDLIPKTVSFTDHASRANRMRIPALMPPGIDLEQVREEREIALYNRINARKA
FT                   ELAELPANIGAWDSSQSDTATADDSVKLKALIEYKMLNLLPKQRLFRKQIQNEMFHFDN
FT                   LGMTANRSSHRRMKKQSLREARITEKLEKQQRDARETREKRKQYDHLQAILTHGAELQT
FT                   AAAQQRTRMQKLGRAMLQHHQHMEREEQRRVERTAKQRLQALKANDEETYLKLLGQAKD
FT                   SRISHLLKQTDNFLKQLAASVREQQRSLAERYGEEDQFFEEDEEEEIASGSEDEGDGKK
FT                   KIDYYAVAHRIKEEVTVQPSILVGGTLKEYQMKGLQWMISLYNNNLNGILADEMGLGKT
FT                   IQTISLITYIIERKKNNGPFLVIVPLSTLTNWNLEFEKWAPSVSRVVYKGPPNARKQQQ
FT                   QQIRWGNFQVLLTTYEYIIKDRPILSKIKWTHMIVDEGHRMKNTQSKLSSTLSQYYTSR
FT                   YRLILTGTPLQNNLPELWALLNFVLPNIFKSVKSFDEWFNTPFANTGGQDRMELSEEEQ
FT                   LLVIRRLHKVLRPFLLRRLKKDVEKDLPDKQERVIKCRFSALQAKLYRQLVTHNKMAVS
FT                   DGKGGKTGMRGLSNMLMQLRKLCNHPFVFEPVEDQMNPGRGTNDLIWRTAGKFELLDRI
FT                   LPKFRATGHRVLMFFQMTQIMNIMEDFLRLRGLKYLRLDGSTKSDDRSDLLKLFNAPDS
FT                   EYFCFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRILRLIS
FT                   SNSVEEKILERAQFKLDMDGKVIQAGKFDNKSTNEERDALLRTLLETAEAADQIGDQEE
FT                   MDDDDLNDIMARSDEELTTFQRIDKERQKTVQYGPGHKYPRLMCEEELPDIYLTEDNPV
FT                   TEEVDVELAGRGARERKVTRYDDGLTEEQWLMAVDADDDTIEDAIARKEARVERRRVNK
FT                   EKRQKKTVGDSSPEPSRENSETPQPKKRRRGPAPKRKAEEVVEETPQPKRKRGRQAKPV
FT                   ETLSPEDRAILQRIVNTVYQALMDMEAELPADSSDSEDGPVTRSIIEPFMKPPPKSHYP
FT                   DYYMVIQNPIAMDMIKKKINREEYQSLKDFRNDIHLLCQNARTYNEDGSILFQDANDIE
FT                   AKCLAELKKETEGYPQFANYDDLGGQGGNDQSTAAASGAETPSAVATPKLKLTFNSGNR
FT                   DNAAAAGAGNGVNEND"
FT   CDS_pept        join(336539..336592,336862..337068,337143..337151,
FT                   337281..337344,337418..337475,337554..337671)
FT                   /gene_id="IGI22628270"
FT                   /gene_family="HOG000172351" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01420"
FT                   /protein_id="CAK43038.1"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniParc:UPI0000EFD11B"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSX0"
FT                   /transl_table=1
FT                   /translation="MASFQDRAQHAIAQLDKELSKYPVLNNLERQTSVPKVYVILGLVG
FT                   VYFFLVFFNIAGEFLVNLAGFLIPGYYSLNALFTAGKADDTQWLTYWVVYAFFTVIESA
FT                   ISAPYWFPFYYIFKFALVLWMSLPQTNGAQVVFHSFIQPVLGRFFQGGSTSANLRAQAE
FT                   AAAKDQ"
FT   CDS_pept        join(complement(339355..339433),complement(338935..339273),
FT                   complement(338651..338838))
FT                   /gene_id="IGI22628271"
FT                   /gene_family="HOG000172330" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01430"
FT                   /protein_id="CAK43039.1"
FT                   /db_xref="InterPro:IPR012445"
FT                   /db_xref="UniParc:UPI0000EFD11C"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSX1"
FT                   /transl_table=1
FT                   /translation="MEPRKTPPEYFLEIFADTTNVRDVLKGILNTIFFHRYFPSIRPIT
FT                   FDVLDFTLPAINDVDLETLIDSRVSSLVRQHSSAASAPDGGGGGVRARMAVEFYEKRRR
FT                   RPGIWFGGLSGKGEEEVCWEVWNLDVTIATPRTESERAKVRKAMENMLQKAVLKILAVV
FT                   NRDKEHIPPITTSDSNPFPYRVVLNPRSDGWQNRFGLY"
FT   CDS_pept        join(340474..340631,340728..341080,341142..341538,
FT                   341599..342292)
FT                   /gene_id="IGI22628272"
FT                   /gene_family="HOG000172319" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01440"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="integral to peroxisomal membrane "
FT                   /protein_id="CAK43040.1"
FT                   /db_xref="GO:0005779"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="InterPro:IPR006966"
FT                   /db_xref="UniParc:UPI0000EFD11D"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSX2"
FT                   /transl_table=1
FT                   /translation="MISATKRWFRRNRKGLAIGAGVIGAGYLAGQYLLSKISEARERMS
FT                   SDRIARENLRRRFEQNQTDCTYTVLALLPTAAEDILEALPVEELTKELQKKRAERLARL
FT                   NAGEGTGSDLSSVGPSITDDDRRSLSSFQSDGFVRTSQLGESTIEGSGSPRPKRNKTQL
FT                   WNEVKITSITRSFTLIYTLTLLTIFTRIQLNLLGRRNYLSSVISMATPPADGSTIRLED
FT                   HDDDDLTQTLGNDFETNRRYLAFSWWLLHRGWKQLMEEVQAAVTEVFGPLNPREDISVS
FT                   KLSELILQVRGKIEGVTEEDRKYRKWLSYVLPSREEEDHLLQESGVLGVTEPATPQTTA
FT                   SLRHLLDETADLIDSPTFTRVMLLLNNECFQTLIEQCKADAFKSSTQVPTSVPQSFTSV
FT                   ATVVPAADGSDTKTKLANVLAVLARQAHVIGNGTAPPNLYLTSIEQGVRELEAFAAVIY
FT                   SSNFDSELLGTDPRTQPSGAEAGFEVPTSPAPEMIEKEEVSEEGPTPGASVVAVDDDSA
FT                   FEKAWGKAVDDQPSSS"
FT   CDS_pept        join(343258..343433,343518..343525,343958..344126,
FT                   344204..344352,344459..344584,344642..344998,
FT                   345099..345114,345164..345225,345276..345593,3
FT                   45654..345898)
FT                   /gene_id="IGI22628273"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01450"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43041.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000EFD11E"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSX3"
FT                   /transl_table=1
FT                   /translation="MASDCADKQSDETFEWHGLGATMDRTIMLSNAQPVRLSDLRIRPK
FT                   WVGFVRPVPFSSLMLDDRSPQPGPGLKPEDHIEALPSDLPVLTTTTERRLLAKIDWHIV
FT                   PCLCVLYLLAFLDRNAAVLGLETDLNIATGTKYNTALTIFFVPYVIFEIPSNILLKKLK
FT                   PHVWWLSLKLGWTDDYTLVPGYEGIHIQRHIANIDTGMFETGMFPGCFYLLGMWYKRSE
FT                   AQKRFSFFFSSTTLAGAFGGLLASGLGEMAGLRGYGGWRWVFIIEGVITCVVAIVWFFI
FT                   IPGFPEDVKWLNEEERMYIRAKLARDAGKAGHDARMGWRDVLAVFKDCCHSIWVTSSGY
FT                   AFFAPTIIKTYGYGTILTQLYSIPPWAAAFAFSMIIATFSDLTRHRLAFTLIPTAIAMA
FT                   GFGILLNVHGEAHRHVQYGALFMVTCGCYSAMPVIVCWFAMNLGGHRRRSVGTAWQVGF
FT                   GNTGGIISTYAFLAKDAPEYRNGYIISLSFICFSAACCIGYFVALWTENKRRDRVMANG
FT                   APAELRADEEEVQGDLAVTYRYGY"
FT   CDS_pept        join(346687..346795,346879..346916,346945..347151)
FT                   /gene_id="IGI22628274"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01460"
FT                   /protein_id="CAK43042.1"
FT                   /db_xref="UniParc:UPI0000EFD11F"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSX4"
FT                   /transl_table=1
FT                   /translation="MMIPVMIVTWFGISIEACLVCHNILGAIDFGARRSADSGGASAAS
FT                   FPSEARWKSQMVFLYSCTILLFAIADELLRGDWSISRVLGSVGEIRWNSGPWRGHENLF
FT                   QIPKSLRRTSYSL"
FT   sig_peptide     346687..346737
FT                   /db_xref="UniProtKB/TrEMBL:E2PSX4 "
FT   mat_peptide     join(346738..346795,346879..346916,346945..347148)
FT                   /db_xref="UniProtKB/TrEMBL:E2PSX4 "
FT   CDS_pept        join(347422..347569,347657..347988,348056..349057)
FT                   /gene_id="IGI22628275"
FT                   /gene_family="HOG000172308" [ FAMILY / ALN / TREE ]
FT                   /orf_name="An17g01470"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43043.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR009668"
FT                   /db_xref="UniParc:UPI0000EFD120"
FT                   /db_xref="UniProtKB/TrEMBL:E2PSX5"
FT                   /transl_table=1
FT                   /translation="MPSDKVEKKRKRASDRHERPSKKPALELQDLPPLASSVVEDDSEL
FT                   APVIITTPGLNAPRNLRLNPYLKTRSKTSSSSSRNKGIVSSELLLQSSEHPKLDFVGRE
FT                   AEEDADSQLKHYVAVVDPENKTWQFIEVRKMTLRGAVRKMGAIEEEEEEESDEEEMKTM
FT                   RAQRTELTNTFGTKQSRKAAQSLAENAQLSNVPSGAASAAETAILGAMPADAATDIASK
FT                   TAALQAQVQAAKPLPQANLDAAHPSEVYPLDVLVPNGLATLRQLPNIKEWQDSVNSGAA
FT                   VNTTSRYVSRRVEAVALSGNTTHLQILRFILLLLELARGLRPGRDKSAGPGSKRLPPRE
FT                   DLRRILSGGTTSENSASGEQLADPVIDAVRRKFAPQGASLSKNDITFLHTTICALSLHI
FT                   PPQPSKDGGNSSAGGNAPNELATDPSDLRDDLRLDNVAITQYFRELGCRVDKPRESEFA
FT                   KWGIKGGKAEAAARRVARLKIPVEFPKVSRGGGRR"
FT   gap             349776..349875
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(352427..352772),complement(350750..352353))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221020" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891656"
FT                   /orf_name="An17g01480"
FT                   /product="Catalytic activity: succinyl-CoA + glycine  "
FT                   /EC_number="2.3.1.37"
FT                   /function="5-aminolevulinate synthase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /protein_id="CAK43044.1"
FT                   /db_xref="GO:0003870"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="HOGENOM:HBG649839"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000EFD121"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9H8"
FT                   /transl_table=1
FT                   /translation="MESLLQQSRAMCPFLKRTSPTTLRSLSTATRPSTSPGGGTMSNLQ
FT                   VLARRCPVMSKALAVQSARLAHTKRFTSYTAGVAGLNPKQFRPTVGKRALHSTAGNGAD
FT                   VTPNVYKESQRVHPGLTGVPKQQLEPSAATVPGPRPHAPNAAPFNYNAFYQGELEKKHK
FT                   DKSYRYFNNINRLAKEFPRAHTASPEERVTVWCSNDYLGMGRNPEVLKSMHKTLDNYGA
FT                   GAGGTRNISGHNQHAVALESTLAKLHNKEAALVFSSCFVANDATLATLGSKMPDCVILS
FT                   DSLNHASMIQGIRHSGAKKMVFKHNDLVDLETKLASLPLNVPKIIAFESVYSMCGSIAP
FT                   IEKICDLADKYGAITFLDEVHAVGMYGPHGAGVAEHLDYDIYASQDTANPRDTKGTVMD
FT                   RIDIITGTLGKAYGCVGGYIAGSAAMVDTIRSLAPGFIFTTSLPPATMAGADTAIQYQA
FT                   QHQRDRVLQQLHTRAVKESLKELDIPVIPNPSHIIPLLVGDAEVAKQASDKLLEEHGIY
FT                   VQAINYPTVPRGEERLRITPTPGHVKEHRDHLVQALQTVWNDLGIKRASDWEAQGGFVG
FT                   VGVEGAEAANQPIWEDAQLGLQPNETVEAAVTREFQTAAAEALSQAASRMQTATPVRPA
FT                   AAAAASIPVGVAAA"
FT   CDS_pept        join(complement(358730..359248),complement(358108..358653),
FT                   complement(354231..358050),complement(353964..354172))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048482" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891657"
FT                   /gene_name="ino80"
FT                   /orf_name="An17g01490"
FT                   /product="Putative DNA helicase ino80 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43045.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG398013"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR020838"
FT                   /db_xref="UniParc:UPI0000EFD122"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R9H9"
FT                   /transl_table=1
FT                   /translation="MTGAPPYNPQSPTQQSRYPVYSPPAKSRPYYANNEQYQQHPPQTP
FT                   PAFSSRSPHFSHAPSPLPGTLPPLNGAAPPSSHPSEPPSQYQAHSSAGNPQFALPRPYP
FT                   GSVLSGNGASPYGHSTPSHAHPAGRPDSHPQTSPKKESESQFPMSTHGVMGYPSSVVRE
FT                   PRASSPPKDVKPTRAADPMSFASILSGPTEERAPPPRQSSAEATPTPLAPAATAQTSLS
FT                   PPPVASAATSQKSKDRAPALTASLPRLEKKPTTEKRRRNPPETEQKTADSRTSNVANGV
FT                   SEPSKTLAQPRGAGSRPVMSERETEALNKALADMAEADKSDVEAPGYDRFREEYRAKGK
FT                   KRAFATEQAEILRRKRRRNDFLVKLSKSLEKQATAGMDRFRYANEASVVAEVQAKEIQD
FT                   EKERKKDMQRKRRRENTVRMEMQKKKEAEAKAHEAQDSAEKAKFLREAERAQRKIKTTK
FT                   RALEGITAPEEISEVTPLAPNLEGGTTSSFHIGRGSPSRRKSGRGGPVTRPKKSKEQKQ
FT                   AEKDAAEAAYAAMENDEPLPIAPKEDPRKESLKKEVKGGRSKEPTPTPLSAYETKGYNQ
FT                   IYEQIWRDIARKDIPKVYRIKALSLSTRQENLRKTAQLASKQSRKWQERTNKSMKDTQA
FT                   RAKRTMREMMSFWKRNEREERDLRRLAEKQEIESAKKAEAEREANRQRRKLNFLISQTE
FT                   LYSHFIGRKIKGAEGDAAGDTAVEATGETVQPGKGQDHTIDMPSSVADAGTKVTNFEDL
FT                   DFDAEDETALRQAAMANAQNAVQEAQDRARAFNSGQNQMDALDEGELNFQNPTSLGDIE
FT                   ISQPNMLTAKLKEYQLKGLNWLVNLYEQGINGILADEMGLGKTIQSISVMAYLAEVHNI
FT                   WGPFLVIAPASTLHNWQQEITKFVPDIKVLPYWGSAKDRKILRKFWDRKHITYTKESEF
FT                   HVLVTSYQLVVLDAQYFQKVKWQYMILDEAQAIKSSQSSRWKNLLGFHCRNRLLLTGTP
FT                   IQNNMQELWALLHFIMPTLFDSHDEFSEWFSKDIESHAQSNTKLNEDQLRRLHMILKPF
FT                   MLRRVKKHVQQELGDKVEKDIFCDLTYRQRAYYTNLRNRVSIMDLIEKAAVGDEADSTT
FT                   LMNLVMQFRKVCNHPDLFERAETKSPFSTAYFAETASFVREGNNVDVRYSTRNLIEYPM
FT                   PRLLCGAGGRVDVAGAENPHAGFRGRYLNHLMNIFTPENMKQSIQDDGAFSFLRFVDTS
FT                   LGEAYEQSHLGIFERAVRRRGQVNRLSRLNVAYDDDKELAGSALPHTLFNIVDRNDKHA
FT                   VNEVAAEGIMRDLMTVSQSTYEREGLNIIEPCVSPAASAPPISVVSSSHIPSIETRDTL
FT                   FNVSVRHALYSTPSRQVDEQIIEKKVDPTPYSLAPMLPKPISAKGRYTHIEVPSMRRFV
FT                   TDSGKLAKLDELLRELKAGGHRVLLYFQMTRMIDLMEEYLTYRNYKYCRLDGSTKLEDR
FT                   RDTVADFQQRPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQ
FT                   TRQVTVYRLITRGTIEERIRKRALQKEEVQRVVITGGAAGGVDFNTRNRESRTKDIAMW
FT                   LADDEQAELIEQKEKEALDRGEVFGAGKGGKKAAQKRKKDITLDDMYHEGEGNFDDASA
FT                   KPSGAATPVSTAENVGTPSSTPAPKRGRGRGSGKGTSKRAKTTKERLRLIDGDGGLGPS
FT                   "
FT   CDS_pept        join(complement(360101..360332),complement(359665..359989),
FT                   complement(359494..359497))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810384"
FT                   /orf_name="An17g01495"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43046.1"
FT                   /db_xref="UniParc:UPI0000EFD123"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9I0"
FT                   /transl_table=1
FT                   /translation="MGECRKKRKKERDKMRENEGESWPKGGEREAAAQKNQKILEPSPS
FT                   SSSSSIQSIPSQSPVQSIFISTSISLIIIYEFYHHPPLFFPLTCCSPPPLPSFTSNLPP
FT                   SPHLNPNPSSIHPEGLRYGHCWVSQVVFAAGPGPFPDRVAHSRLGWACVSCRILSGTVD
FT                   PWRVCWLAHHKHFGALRRFLSIR"
FT   CDS_pept        join(complement(360829..360927),complement(360669..360790),
FT                   complement(360551..360583),complement(360380..360455))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963560"
FT                   /orf_name="An17g01510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43047.1"
FT                   /db_xref="UniParc:UPI0000EFD124"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9I1"
FT                   /transl_table=1
FT                   /translation="MYAGHCRPMQALQIMSKSPGGAAAHATITPHDQRDDGRTGGQELA
FT                   GISIITRVSVSHSQSLSPFPIEGDDVWRREKCYNPLEGIMSRLEEGIVLLRTSALVIWA
FT                   TASGQ"
FT   CDS_pept        join(complement(363236..363384),complement(363019..363156),
FT                   complement(362668..362900),complement(362512..362582),
FT                   complement(362313..362440),complement(362203..362258),
FT                   complement(362002..362127),complement(361874..361953),
FT                   complement(361694..361804))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891658"
FT                   /orf_name="An17g01520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43048.1"
FT                   /db_xref="UniParc:UPI0000EFD125"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9I2"
FT                   /transl_table=1
FT                   /translation="MTKIPSDGRLMNAIDVYVRRIIRVFQVKGRESFVALCSCVLVVLP
FT                   GMTDRGLVPGDTDKEAVTEPRAGFWSLGRGGHPRAYCMINPIRDEIPQTGQRHRRHGNQ
FT                   TLSPQLPIAGKAWGERHPETRNPRCIRGTLAIETVYYQIPATRTALSRPSPSLQCLVRV
FT                   GKEGLIVPMEEAAAMKAGSRSMLADRSAATADFNDRCIASLCLTPSSRMFFSFLRVTML
FT                   LVPIPQTLRALPNPVTGWPQPISQLPGGSMVFPLSGGERADGRLKKPSCGWADRVPPGH
FT                   PPDHRLILTSFGGVLSNGSISWYKCPDQPTHYGWDASTPGFARQERVIAIYPSLGHALL
FT                   AAWVNLLVASGLSSTPIAAPAES"
FT   CDS_pept        join(363417..364067,364125..364479,364531..364577)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891659"
FT                   /gene_name="adhA"
FT                   /orf_name="An17g01530"
FT                   /product="Alcohol-dehydrogenase adhA from patent WO8704464-
FT                   A-Aspergillus niger"
FT                   /EC_number="1.1.1.1"
FT                   /function="alcohol dehydrogenase (NAD) activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43049.1"
FT                   /db_xref="GO:0004022"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000014212D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9I3"
FT                   /transl_table=1
FT                   /translation="MTIPEKQWAQVVEKKGGPPVYKQIPVAKPGPDEILVKIRYTGVCH
FT                   TDLHAMKGDWPLGLKLPLVGGHEGAGVVVATGDLVNEFEVGDHAGIKWLNGSCLACEFC
FT                   KQAEEPLCPHALLSGYTVDGTFQQYAIAKASHASKLPKEVPLDAVAPILCAGITVYKGL
FT                   KESGARPGQTVAIVGAGGGLGSLALQYAKAMGLRTIAIDGGDEKKAMCEKLGSEAYIDF
FT                   KTSKDVVEDVKAATPEGLGAHAVILLAVAEKPFQQATEYVRSKGSVVAIGMPAGAFLRA
FT                   PVFNTVVRMINIKGSYVGNRQDGVEAVDFFARGLIKAPFKTAPLEDLPRIFELMEQGQI
FT                   AGRYVLEVPQ"
FT   CDS_pept        join(complement(367225..367303),complement(366945..367145),
FT                   complement(366622..366759),complement(366033..366565),
FT                   complement(365890..365976),complement(365426..365810),
FT                   complement(365189..365343))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171300" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891660"
FT                   /orf_name="An17g01540"
FT                   /product="Remark: transport of 4-aminobutyric acid "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK43050.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG324420"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniParc:UPI0000EFD14E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9I4"
FT                   /transl_table=1
FT                   /translation="MAEKFKDAAQVADGDPPIEQGDSQLLATLGYKQELRRHYSTVQVF
FT                   AIAFSIMGLLPSIATTLSYSIPAGPVGMVWVWLHMHAGSTYMGFVANLTSAMPTAGGLY
FT                   FWTHYFSGEKWKNPLSFVVGYSNSLGLIGGVCSIDYGFATILLSVVSIARDGNWTASRP
FT                   VLYGTYVACVVVHGLIAIFCARIMPKIQSACIVSNVGLVLATVLALPIGKAVRGGQINS
FT                   GTYVFGHSENLTTWPQGWTFMLSWMSPIWTIGAFDSCVHMSEEASHAARAVPLGIIWSA
FT                   GLCGLLGFVSLALIAAVINPDLNAVLNSSFGQPMAQIYYDALGKSGALGFMIVVAIVQF
FT                   FMGLSLVVAASRQSWAFSRDGALPFSNFFRHVSKRVRYQPVRMVCFVVLISVILGLLCL
FT                   IDEAASSALFSLAVAGNDLAWMVPILSRLVWGKERFHPGEFYTGWFSKPIAITAVVYLA
FT                   YVIVLSMFPTGGPSPSPQDMNYTIVINGSLWLGAMVYYVVYARKVYRGPQMTVGGGGES
FT                   SGLEEDEK"
FT   CDS_pept        join(complement(370810..370852),complement(370589..370624),
FT                   complement(370359..370511),complement(369621..370280),
FT                   complement(368338..369569))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891661"
FT                   /orf_name="An17g01550"
FT                   /product="Remark: efficient transport out of the
FT                   prevacuolar compartment requires Nhx1p "
FT                   /function="sodium:hydrogen antiporter activity "
FT                   /biological_process="regulation of pH"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43051.1"
FT                   /db_xref="GO:0006885"
FT                   /db_xref="GO:0015385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG734847"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018408"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniParc:UPI0000EFD14F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9I5"
FT                   /transl_table=1
FT                   /translation="MATQVMGNFLHQLLRRAVDSDTDPDDADAPDTGDKEFFSSWALFI
FT                   LIMLLMFALFTSYILQQKKIQAVHETVLSIFAGMFVGLIIRLSPESPIQDSVTFDYQFF
FT                   FNLLLPPIILASGYELHQANFFRNIGTILTFAFAGTFISAIVLGLVLFVWTRIPLDGLN
FT                   ISFVEAIAVGATLSATDPVTILAIFNLYKVEPKLYTVIFGESILNDAIAIVLFETAQKY
FT                   ADSDAGSLTFLNLFEAIGLFLLVFFGSMMVGVIVGIMTALGLKYTHVRRQPKIESCLIV
FT                   LIAYASYFFSNGVYLSGIVSLLFCGITLKHYAYYNMSRRTQLTTKYLFQVMAQLSENFI
FT                   FIYLGLDLLVQRHLQFKPLFILVAVFGICIARYLAVFPLSKAINWFIRYRARRRGMDVA
FT                   DELPFAYQAMLFWAGLRGAVGVALAAGLKGVNAPALRATVLVVVVLTVIIFGGTTARML
FT                   EILGIRTGVVEEIESDDEFDIEVTNGGTYYKRSDTGLGYTPRRMDSTIPLDGVPRGDMD
FT                   RNNSYSSGNNRRPSPPPSGSGRTRGHARLYSNAYSQRDSGRDRTSTATLLGGGARNHSD
FT                   SEAASEDEFGLRTTGKGRVADADQLDAFDLDVEDAPSDDDLPPSAPAPTTSRLRRSPSQ
FT                   PQQYLESSQTTPPNNPSPNRRETGLSARDAIRDLFSGGPSGDHAAWFRQLDEDYIKPRL
FT                   LLDQSNHKGPGAV"
FT   CDS_pept        join(complement(373221..373408),complement(373085..373124),
FT                   complement(372698..373019),complement(371818..372639),
FT                   complement(371680..371754),complement(371288..371508))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172286" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891662"
FT                   /orf_name="An17g01560"
FT                   /product="Remark: OsSUT1 was expressed in source organs
FT                   such as leaf blade"
FT                   /protein_id="CAK43052.1"
FT                   /db_xref="HOGENOM:HBG325806"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000EFD150"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9I6"
FT                   /transl_table=1
FT                   /translation="MPETHERFADETSPLVGASDNNQVHSMSRNGDNNGTSGAGDAHHL
FT                   SETKSSWYLFLLTLSIGGLQVVWSTELSNGSPYLLSLGMSKALLAFVWIAGPITGTLVQ
FT                   PYIGICSDNCRISWGKRKPFMVVGGIATVISLLALAWVREMTGGFLGLFGVDPASSATR
FT                   TVVIVLATILMYCLDFSVNTVQAGIRCFIVDNAPSHQQEAANAWASRLTGVGNILGYIF
FT                   GYMDLPKWFPFLGNTQFKVLCALASIALGITLLVSCLYIKERDPRLDGTPSSGNPGLVT
FT                   FFKQVFKSIKHLPPEIAKVCEVQLAAWVGWFPFLFYSTTYIGQLFVNPIFDGHPGLSDD
FT                   DINKAWEEATRIGTFALLVYAIISFVTNLTLPVLVVPTYKSAVPSEPTPTEGQSEDEPF
FT                   LGNRRLSTSSIGTAMEAPAPILGINKGDSGEDKWLSKLQIPGFTLRRAWLMSHILFAVW
FT                   ISWALTLWAPFALISAEVSRIDTERIILGLHNVAISAPQIISSLISSAIFKAFQKPRGE
FT                   PWDDSVGWVMRFGGCAAVLAAVLTSRLTEGARGVPVSS"
FT   CDS_pept        join(complement(374204..374358),complement(373974..374112),
FT                   complement(373565..373888))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891663"
FT                   /orf_name="An17g01570"
FT                   /product="Similarity to EST an_3450 -Aspergillus niger "
FT                   /protein_id="CAK43053.1"
FT                   /db_xref="UniParc:UPI0000EFD151"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9I7"
FT                   /transl_table=1
FT                   /translation="MATFLSSWNILRLSRHTPEAGMQGGGSGFEASSTIDIPRDGWILV
FT                   SATGVQSQGIDVCHLSDDCVSPPDPIVTRPIRLPDRGISRAWPADVDPILQGIHGARLG
FT                   TPRVDLRAIPPIYSILLPERFTFPEHRLACPRPPLAESLRIQPRSSSLIGIISHYIALP
FT                   LASTSVRKKPQNGCIPYWTSLCTTAFPNPWIYLSTSNQFIYY"
FT   CDS_pept        join(complement(377343..377466),complement(377127..377226),
FT                   complement(375515..377062),complement(375316..375399),
FT                   complement(375006..375258))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172275" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891664"
FT                   /orf_name="An17g01580"
FT                   /function="nucleic acid binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43054.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG328932"
FT                   /db_xref="InterPro:IPR003120"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EFD152"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9I8"
FT                   /transl_table=1
FT                   /translation="MYSQHGAPMAPPQKPETFMLSTEAQQSLPHDAQVALQQVDNLKYF
FT                   LLSAPVDWHADQLIRRFLLPTGDYISCVLWSNLFHISGTDIVRCLAFRFQAFGRPVKNS
FT                   KKFEEGIFSDLRNLKAGTDATLEEPKSPFLDFLYKNNCIRTQKKQKVFYWYSVPHDRLF
FT                   LDALERDLKREKMGQEATTVAVSEPALSFEFDSSQSLYEQLTKAQQANSSSFAAHASTT
FT                   YGQPASPVVRTVDAMPPPQMAPQMAPQMAPPALPLLPDESGNPAMYNPVPMPTTLAQSV
FT                   IKREAEYGHIQYDRNGMPIARLHQRHASMPTFVEYSPAPSFVSSQYEDYSNRGLSFEPV
FT                   TPPQHSSHLGAEPAYIANEDTGLYTAIPDISSATHFNPMMQLPPSNLAHAHYPAPARTF
FT                   PSNVYSVIEGSPTYKQRRRRSSIPPSITSVGAGPHPQVTSAPNQAVAYAAHKPSDLRRS
FT                   VSSSVAPVAEVDESHHDQSFRAANGYRAAVLPQKNLLHEMSRNSTPLPSLEENPEQGTL
FT                   ALANQPDELAPLPSGEALDASVQNSATNKSDRYGPIRRARSATMMELGPYPQKSHSCPI
FT                   PSCGRLFKRLEHLKRHVRTHTQERPYPCPYCNKAFSRSDNLAQHRRIHEAQQDGQQPLS
FT                   GHEEDLENEENGFGSAEEGSSPSESVSGAMVNVPGMTTMPSAMTLPSAMPTMVAPHMIA
FT                   PQLLQQQL"
FT   CDS_pept        join(377562..377723,377835..377889,377955..378319)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891665"
FT                   /orf_name="An17g01590"
FT                   /product="Similarity to hypothetical protein PFC0680w -
FT                   Plasmodium falciparum"
FT                   /protein_id="CAK43055.1"
FT                   /db_xref="UniParc:UPI0000EFD153"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9I9"
FT                   /transl_table=1
FT                   /translation="MGAASGRCHRATGWAEQGVTHSHSTRLGKRTNNHSQGIKGSDLGG
FT                   LNAIKRQKQYLGADVVPTLVNKGQMKGRDNSHGEDGVEMKRKEVKKKKRKDEVRTEEEK
FT                   QRDASRDGKRGGEGEERKRTKWRDEVGTCFFTAVMRYRSSMGGQSVTGNNNANRYNNNL
FT                   TINNKIGKKNNNNFKRPASVEGRRLWVWEE"
FT   CDS_pept        join(379469..379580,379689..379772,379817..380025)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810385"
FT                   /orf_name="An17g01600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43056.1"
FT                   /db_xref="UniParc:UPI0000EFD154"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9J0"
FT                   /transl_table=1
FT                   /translation="MCGEGVANLSYLTQKKGMGKQNMQKWRWSGSLGTSMMGSLNASKL
FT                   YLLASRYYYQKLWKRGNQEKVYTTRYAHRRARAMYLLLLLFTDLGDDFLGASFFLGAIC
FT                   QVSSLSKHYTHTQTQPTIDTSTAYHSQRLW"
FT   CDS_pept        join(380148..380317,380476..380498,381029..381154,
FT                   381215..381318,381476..381602,381644..381735,
FT                   382089..382197,382230..382279,382331..382455,3
FT                   82520..382868)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891666"
FT                   /orf_name="An17g01610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43057.1"
FT                   /db_xref="UniParc:UPI0000EFD155"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9J1"
FT                   /transl_table=1
FT                   /translation="MLPAWSRHGYEITNQGASLGLPPWVEPRKDHYAKPAHPIKLARET
FT                   ILKHSPLVSEFCYSVTYLPWKSTEAVVQYDMNCPFGLHLAPFVWEDQGYRGGHSARQCL
FT                   HTSQNATATKGRMTGEICRSRLVGGLLKIVVVGKVNPYKLSRSTKSHSPDSSTRYRQRS
FT                   KLNRTQYEGPDYPSSILRHQGSCFMGYVPNSQNIRIVLAVRIHRCLMILSLDVSSESQS
FT                   EVCGEAMIAPFTSSTSARSGRLKIASIVAVPELSGGHWPDRQDLYRKKKKATRDSRRAL
FT                   CRLQRLRVLGNKKKGGAASWVCHAGQERVGGKRPLANHDKFSEDPVKNAGGWLLHLGEV
FT                   RETEQPEGAPIACIHTHLELSRAMSLVWTPLRSRLRKLSRYLAIVFGAVAKGSGRTAVK
FT                   WGLRWSRDGSIPIATVGGMARLRLV"
FT   CDS_pept        join(complement(385553..385623),complement(385392..385476),
FT                   complement(384923..385022),complement(384558..384619),
FT                   complement(384399..384509),complement(384173..384232),
FT                   complement(383974..384048),complement(383849..383880),
FT                   complement(383552..383749),complement(383183..383466),
FT                   complement(382909..383072))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891667"
FT                   /orf_name="An17g01620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43058.1"
FT                   /db_xref="UniParc:UPI0000EFD156"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9J2"
FT                   /transl_table=1
FT                   /translation="MLKLLICPLKPYSPKRLKTSLQSTFEDETPISETTYGLRMFEKVD
FT                   RHENTPESDMIEFASSAATRHTDLLLADKRPTFRQFLCLLYSARNPSEQRTLTLAPESL
FT                   GNGGWCLLKSLDDAMPADSVILPTTLGIYHSLSGSLPNPLDNALAGVIRPIDIFSLRRQ
FT                   WIRGHGIPAFSVGRHTAYRLIPKPEGAKVVLLGLGRKPTKTGLLTNERIGNPEEIGAPG
FT                   WEDQYGDGAFAAHSTKDLTVSCKQNPDGRDSKLPRTFSSQAGRKMDLALVRPLFDRPEL
FT                   PISYPRQVAVQAECGTGSYSRRYCPGGPGSDGCRNLEQCWTFLDGFRPDDQTQAHCTES
FT                   GPSLPLLEMRPFLFADDRIEAAVIYGPIWSPSRTPWNPGTIAYSGLVATPLGSGRIQPS
FT                   GESLSFQGVLSSTT"
FT   CDS_pept        join(complement(386617..386973),complement(386027..386557))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114594"
FT                   /orf_name="An17g01630"
FT                   /product="Similarity to hypothetical protein SPAC3F10.08c -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK43059.1"
FT                   /db_xref="HOGENOM:HBG328938"
FT                   /db_xref="UniParc:UPI0000EFD157"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9J3"
FT                   /transl_table=1
FT                   /translation="MVGKRKRDAAVVSRTTKVDKEEERTTSQTATTDASAADVFRKFFE
FT                   AQFQPLEVPGGQVTRNDESDEEESEDEDFEEGSESGSDWDGLSGEEDEAPVEVVEHRDI
FT                   KSQDLMDKKARKAFMTSKPPSYSEEPKPAKKKAKKEKSDDDEEDAMDADNLKNDLALQR
FT                   LLKESHLLESANELAPTGKNRIKALDLRMQELGAKASLYKQKMPTAHRRGIKEKADMKE
FT                   DRRRREAKENGIILEKPAPKSNPASTKRRERGVGGASIGKFAGGALNLSKRDVAAIQGP
FT                   RRTTKGKGRGRGRR"
FT   CDS_pept        join(387277..387576,387718..387904,388029..388312)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810386"
FT                   /orf_name="An17g01640"
FT                   /EC_number="5.3.1.16"
FT                   /function="1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]imidazole-4-
FT                   carboxamide isomerase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /protein_id="CAK43060.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0003949"
FT                   /db_xref="HOGENOM:HBG302148"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011858"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000EFD158"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9J4"
FT                   /transl_table=1
FT                   /translation="MTKFRPCIDLHSGQVKQIVGGTLSSVAADLKTNYVSKLPASHYAE
FT                   LYRKNDLRGGHVVMLGPGNDEAAKEALKTWPAGLQVAGGITDKNAKYWIDMGAEKVIIT
FT                   SFLFPEGKFSLERLQSVLAALDGDRSKLVLDLSCRKKDNTWFVAMNRWQTITEMEITQE
FT                   SIALLEPYCSEFLIHAADVEGLQQGVDEELVSKLSQWCTIPITYAGGARNLQDLEKVHV
FT                   SSQGKVDLTIGSALDIFGGSGVTFDECIEWNKAH"
FT   CDS_pept        join(388570..388949,389018..389075,389150..389476)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963561"
FT                   /orf_name="An17g01650"
FT                   /product="Similarity to En/Spm-like transposon protein PDF1
FT                   - Arabidopsis thaliana"
FT                   /protein_id="CAK43061.1"
FT                   /db_xref="UniParc:UPI0000EFD159"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9J5"
FT                   /transl_table=1
FT                   /translation="MTRTTSLDTQPPAPKQLSANTPEVSTGTCDPRHHPTTSTASSPLS
FT                   TAAWTGRLKVPSFLYPCQQPIHPITRPHVPLSHRKAYHRQPPEPRQPATPDSSSLSHPR
FT                   GCSNHITPFKMKPVVSALNAWSCVVISVFAIVILSVLGSLYKSEHPGFTGSEGEPEDGA
FT                   AVAASIFTAVLVYIVCLISRILTFLDWNGRDKKRNTEEEKRWIANRLINRIGFLRVLRF
FT                   PGLLAHEGPEGRRYIVELNDIQQHCFANSRLA"
FT   CDS_pept        join(complement(391794..392094),complement(390314..391740))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891668"
FT                   /orf_name="An17g01660"
FT                   /product="Catalytic activity: acetyl-CoA + histone  "
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /protein_id="CAK43062.1"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG317000"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR005910"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000EFD15A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9J6"
FT                   /transl_table=1
FT                   /translation="MATATMTMPPPPKAKKNAKLPPENERFMRACSDIANALIQEYEAQ
FT                   RDPKKPKRDINLNKLRGQVAKKHALATQPPLTAIIAAVPEHYKKYILPKLIAKPIRTSS
FT                   GIAVVAVMSKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP
FT                   FEQARGRVDQIKSLGHSVDKVEYIIMGGTFMSLPEDYRESFVAQLHNALSGYQTDNVDE
FT                   AVQAGEMSNVKCVGITIETRPDYCLDQHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGH
FT                   TVAAVAETFKLAKDAGFKVVSHMMPDLPNVGMERDLFQFQEYFENPAFRTDGLKIYPTL
FT                   VIRGTGLYELWRTGRYKNYTPNALIDLVARILALVPPWTRIYRVQRDIPMPLVTSGVEN
FT                   GNLRELALARMKDFGTTCRDVRTREVGINEVKNKIRPSQVELIRRDYTANGGWETFLAY
FT                   EDPKQDILIGLLRLRKCSPTHTFRPEFTGQQTSIVRELHVYGSAVPLHGRDPRKFQHRG
FT                   FGTLLMEEAERIAREEHGSTKISVISGVGVRSYYARLGYTLDGPYMSKMLDPIEDEEF"
FT   CDS_pept        join(392540..392709,392793..392821,392899..393025,
FT                   393086..393148,393209..393234,393309..393391,3
FT                   93471..393971)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963562"
FT                   /orf_name="An17g01670"
FT                   /product="Catalytic activity:"
FT                   /EC_number="6.2.1.4"
FT                   /EC_number="6.2.1.5"
FT                   /function="ATP citrate synthase activity"
FT                   /function="binding"
FT                   /function="succinate-CoA ligase (ADP-forming) activity "
FT                   /function="succinate-CoA ligase (GDP-forming) activity "
FT                   /protein_id="CAK43063.1"
FT                   /db_xref="GO:0003878"
FT                   /db_xref="GO:0004775"
FT                   /db_xref="GO:0004776"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG615372"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="UniParc:UPI0000EFD15B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9J7"
FT                   /transl_table=1
FT                   /translation="MQAVRRNTVAALRNAAATQRRAYSASASPAYAETVNNLRINGDTK
FT                   VIFQGFTGKQGTFHAEQAIAYGTKVVGGTNPKKAGSMHLDRPVFANVSEAVKETGATAT
FT                   ALFVPPPLAAKGIEEAIEAEIPLAVCITEGIPQHDMVRITDILKTQNKTRLVGPNCPGI
FT                   IAPGQCKIGIMPGFIHKRGRIGIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGT
FT                   NFIDCLKIFLEDEETDGIIMIGEIGGSAEEDAAEFLKANNKYNKPAVGFIAGISAPPGR
FT                   RMGHAGAIVSGGKGGADSKIAALEAAGVVVERSPASLGKALLNEFVKRDLV"
FT   CDS_pept        join(complement(394577..394772),complement(394439..394484),
FT                   complement(394299..394359))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891669"
FT                   /orf_name="An17g01680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43064.1"
FT                   /db_xref="UniParc:UPI0000EFD15C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9J8"
FT                   /transl_table=1
FT                   /translation="MEVIVCSRLLEAASIINPSDNSCFLFAGPGPVPSPSIPETWAICS
FT                   ATLAGRIPGMSDIPSPFGLVGNHPSATRLLLRRACTISATESAGCNNYCVDHDSY"
FT   CDS_pept        join(395973..396092,396188..396238,396702..396751,
FT                   396794..396849,397312..397391)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810387"
FT                   /orf_name="An17g01690"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK43065.1"
FT                   /db_xref="UniParc:UPI0000EFD15D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9J9"
FT                   /transl_table=1
FT                   /translation="MEVWKDDGWMGMSQISARQASTLQMIGRERERELVGKRRKLEDKN
FT                   DDDSVVLAQTLRAKSLVVSEPKDSDTTGREACMHTYFARAVQSDWFSVGSCLDPDGGPE
FT                   GTLHSNGGGIEYEE"
FT   CDS_pept        join(complement(399863..400032),complement(399496..399772),
FT                   complement(399331..399415),complement(399165..399287),
FT                   complement(398951..399072),complement(398811..398863),
FT                   complement(398420..398600))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891670"
FT                   /orf_name="An17g01700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43066.1"
FT                   /db_xref="UniParc:UPI0000EFD15E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K0"
FT                   /transl_table=1
FT                   /translation="MQDYSTAEQLGQTGGYPSSMTFPKRANVGGKSRCYRQGMNGDVGL
FT                   GVSLRPVLLGDQAELPRSAYMTWARRGDEIPEQACFPGHPGLRLAPAPQELTDLVNLAY
FT                   RFPANGVFEGPGTPVMRKGLDGSGARDKGAEQAIQWRRGGALGYMKLSCDQHGEARCNA
FT                   RRQGRSSIDDSGRQGSTHAHQYEQSEISLIGELLRCSGLLWISGIYIRPIRTKKGAGQP
FT                   RWAGSTVAADCGIGGGVKLYQDILRELPRESQTTTPQGRWIGRKGVAAQTGSQWKSRME
FT                   QDETLNWISTNFLLFLRGTPFYYLLLTVLTVDRNNCAEGLTSLVAVHQPPENQIR"
FT   CDS_pept        join(400210..400470,400528..400768,400818..400886,
FT                   400937..401383,401443..401999)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810388"
FT                   /orf_name="An17g01710"
FT                   /product="Remark: Yil120wp was implicated in yeast
FT                   resistance to ketoconazole and quinidine "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43067.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG738000"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EFD188"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K1"
FT                   /transl_table=1
FT                   /translation="MSSTTSSSRSDLEKVPVPQVIPRDSDSDKGSLSPEPSTLEAQSSE
FT                   KPPHHIFTRSRKLQMVCIVSLAAIFSPLSSNIYFPALDDVSKSLNISMSLATLTITVYM
FT                   IVQGLAPSFWGSMSDATGRRPVFIGTFIVYLVANIALAESKNYGELMAFRALQAAGSAA
FT                   TISIGAGVIGDITNSEERGSLVGIFGGVRMLGQGIGPVFGGIFTQYLGYRSIFWFLTIA
FT                   GGVSLLSILVLLPETLRPIAGNGTVKLNGIHKPFIYTITGQTGVVEGAQPEAKKTKTSW
FT                   KSVFAPLTFLVEKDVFITLFFGSIVYTVWSMVTSSTTDLFSEVYGLSSLDIGLTFLGNG
FT                   FGCMSGSYLVGYLMDYNHRLTEREYCEKHGYPAGTRVNLKSHPDFPIEVARMRNTWWVI
FT                   AIFIVTVALYGVSLRTHLAVPIILQYFIAFCSTGLFTINSALVIDLYPGASASATAVNN
FT                   LMRCLLGAGGVAIVQPILDALKPDYTFLLLAGITLVMTPLLYVEDRWGPGWRHARERRL
FT                   KAKANGN"
FT   CDS_pept        join(402970..402985,403119..403845,403903..404220,
FT                   404273..405869)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891671"
FT                   /orf_name="An17g01720"
FT                   /product="Remark: the A. chrysogenum RFX protein CPCR1
FT                   recognizes an imperfect palindrome "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAK43068.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG328944"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000EFD189"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K2"
FT                   /transl_table=1
FT                   /translation="MPPEMARAASQSSSAASQATQIVASHSRPGTADLMRSRSETVVSR
FT                   NSRRPRSRGSTASIHSNTTQQTQDQQLADGFSQFLPTQPTAGHNVFGGNPEDIIMRFGQ
FT                   QLSHPVNGASLDPTMQDAHHAVMPRAEEFPSHAMHGHHMSHHSIPSGLPSHGLAGVPMP
FT                   QYTAMYDSGIENHVPEHVLEDNDISEAGAKKKKGSSSSLANDNELRKLLRQYEGYSLKQ
FT                   MAAEVLKHEGAGGKAEKVKQVFAMIWLKENCRKSSGSVRRDRVYCCYAEKCGTERVSVL
FT                   NPASFGKLVRIIFPNVQTRRLGVRGESKYHYVDLTVIEEKQQKPPPLNPQLPSNTNSAA
FT                   NIAESKVDDMMQKSVSVAPQPPADTAVFPSPTTSFAPKFTASPSTSGCDCQSSSESHGG
FT                   SSIRLDNMASTSGKLIHQMLHLPSSDSPPMDNESLQLPDISDYLPANTDSKIAAALAAL
FT                   YRSHCISVIDSFRYCKERNMLRYFSAFHGTLTVPVQKLLTHPNLAPWIKECDWIMYQKM
FT                   IAFVAPLTTQVVPKLVLDAFSSISQKLTSHIADTFKSQPLHVSEARLIPAHIFCNLLKH
FT                   MLDVNQSANAAAAWLCHPDNRNQMWFDFKTLVDPQEMIVKANIPRCSERATALVLKHDV
FT                   RALLTPVADMNPSAALPFYTRPDTEEDIQAHKYPVESAAGDDYNFPDKWISFILNLPSV
FT                   FPHHSTQCIIDKVDALWDCILRRLTLGGAQSFSAWWMTKVFFHEMMLWQAEKGGFMRYT
FT                   PSTLHYATLSSNQQGPTNFLMKPSNCPVPDKNESQHASHSRTRSAASLTSAESLTQTQT
FT                   PMHRSQMEAESNQSTLETEKPSGVSESITGFQAPNNDDSAIDLDDDSMLMTVGKYGDMM
FT                   VSDPADAEGDVVVI"
FT   CDS_pept        join(complement(409355..409357),complement(407579..409239),
FT                   complement(407395..407514),complement(406634..406788),
FT                   complement(406405..406510),complement(405991..406129))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172218" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891672"
FT                   /orf_name="An17g01730"
FT                   /product="Similarity to hypothetical protein AAK58053.1 -
FT                   Ophiostoma novo-ulmi"
FT                   /protein_id="CAK43069.1"
FT                   /db_xref="UniParc:UPI0000EFD18A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K3"
FT                   /transl_table=1
FT                   /translation="MSGNYDYPPASRRPSRGARTNDRQLQQQQQQQQQQQPPVNRLQHL
FT                   RELLTSERNRGDFAFARAVETLNQEMDDYRSSRSWDRSSFEQARAALDQHMQQLQERTR
FT                   QSRANRGSSGPPMRPRPAVPRLQPLNVTAANPEESASDLSHSDSRTPRPRAGRGSDRPN
FT                   RLRRPRGSNSSSLLDTPVPHLDSPTVMPQQVEDEHQLDRARTKRRKLETDDNREGLQGF
FT                   RYGQYGQVVPGALRMELASCDGGTYDPHGESSLPENILRNDASVYCTKSDRCNLVLKHH
FT                   GESPFCLKKIVIKAPRLGYNSPYVSAGLETPSQTVTNNFKRIREGMVFVSMSCDEALAR
FT                   TAAFEVQWESTRPFARHLPSGMQPSQEYLNAYRPPLQSLGRGPVINHSSDSESDSTDEP
FT                   GAVEPSVSNVPDPTSEFRVTTEYGVQSDVRHDRDDHMDDDELLSLTDTDSIPMGRMDED
FT                   NIICSDSDMSLSDDDSNVSTFTRRQRELSRRIRAMRRRYVAERDSQTRRRPYLAMPSPG
FT                   LRPEGTRGSETPQLMKPHARFFIERNKSMVSIKFDPPPSGRYILVKLWSPHSGNNIDIQ
FT                   SIIAYGYAGTRFFPALSFRNGYLSLNTSIVKGHEQKTQEGGQDHSIQQSKIQAKSSSNE
FT                   AQTSIAPFSALRSHELRETRPKMLLTHGMDMHVSLPDVESHTKGKTGINPLLDLYDRQP
FT                   AQTALLQVNVSRIDAVISRLSCKDRRTPSFPLK"
FT   CDS_pept        join(409977..410016,410091..410148,410214..410385,
FT                   410438..411331)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172217" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810389"
FT                   /orf_name="An17g01740"
FT                   /function="binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAK43070.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG328946"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFD18B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K4"
FT                   /transl_table=1
FT                   /translation="MEPQPDPTQTISADEIALYDRQIRLWGVKAQEKLRSANILLITFK
FT                   SLANEVAKNLVLAGIGSLTIVDHEVVTEEDLGAQFFINEEHLGQNRAQAAAPSVRAMNP
FT                   RVQLHIDTEDIHLKQPDFFAQFDITIATELDFPTYTTINAACRIANRPFYAAGLHGFYG
FT                   FVFADLISHDFVIERTKSNVQSATQETPTRSILNITTKKENEKVIEMVTKREVYSPLIL
FT                   ANTSPLPEEFTRIARKRKQVTPLLTCLRALWEYQKSSAGALPTFSHQDLELFTKHARDC
FT                   HQELKLDITTLDAGFLRTFLQNLGSELSPVAAFVGGHLAQDVINVLSAREHPLQNMLLF
FT                   DGERSAAPIYPLHPFFPPEVESAIPPVVPVVQAIPLDGEPAPAPLMP"
FT   CDS_pept        join(complement(413546..413671),complement(413395..413472),
FT                   complement(412446..413288),complement(412053..412388))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963563"
FT                   /orf_name="An17g01750"
FT                   /product="Similarity to mitochondrial electron-transport
FT                   enzymes."
FT                   /protein_id="CAK43071.1"
FT                   /db_xref="HOGENOM:HBG395768"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniParc:UPI0000EFD18C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K5"
FT                   /transl_table=1
FT                   /translation="MAILSRLGPQGLLAVLLLASPTLAHGGHESVPEGAAISEDPIDTT
FT                   LWIHMILMGFAFGVIFPLGMVLGIIRSRWHVPLQIVGTIIAVLAYFLGHAHKGRQFSKN
FT                   VHASFANTLMLMMVVQIVLGVYLKLHLTKGIHGRIRRVIVIAHGVVGKAMPVASWVQML
FT                   FGGITAMGFCRDDHLGQCLAHFIMGSAFIAYGILLTILLLVGQYWLRRTGRSQEFFDSL
FT                   IIAAWGCVNTFTEHRWGGPWVHNDLQHTTMGVVWWCAGLLGIWMSRKRNGRPKRNLIPA
FT                   IVILLTGYAMSAHPQTLMISTMIHSIFGYTLMAAGFTRIIEISFVLRDKGSVSPDGSDP
FT                   NSFQYLTPFLLYASGFLFMGATEEQMQLLNDAGITHVSYVLILYSIAFILFLCKTTSLP
FT                   PKNQRTTLTPPPTQSSTCSCTSTPSMHGPNPHKRLPIRALPALQMPARAHPAIDRPPTA
FT                   AS"
FT   mat_peptide     join(complement(413546..413593),complement(413395..413472),
FT                   complement(412446..413288),complement(412056..412388))
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K5 "
FT   sig_peptide     complement(413594..413671)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K5 "
FT   CDS_pept        join(414278..414355,414407..414492,414579..414738)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891673"
FT                   /orf_name="An17g01760"
FT                   /product="Similarity to hypothetical protein SPBC409.03 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK43072.1"
FT                   /db_xref="HOGENOM:HBG328947"
FT                   /db_xref="InterPro:IPR010760"
FT                   /db_xref="UniParc:UPI0000EFD18D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K6"
FT                   /transl_table=1
FT                   /translation="MPPPQQATSSTTTPACDEQTQKEKKLSTLRASIASLQSQITEIES
FT                   QIAQTKAKLKNDPSTTVKRHIRLLHEYNEIKDIAQGLMGLIADARGVRQVDVQREYEVD
FT                   DGD"
FT   CDS_pept        join(complement(419047..>419181),
FT                   complement(415673..418983),complement(415259..415616))
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15891674"
FT                   /orf_name="An17g01770"
FT                   /product="Remark: N-terminal truncated ORF due to end of
FT                   contig."
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43073.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0000EFD18E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K7"
FT                   /transl_table=1
FT                   /translation="MQLDADDVNVSFFGLFRYASRMDLAIMFVSAICAIVAGAALPLFT
FT                   ILFGSLASAFRGIALYEISYHDFYHQLTKNVLYFVYLGIAEFVTVYISTVGFIYTGEHV
FT                   TQKIREHYLESILRQNMGYFDKLGAGEVTTRITADTNLIQDGVSEKVGLTLTAIATFVT
FT                   AFIVAYIKYWKLALICTSTIVALVLLMGGGSRFIVKNSKQALQSAGAGGTVAEEVISSI
FT                   RNATAFGTQDKLAKQYETHLAEAEKWGIKTQVTLGFMIGGMFGIMFSNYGLGFWMGSRF
FT                   LTDGEVNVGQVLTVLMAILIGSFSLGNVSPNAQAFTNAVAAAVKIFGTIDRPSPLDPYS
FT                   EEGEKLEHFEGNIEFRDIKHIYPSRPEVTVMDGVSLSMPAGKTTALVGPSGSGKSTVVG
FT                   LVERFYFPVGGSVLLDGHDISTLNLRWLRQQISLVSQEPVLFGTTIYHNIRYGLIGTKF
FT                   EQESEDKIRELIENAARMANAHDFITALPEGYETNVGQRGFLLSGGQKQRIAIARAIVS
FT                   DPKILLLDEATSALDTKSEGVVQAALDRAAEGRTTIVIAHRLSTIKTAHNIVVMVNGKI
FT                   VEQGNHNELVGRKGTYHSLVEAQRINEEKDAEALAADEDVDEEDFSKHEIARIKSASSG
FT                   SGSIDDEDEKSLAGNGLNRSGTHKSISSAILSKREPEVARKYSLWTLVKFIASFNRPEL
FT                   KYMLIGLVFAVLSGGGQPTQAVLYAKAISTLSLPTSEAAKIRHDGAFWALMFFVVGIAQ
FT                   FINLSINGAAFAVCSERLIRRARSMAFRSILRQDITFFDREENSTGALTSFLSTETKHL
FT                   SGVSGATLGTILMTSTTLGAAMIISLSIGWKLALVCISVVPILLGCGFYRFYMLARFQQ
FT                   RSKTAYEGSASYACEATSAIRTVASLTREQDVWAMYHSQLEDQGRKSLISVLKSSILYA
FT                   CSQALVFFCVALGFWYGGTLLGHHEYSVFRFFVCFSEILFGAQSAGTVFSFSPDMGKAK
FT                   NAAAEFRRLFDRKPEIDTWSEEGEQLESVEGEIEFRNVHFRYPTRAEQPVLRGLNLTVK
FT                   PGQYIALVGPSGCGKSTTIALLERFYDAIAGKVLIDGKDITQINVNSYRSFLSLVSQEP
FT                   TLYQGTIKENILLGVRGEDVTEEQLVKACKDANIYDFIMSLPEGFNTVVGSKGGMLSGG
FT                   QKQRVAIARALIRDPRVLLLDEATSALDSESEKVVQAALDAAAKGRTTIAVAHRLSTIQ
FT                   KADIIYVFDQGKIVESGTHQELIRVKGRYYELVNLQSLDGGN"
FT   gap             419192..419291
FT                   /estimated_length="unknown"
FT   CDS_pept        421938..423263
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810390"
FT                   /orf_name="An17g01795"
FT                   /product="Similarity to protein of retrotransposon Ty1 Tyb
FT                   - Saccharomyces cerevisiae"
FT                   /protein_id="CAK49135.1"
FT                   /db_xref="HOGENOM:HBG328948"
FT                   /db_xref="UniParc:UPI0000EFD18F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K8"
FT                   /transl_table=1
FT                   /translation="MPRASPARILGGTTLLSTFITTILDGMCFTFSRSLSSRVSSVESA
FT                   IVSLSAVSCVALVSMMLLWIKDIKSEPTEQSRNHRAITYGLIAAYLSVATGVTAGGIAW
FT                   SAAQSVSAKKSTVTRHQSLLVARCTIWAISVLSQGILGGYLLTTLTRREPTRNWSPPSV
FT                   SQELEVLSDKASVKDASTVQSSSLASESQRPSADLKTSPDTVPPIQPSVSNTESQASNR
FT                   YSGRTLFQHDSKQSSFDLQRSYVPPGDTTVTPATVEEHPGDQTGSAAVGAKLRPEPPKI
FT                   RRSYSDTKRSLDGLVRQPSSARSSPATSSTQLVTPARPAPPKLKLPDESFIHPLFRSDS
FT                   SSPPPTPMPGTTVIASPAAGQTISVQALNRVRSTRSLRSQAPRSRSPLFDQPLNGMERN
FT                   TESPEPSGRGSPMPSFIMAADVRSSISRYEKKYDLNESPDES"
FT   sig_peptide     421938..422069
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K8 "
FT   mat_peptide     422070..423260
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K8 "
FT   CDS_pept        join(426772..428445,428509..428613,428670..429422)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172141" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963564"
FT                   /orf_name="An17g01805"
FT                   /product="Similarity to protease type 2 Iga1 -Haemophilus
FT                   influenzae"
FT                   /function="peptidase activity"
FT                   /protein_id="CAK49136.1"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="UniParc:UPI0000EFD190"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K9"
FT                   /transl_table=1
FT                   /translation="MLVQGLPRALLVSFYPLPATAANSYGPLDSTHDDLSSVRVTRSLR
FT                   SSRDARASQHDVRAPSNTAATAGNHTNHLKNNTNRPSRIITLSTRAARANTAAENAARE
FT                   AALRETAARENLARENTARETRNTRTRASAQLATAQPETPVMAVPETPRHKRVKRGPTV
FT                   EETPRTTRQSARLRAHVHPTSTEDGSNDQGIVPKFPEPSPSTNAAPSSRTRNRSRQFAD
FT                   NIIDTTHNATAVAAVVKSPSPDRATPVPAEQPKPLQDEPQSIEPDFHPPTKEESPKGTV
FT                   VDEDKNGVTETAAHEIAGPQNSTPTPSPDASEKPKSSSQPEDPGAAENESVSESPSKKP
FT                   KVEEGELDHALHQQLQNGTGGNPESRSPAEAMAESRVDEESRQVTEEIEGSTPEVATES
FT                   TAGKATRGRTRGRGRGGRSRGSARFAVNKRGRGAARSGRGGRTGRQLDRSSDVEPDRSP
FT                   SPSAATQKLRDRQRELDKAFKKVAAAQRLALAVLATQSEKRLARDKNAHKNVPEFEEVN
FT                   LQLKERLNGRKEVLRREYELKVAQEHRLFEANKQAIEERYRAQARNIREEHLLASQGAY
FT                   MTFVEGRRAAEDDEHTETDDSETEPERGRVVPPAREVFRGFNSNYVRNPSGAALYDRAY
FT                   FGWDDFVQRAKVGDDIDPQMKEIRDAGPFAGMTAEQILDMLVKATGVVEVPRNTMPAEI
FT                   SPPVVLPDLRPRALSALADIAAAEPPRPPLSQAAPRLSTHRALLPQPAQPPLAHGPAET
FT                   RPFVLPPPTPQRQQPRRLLPAGQQIPPINEQLGLPDPFASMGGPPHLPPPPGSNFHRPP
FT                   LPGFMTGHHPPSLYYPPPPPPPPPPGPRPPF"
FT   sig_peptide     426772..426837
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K9 "
FT   mat_peptide     join(426838..428445,428509..428613,428670..429419)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9K9 "
FT   CDS_pept        join(430283..430317,430418..430489,430549..430634,
FT                   430705..430894,430956..431316)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963565"
FT                   /orf_name="An17g01815"
FT                   /function="ribosome binding"
FT                   /biological_process="mature ribosome assembly"
FT                   /protein_id="CAK49137.1"
FT                   /db_xref="GO:0042256"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="HOGENOM:HBG589638"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniParc:UPI0000EFD191"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L0"
FT                   /transl_table=1
FT                   /translation="MAVRAQFENSNEVGVFSRLTNSYAIVAIGASENFYSVFEAELQDV
FT                   IPICHATIAGTRIVGRLTAGNRNGLLVPTTTTDQELQHLRNTLPESVKIQRIEERLSAL
FT                   GNVICCNDHVALIHPDLERETEEIIADVLGVEVFRQTVADNVLTGSYMALSNQGGIVHP
FT                   KTSIRDQDELSSLLQVPLVAGSVNRGSPVVGAGMVVNDWLAVTGLDTTATELSVIESVF
FT                   RLGEMGPRGVGMGDANKESIVESFY"
FT   CDS_pept        433000..433503
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891675"
FT                   /orf_name="An17g01823"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK49138.1"
FT                   /db_xref="UniParc:UPI0000EFD192"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L1"
FT                   /transl_table=1
FT                   /translation="MFPSSPLWPCSLPGLMGGGGGGGGVEDRCRLEEDGVVYSVMLPSP
FT                   MLGSSSLLRFRWPCKSSVMVVGVSPSCAVTRSSSSSDIFMSGPSSSTTSAAASFGFESG
FT                   SFDCRSAFRCSYARCLATALSKNSLQNFFTFFCCLSSILVGSPTRLFLKSELTNFLATC
FT                   VDSN"
FT   sig_peptide     433000..433065
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L1 "
FT   mat_peptide     433066..433500
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L1 "
FT   CDS_pept        join(complement(435612..436134),complement(433635..435316))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891676"
FT                   /orf_name="An17g01825"
FT                   /product="Similarity to huntingtin interacting protein 1
FT                   HIF-1 - Homo sapiens"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK49139.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="HOGENOM:HBG328952"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="UniParc:UPI0000EFD1BF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L2"
FT                   /transl_table=1
FT                   /translation="MSPHDYADRQSESVADAVTAMKLESDAAPENSAMPNGGGAMIKDE
FT                   SSNAASNASPVPTPKAERSRSSSRAPVKKEENYEDDGSNLKGAENNHGGNVEEKVGGDI
FT                   IVKLEPGQPPKLTRSSSQKVVPRPPQLFAHLPDSTAEAQATFDLMDACTYANKYMGYTE
FT                   HAMECDCAEEWEPSVSKNLACGEDSDCINRATKIECMGDCGCGPECQNQRFQRREYAPV
FT                   AVIKTEKKGFGLRAEADLRPHQFIFEYVGEVINEGQFRRRMRQYDEEGIKHFYFMSLSK
FT                   GEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAERHIQAGEELVFNYNVDR
FT                   YGADPQPCYCGEPNCTGFIGGRTQTERATKLSNATIEALGIDDADGWDTAVAKRPRKKK
FT                   TGEDDEEYVDSVQPKSLEENGVTKVMAALMQCKEKWIAVKLLGRIQRCDDERVRNRVVK
FT                   MHGYQILNSQLGMWKEDHNVVLQILDILDKFPRLTRNKIIDSKIESTIQPLTSCGDERV
FT                   EKKSATLLQVWSTLEVGYRIPRMKRDPNAMTPAVNQFGRRENTRDERRRSKSRSRSRSR
FT                   SIEAPRGPAAQTRGGHGQRNPHHHGPRPFRRQFNPLPPGWFAAESNGRTYYYSARGDTT
FT                   WTRPTKPAPQPPPAPKESRDKALQDIIDGIMNAKENTPKEKSGTPATPQASRPTPDMKD
FT                   GQEKWRSYSEEKRKKIYENTVSNTAFEGKDNKRCASTDGE"
FT   CDS_pept        join(complement(440351..440539),complement(439915..440175),
FT                   complement(439785..439866),complement(439516..439546),
FT                   complement(439230..439251),complement(439123..439138),
FT                   complement(439031..439065))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891677"
FT                   /orf_name="An17g01835"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK49140.1"
FT                   /db_xref="UniParc:UPI0000EFD1C0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L3"
FT                   /transl_table=1
FT                   /translation="MKQTDQPTKSLPPQGRLGSYHRACELASRLVLHSTSSGHRGDDLG
FT                   NVAADFHLTDRLSGDGQQVVTEADGFPTGFLRPSPTSPNHGRSQPGWKATVSIDQQYRN
FT                   GDERGFRGQIDQENEAHRGKRGRSKQREFRDEEDFPLGNGRGACGALPLKTTTKKGRTF
FT                   RQPGTLTLLAAVWLAYDLFVLFYVRIPPLCACLEFTRENICVEELACA"
FT   CDS_pept        join(complement(441269..441319),complement(441027..441194))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657724"
FT                   /orf_name="An17g01845"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK49141.1"
FT                   /db_xref="UniParc:UPI0000EFD1C1"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L4"
FT                   /transl_table=1
FT                   /translation="MKALLSLENEVRGWGPELQENAEACIGPIHDSGNASGDDWQKMIA
FT                   AEVVDNRRVGLLGSAIGADESKILEAG"
FT   CDS_pept        join(443215..443317,443593..444467)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216941" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810391"
FT                   /orf_name="An17g01855"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /protein_id="CAK49142.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI0000EFD1C2"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L5"
FT                   /transl_table=1
FT                   /translation="MSNQPERPWTEEEKVGLPILAPLPSQSPVLSADGGRSLNSCQIAF
FT                   CNMLQHVQISVTHSLGSIPPQPHEPSVPATVPLESSSVLRKRPLIPSDRTIRAPRAIQP
FT                   RPATSTASYSSESGASALLSPSSESVTARGEPPRKRGRPSKAESERRKAAAEARGETYP
FT                   PPRRSGSHKLKVSSTPTSPSGVAPGLPSFSPQASSSRPQDLPRHEMHYVPPPGRPIPLM
FT                   GPSSDERPRDMPNQDMSSSMRELPRPEIRQTLPSPGTLQLGHRETPLIRREPGVSFEPL
FT                   PPDRHPFSQSNRRSLIHPTSRYPDEPPTPASDLPIARPPDHRPE"
FT   CDS_pept        join(complement(448571..448656),complement(448369..448438),
FT                   complement(448090..448239),complement(447230..448021),
FT                   complement(447034..447171),complement(446323..446964))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963566"
FT                   /orf_name="An17g01865"
FT                   /product="Catalytic activity: ATP + protein [ "
FT                   /EC_number="2.7.11.17"
FT                   /function="ATP binding"
FT                   /function="calmodulin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK49143.1"
FT                   /db_xref="GO:0004683"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG328956"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI0000EFD1C3"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L6"
FT                   /transl_table=1
FT                   /translation="MASGDAELPQQDASPITTERPPLPPFRCVSTPSYESPQRHHRRNP
FT                   IVRRPVKETLNARSEYYTSQDDGTAEHRINQYVIKQEIGRGSFGAVHLATDQFGNEYAV
FT                   KEFSKARLRKRAQSHLLRRPRGPKRPSDGFNSPLHRRAPGGDEHKENALYLIKEEIAIM
FT                   KKLNHNNLVSLIEVLDDPTEDSLYMVMEMCKKGVIMKVGLEERADPYDDDQCRCWFRDL
FT                   ILGIEYLHAQGIVHRDIKPDNCLLTSDDVLKVVDFGVSEMFEKDSNMFTAKSAGSPAFL
FT                   PPELCVVRHGDVSGKATDIWSMGVTLYCLRYGRLPFEKQSIFELYEAIKNDPVVCEGET
FT                   DENFKDLMFRILEKDPAKRIPMEELREHPWVTKNGLDPLLSESENTAEIVGLPTEEEMN
FT                   SAITRNIGHVMAVIKAVTHFKRLIDPAKADPPMQSILGQEYETHFVEPPMEMEPEESFT
FT                   ATGNMPILNKSQSLNMYNRRPWERDNVLQGFHQRREDLIPNQPTDGSESLSHHGKTGPA
FT                   SGSNSRNASRMEPERKDSGSIRSHNIAGGSIDDFQPNSTPQSPSPFVPLSRASSVTTKR
FT                   SVEGTRGHARDPLEEEFPFLYIGPQHTPARPTNPTLIPTPIPYSKNPTP"
FT   CDS_pept        join(449556..449592,449667..449877,449953..450098,
FT                   450165..450277)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657725"
FT                   /orf_name="An17g01875"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="cis-Golgi network"
FT                   /protein_id="CAK49144.1"
FT                   /db_xref="GO:0005801"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="HOGENOM:HBG396637"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI0000EFD1C4"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L7"
FT                   /transl_table=1
FT                   /translation="MVVYSFYIFDRHAECIYNRRWLPRPTSMTGSKSSRPTSETSAPGL
FT                   PATLGQTARATDDDAKLIFGTVFSLRNMVRKLGGEDDNFVTYRTSQYKLHYYETPTNIK
FT                   FVMLTDLKSPSMRVALQQIYINLYVEYVVKNPLSPAEHPGGIGVNNELFEESLEQFVVC
FT                   AINVS"
FT   CDS_pept        join(complement(451106..451307),complement(450861..451017),
FT                   complement(450578..450704))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891678"
FT                   /orf_name="An17g01885"
FT                   /protein_id="CAK49145.1"
FT                   /db_xref="HOGENOM:HBG328957"
FT                   /db_xref="UniParc:UPI0000EFD1C5"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L8"
FT                   /transl_table=1
FT                   /translation="MSNRYEREAEDLYEEENDPSPVSGTFHDNSYAHETQSSLRNQVPV
FT                   ARDQAPYEDPVQPPYSNTDQQLAQDEDEAIDQSNVISGRTRGAKPQTRNQYSEGPDEDD
FT                   LPDEVLYGNVGTSSTRREVINSFHPQDHEIVPVPGLVAVCAGRGPVSGFDSGLRAMR"
FT   CDS_pept        join(452171..452448,452533..452917)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963567"
FT                   /orf_name="An17g01895"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK49146.1"
FT                   /db_xref="UniParc:UPI0000EFD1C6"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L9"
FT                   /transl_table=1
FT                   /translation="MWCCCSLPFLLPSDQRPLTICVLPNQSHRTRYVHTHIYHQDLIHD
FT                   PIFNKLLFGMVHLTVSSFRARITGGEKQAVFNGSDEAVRQNTSCACAKGTWAVSGLHST
FT                   GSLAVDFLSFLEPSLYSVFDRWACCFRHGFAGQLNRRASHYVESVGSRKTRTHMKTMSE
FT                   MLKLLWFGSAQFNSVQFLRMIRIYVSDYNQLILKTQDVPCCRTDASCPSTSYLVVDK"
FT   sig_peptide     452171..452215
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L9 "
FT   mat_peptide     join(452216..452448,452533..452914)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9L9 "
FT   CDS_pept        join(complement(455558..455689),complement(455407..455506),
FT                   complement(454782..455173))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891679"
FT                   /orf_name="An17g01905"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK49147.1"
FT                   /db_xref="UniParc:UPI0000EFD1C7"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M0"
FT                   /transl_table=1
FT                   /translation="MHHTEWVGSEDFSCLVYITSPWTLNLAEPWWKAKYWILITDSFTL
FT                   VPYFPTETWVKYSIKDVPASGGCDGVPIQLGAPLQSNLDGMMDYQQTTEVRPHLPYVRR
FT                   CSSDYDLDRIADKTVDDLVGSTLTSATYIWAGATKKQKQVNEQIGIVSLASLLARKGYN
FT                   HHSFIQSVSQSISLLIKGRKSKNRKGESMIEHYYCVLELLSEES"
FT   CDS_pept        join(456990..457210,457449..457539)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963568"
FT                   /orf_name="An17g01915"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK49148.1"
FT                   /db_xref="UniParc:UPI0000EFD1C8"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M1"
FT                   /transl_table=1
FT                   /translation="MWFDKFRHPFALEVWTLLTLAPHEQIGYLTPKWGDVHQGKLPPSQ
FT                   TKKKAPVVKRIGEKRRDISSSDRRLRTPNSIGATERASSPPTRLSNSSGCISRLVSGT"
FT   sig_peptide     456990..457070
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M1 "
FT   mat_peptide     join(457071..457210,457449..457536)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M1 "
FT   CDS_pept        join(460441..461877,461937..462068)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963569"
FT                   /orf_name="An17g01925"
FT                   /product="Remark: alternate names for the S. cerevisiae
FT                   Hal4 kinase: Sat4 or YOR008W."
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK49149.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG328961"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0000EFD1C9"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M2"
FT                   /transl_table=1
FT                   /translation="MTPQSASPVPSAVSSTAASQISYDSRDGEPQVTRALAGMNLSAAN
FT                   GDVLPVPPTPAKIARPTMANRISRMFSNTGKSTPKEQESHRDFSDSSTESIKAPSNASI
FT                   KQSKPTSKPSKPNSKPSSRAPSRQASTKEEAEKKPKSSNGKDNKEAAPVHKRFELPGDG
FT                   THNHHLRSARRQEKLTDLLRDMLGGGRKKDDHVDEQQLSLMSTWIDQFKNERDKLATDK
FT                   KGGPNATASLVDKYGKCQEIVGRGAFGIVRISHKVDPRDSKVEQLYAVKEFRRRPQETT
FT                   KKYQKRLTSEFCISSSLRHPNVIHTLDLLQDAKGDYCEVMEYCAGGDLYTLVLAAGKLE
FT                   VAEADCFFKQLMRGVEYMHEMGVAHRDLKPENLLLTTHGALKITDFGNGECFRMAWEKE
FT                   AHMTAGLCGSAPYIAPEEYVEKEFDPRAVDVWATGVIYMAMRTGRHLWRVARKDEDEFY
FT                   QRYLEGRKHEDGYAPIETLHRARCRNVIYSILDPNPSRRINASQVLKSEWVREIKLCKA
FT                   GEEGY"
FT   CDS_pept        join(463074..463371,463771..464016,464203..464351)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891680"
FT                   /orf_name="An17g01935"
FT                   /product="Similarity to HIC-1 polypeptide from patent
FT                   WO9614877-A1 - Homo sapiens"
FT                   /protein_id="CAK49150.1"
FT                   /db_xref="UniParc:UPI0000EFD1CA"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M3"
FT                   /transl_table=1
FT                   /translation="MAVVSSRSSMTDWSTVGSVCLGSEIWGFPPSTVFSPPFPVGRPIP
FT                   DDDDDYDSYGHLNICWLPLFYLLLDTMPTPTSEGKKKATFSDHIIMQAATGPVQDASGA
FT                   SGRPAVQSIGVIPTKHAPYGAANGGDAGREPDQACLAHYAAPKGTRARSSIGTDPRRKA
FT                   SLLKPWTGGARTAQQRSAACMIHPPLFEPLPDPVVECRPRQSGQPYAVGLALKDHAVQL
FT                   GQAAPFFT"
FT   sig_peptide     463074..463154
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M3 "
FT   mat_peptide     join(463155..463371,463771..464016,464203..464348)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M3 "
FT   CDS_pept        join(465835..465847,465952..466002,466120..466165,
FT                   466235..466308,466387..466534,466605..467058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891681"
FT                   /orf_name="An17g01945"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK49151.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG328963"
FT                   /db_xref="InterPro:IPR003005"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR010504"
FT                   /db_xref="UniParc:UPI0000EFD1CB"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M4"
FT                   /transl_table=1
FT                   /translation="MSWAGFKKNVNRATTQVMMKTGHVERTSDRDYEIEERRYRTMEAA
FT                   ANRLQKEAKGYLDSLRAMTASQMRIAETIDAFYGDAGTNDGVSRSYKQAVEDLDAETIK
FT                   ALDGPYRSTVLEPISRFCAYFPDINECIKKRNHKLLDYDSMRAKVKKLVEKPDKDATKL
FT                   PRMERETEIAKQAYEQLNEQLFTELPQLIDLRVPYLDPSFEALVKIQLRFCAEAYSRMA
FT                   QVQQYLDAETRDQYARGDLDNRVEEVLQEIRDLSIAGTV"
FT   CDS_pept        join(complement(467384..468401),complement(467264..467307))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891682"
FT                   /orf_name="An17g01955"
FT                   /function="aminoacyl-tRNA hydrolase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAK49152.1"
FT                   /db_xref="GO:0004045"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG328964"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="UniParc:UPI0000EFD1CC"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M5"
FT                   /transl_table=1
FT                   /translation="MNTNSSPSSGNNKAKQSKSKFPSMHEPAAAAVAAVVLHSTQTTEQ
FT                   EQEHHQLPSAKSTTTTTTTITLNHHPDNSSSTSTSTSSMSPPPPLKTPRRFLFIASIGN
FT                   PRPYRTTRHSAGHILLEALTPLLPRRLPLVGASPNNGNIVNPLFYKTYTSPTYMNESGP
FT                   KLLRNFQSWLSSTQTEIYQKIVQPGNVLSTNTTPHDAASDAVAEWHLRGTDPTTLRNFS
FT                   PTLVILHDELEAPLGKVRVKRGGPEKASLRGHRGLISSFESLRGKGLYPPNPKKNVVGA
FT                   GVDLSVLRIGVGIGRPETRDRGGVAKYVLEEMSDRELKAVKAAAGPVLEVLMDELYRDD
FT                   RLDRGGLEIPLYY"
FT   CDS_pept        join(469636..469787,469860..470748)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657726"
FT                   /orf_name="An17g01965"
FT                   /protein_id="CAK49153.1"
FT                   /db_xref="UniParc:UPI0000EFD1CD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M6"
FT                   /transl_table=1
FT                   /translation="MEAKDLQPLGQNEPIVEPDESENAQKQPWTKPPPDPEPNSQSHSD
FT                   SDQASINSYETHQLDIYEENNRRYPNDSYHMPNDEAERTRLNIVHQIYLILLDGHLTAA
FT                   PIVTNAPRILDIGTGPGDWAIEMSHAYPHGTIIASDIGVFDNALGHVDLPNLSFYLDDA
FT                   RDEWAYNIPFDLIHLRGLSGAFPDWSFIYQQAFEHLAPGGYLEVADTDFAAETMTTIPQ
FT                   NSYLRLFASALRSADYSAGYLRDLSHLQPALFRAQGFIDIDVREYTFPIGLWPESPHDR
FT                   TVGKMGLIALLEGLESYSLRALTTTYGWLAEEVRELCDQVRAEILEGVYRISARVKIVT
FT                   GRKPLT"
FT   CDS_pept        complement(471154..472485)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810392"
FT                   /orf_name="An17g01975"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAK49154.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG601536"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI0000EFD1CE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M7"
FT                   /transl_table=1
FT                   /translation="MVSKKASHRPPPGAGLDAKPRNKIQRQLLHIKRKRAKDSSRRAER
FT                   YAFKKEEAKNPKLKEERLKRNIPLTIDRKRVWDDAGSDVEDGLGLSVDVERIKRRKQEE
FT                   EEELNRPLNEDEQSSDAEEGSEDDDDDDVDSMLASSDEEDEDASDDEDADSDSGKKKSS
FT                   SETRGRSKSSLPTATERATSPSQSTKSTNLSLVPDALAAKFPSLFSTENPKSPKILITT
FT                   SLNSSLHYEAELLTDLFPNSVYVRRTRHRFAHQFSIREISKFATNRNFTAVVILREDQK
FT                   KPAGLDIVHLPTGPMFHFSMTNWVEGKRIPGHGRATEHWPELILNNFRTPLGLLTAHLF
FT                   RTLFPPQPDIEGRQVVTVLNSRDYLFFRRHRYVFREKRETEKAVVGSDGKEMKGAEGIR
FT                   AGMQELGPRFTLKLRRVDKGIQRASGQEWEWKGQMEKTRTKFQL"
FT   CDS_pept        472854..474734
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000242015" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963570"
FT                   /orf_name="An17g01977"
FT                   /product="Function: A mutation in Grs1 from S. cerevisiae
FT                   affects 3'-end formation."
FT                   /EC_number="6.1.1.14"
FT                   /function="ATP binding"
FT                   /function="glycine-tRNA ligase activity"
FT                   /biological_process="glycyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK49155.1"
FT                   /db_xref="GO:0004820"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006426"
FT                   /db_xref="HOGENOM:HBG319978"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI0000EFD1CF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M8"
FT                   /transl_table=1
FT                   /translation="MSHCSSAQRLGGLRCRRALGPSFRSFCPRHPNRLLHRQLLAFRPP
FT                   PTCASSSSFLPPRSFSTSLPRTRHHLPQPSSKKKSSKMASLSTKTGQVVDRSVLDSMLR
FT                   RRLFYTPSFEIYGGVSGLYDYGPPGCAVLNNIVDLWRKHFVLEEDMLEVDCTMLTPHEI
FT                   LKTSGHVDKFADWMCKDPKTGEIFRADHLVEEVLEARLKGDKEARGQKVEVDEEKEAKK
FT                   KKKVKQTKAVKLDDAVVKEYEETLAQIDNFDGPELEKIIAKYDIRNPTTDGNLLPPVAF
FT                   NLMFQTSIGPSSNMPGYLRPETAQGQFLNFQKLLEFNQQSMPFASASIGKSFRNEISPR
FT                   AGLLRVREFLMAEIEHFVDPQGGKKHARFEEVKDVKMTLLNRDIQLSGSTKTEEMTIGK
FT                   AVETGLVDNETLGYFLARIQLFLLKLGVDPKKLRFRQHMANEMAHYATDCWDAELHTSY
FT                   GWIECVGCADRSAYDLTVHKNKTGAPLVVRETRAEPLKVEEWQIDLDKKKFGPRFKKDG
FT                   KTVTAAIDALSQELREKLSLDLEQTGKIEVEVEGVAGGKVELDKELIKIEKRTRVENVR
FT                   EYTPNVIEPSFGIGRILYSMIEQVYWSREGDEARGVSLLPFPILVFFYNG"
FT   gap             476541..476640
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(480382..480398),complement(478229..480242),
FT                   complement(478067..478166),complement(477604..478016))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891683"
FT                   /orf_name="An17g02010"
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAK43074.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000EFD1D0"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9M9"
FT                   /transl_table=1
FT                   /translation="MASYEKMYSPDQFMNPGPAPRPPADRPQLNLPTNPSNNVATSFSQ
FT                   MSLNSPSTPGPANLSLFPNTSTPSLTRTKTDQSGGGGVTVIKEGYVRCKEDKFLATWNQ
FT                   RYLILREFRLDFLKNETGKIVLSIPLTAVTGVSRSEDTRMAFEIIRLANPKDVNSKTAV
FT                   ITRDVPTKSITCEVKSDDEIYDWIDKIYERCPGMGGVSNPTNFSHRVHVGFDPRTGAFV
FT                   GLPPEWEKLLTASAITKEDYKKNPQAVIEVLEFYSDIKMREQNPQYYAGLSSPANQQAK
FT                   PFSGGGSVGNSIAPPRPPPPAPAQRLDSGGQSYSSQSPVSSPSQSKSDSDRALEQQQQL
FT                   ERMNELADKERRRMEEDRRARQREEEQNRLDQEAYNASLPKTRVPLAKQELGGYGQSPD
FT                   DRYKPSRPAPQAPGSSRQDPPRQLTAQRPAPSAPTAGQRPGDYANGSARAEQSSPSSRH
FT                   PAQGQSPARAQNNGVKAQPAQGPPPSKLPAPVQPVKPLNIANKQTAKTNVPDGVRQAEA
FT                   ALSKKAEPRQREVRMSNMSENEVMDRLRSVVSKDNPNESYSKQRKIGQGASGSVYVARV
FT                   KEHATSGVARELYRQYGPRTQVAIKQMDLRSQPRKELIVNEIIVMKDSQHANIVNFLDS
FT                   FLQEQSNELWVVMEFMEGGALTDVIDNNPVIQEDQIATICAETCKGLAHLHSQNIIHRD
FT                   IKSDNVLLDRAGHVKITDFGFCAKLTESKSKRATMVGTPYWMAPEVVKQKEYGPKVDCW
FT                   SLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPEKLSKELKSFLSVCLCVDVR
FT                   SRATADELLAHDFLKLGCSLASLAELLRWKKNSGQ"
FT   gap             480457..480556
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(483955..484048),complement(483759..483873),
FT                   complement(482623..483694))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657727"
FT                   /orf_name="An17g02020"
FT                   /product="Catalytic activity: ATP + NADH [ "
FT                   /EC_number="2.7.1.86"
FT                   /function="NAD+ kinase activity"
FT                   /function="NADH kinase activity"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK43075.1"
FT                   /db_xref="GO:0003951"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0042736"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG328966"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniParc:UPI0000EFD1FD"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N0"
FT                   /transl_table=1
FT                   /translation="MLWSRSFSSSPRRYEIRDVATLPKRLIPKYQESQVGDLLSLQWPA
FT                   PPRNIFVVKKDYSPAVTASLIEFANHATSTYPSASIILEPSVAEEIHSSLQSPVYTAPL
FT                   DQLRPALHDKVDLTVTLGGDGTILHASSLFATCYNVPPVLSFSMGTLGFLSEWKFAEYK
FT                   RAFREVYMSGAGVGDRATVLGDPQPASVDETLDLEANPTGWSSVRGKSMGLTRGARILM
FT                   RNRLKVGLFTADGKPVQRESTSAAMPNVVNNQGVYVMNEVLLHRGKEPHLAVLDVYVGG
FT                   RFLTEAVADGIIISTPTGSTAYSLSSGGSIVHPLVPAVLLTPICARSLSFRPLVLPSST
FT                   PITLRLSEKNRSRELEVSIDGVNLGQGLTAGMEARVWDEEMRHGKNEWQGGVPCVMRRI
FT                   TGGEAHDGWVGGLNGLLKFNHPFGEER"
FT   CDS_pept        join(484968..485833,485896..486283)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657728"
FT                   /orf_name="An17g02030"
FT                   /product="Similarity to 2-acyltransferase from patent
FT                   WO9413814-A - Zea mays"
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAK43076.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG398568"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI0000EFD1FE"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N1"
FT                   /transl_table=1
FT                   /translation="MDTSEVRQRKHDPQLDHTASSKKQSSDSQDEEPRLKHGIAMQLLR
FT                   SLLLATWFNCCCVAILATQVIGSPLYVINKDWYYSYMAYTKQSFGLVITALTQWGCPTF
FT                   VRVSGDRSVRGQVHVAEDGRLKTQFPERMVLIANHQVYTDWIYLWWVAYTNTMHGRIFI
FT                   ILKESLKYIPIIGQGMTFYGFIFMARKWLSDKPRLQHRLEKLKTQHTGSQSGSPQYDPM
FT                   WLLIFPEGTNLSINTRRRSAEYAAKQGLSPLKHELLPRSTGLFFCLQQLRGTVEWVYDC
FT                   TVAYEGPPKGSLPDKYFTLRSTYLQGRPPTSVNMHWRRFAVSEIPLDDQQEFDSWLRER
FT                   WIEKDQLLEEYYETGRFPSELAGSIEVGHGFEDRKTAAAAGYAEAHVRLGHWAEVGRIF
FT                   MVLLGTVFLCKLPKLLEF"
FT   CDS_pept        join(487102..487956,488029..488769,488815..490818)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172007" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891684"
FT                   /orf_name="An17g02040"
FT                   /product="Remark: alternate names for S. cerevisiae Ctr9:
FT                   Cdp1 or YOL145C"
FT                   /function="binding"
FT                   /protein_id="CAK43077.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG328969"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000EFD1FF"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N2"
FT                   /transl_table=1
FT                   /translation="MASLQNGHANGTNGDSLPAANPLPNLRFSDIPSAIDIPASTLDSE
FT                   VEVSLEILPDDPTELCTLLENEKAAKNFWVTIALAYAKQKQLDHAIDILNKGLASVAHG
FT                   ATKEKLGLLGWVCWLLMLKSRNAPRVAPEGELYTEAKTKDHYLQLATSTLNEASRLNPA
FT                   FPPLFLARGVLSLLRASLHPPRPVRPGTVDTSERVESLRQALKCFDESSKAFGGRNVMA
FT                   ILGRARTQYLLGRYAEALEGYQKVLMKMPSLTDPDPRIGIGSCLWQLGFKEQAKVAWER
FT                   ALALNPDSKVANILLAVYYLYDSSRHATTDPAFGSLYKVAMTQYTQKAFKIDKEYPMTC
FT                   SLFGGYFLLRKAYSTVETLARKAIEHTDVMQIASDGWYLLGRKSHYEGDLTRAAEYYNR
FT                   SDQARGGGEKGYLPAKFGTVQMQVSNKDFDGAKFRLEKIIQQTKNAECMVLLGALHAEE
FT                   VFAAQRSGSKEDKSVEIKKAINLLESVRALWKDETKKISPDESVLVYLARLYEQSAPEK
FT                   SMQCLTQLEEMQLAEVKAALRVHLPPQLLNNMGCFLYQAEKIERARTMFQAALDACVRS
FT                   KEKESELDTDALVTTISFNLGRTYEAADMPEEAKKVYQGLLERHADYTEANARLTYIAL
FT                   RQSPTDEGPKKMAKLYEADSTNLEVRALFGWYLSKSKKRAANLAEDHEQRHYKHTLQYY
FT                   DKHDRYSLTGMGNIHLSTARDMRRDSDQDKEKRRKMYERAVEFFDKALQLDPRNAYAAQ
FT                   GIAIALVDDKKDHASAVHIFSKIRDTLRDASVYLNLGHVYAELRQYTRSIEHYEAALSK
FT                   DRARDAQILACLGRVWLAKGKQEMNLQAMKTALDYAQRAHSVAPGQVHLEFNVAFVQNQ
FT                   IASLTYGLPETQKTVQDVQDAAEGLQQAVETFNRVAQAKNPPYPSSALEQRANMGRTIL
FT                   KQLERALQSQKEYEEKNAAKLQQAREAREAEKRQREEEVRKAQEAERERKQRVAEERQR
FT                   MIEEAQRLAEQRAEEERAREEAELTTESETGAKVKRKKRTTSTKRKKKRNEDDFINDGG
FT                   DSPSRERSSEPDSDGEAAAAPKKRRRLERRSGSKAQQSKYKSSEMVVDSDDDEEGGAGG
FT                   ADDDDEDHAMRDTGANDDEDEEEQDVVQRRRAKVNRRVADDDEDEEDEDDGAVVAGGGG
FT                   EGATTGGDGGEDDDDGLFNDDGGDDDMDMKEDE"
FT   CDS_pept        join(492253..492362,492498..492645)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891685"
FT                   /orf_name="An17g02050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43078.1"
FT                   /db_xref="UniParc:UPI0000EFD200"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N3"
FT                   /transl_table=1
FT                   /translation="MMEEDKYSTKLYGMVRVVRMVGIRSGFGIFNTGLGGMRIPTDSHA
FT                   VFLSTAAPVNGVTYSILDTSPCWLGRSSHEQDAHPDRRSM"
FT   gap             497261..497360
FT                   /estimated_length="unknown"
FT   CDS_pept        join(<497361..497691,497772..499699)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891686"
FT                   /orf_name="An17g02060"
FT                   /product="Remark: due to contig end. "
FT                   /protein_id="CAL00547.1"
FT                   /db_xref="HOGENOM:HBG023715"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="UniParc:UPI0000EFD201"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N4"
FT                   /transl_table=1
FT                   /translation="LSVFSGRSRSNTTNSTTSSRRSPASSMTSVDAASLPSQDDRTTSA
FT                   AGVRHERPESVTKSLLSRGSRILRRQGSKFHIVSTLDEEDEMEREKPRFEVSEIFSRNK
FT                   SRHSDAHDQLKNLISDPFDFHHLTHTSPSQFQSLEKARETDLVTEFSAIRASQRPVTNL
FT                   KGIRAEDLHFRDFSTEDLTQCGTAIGCDDVVPPPPTSPPASPGGSSSVSPKQRDVRVRR
FT                   ESRVVENFSRPVPRFPKVGSTTPPPRASSPRLASSPELPEPAPRAIDEILGLSTQPTYP
FT                   EHVYSHTEDVEQGAAWPQIPLEDMFQPPSGHAFATNINNEVMNARTSSMSLPTLSSDLE
FT                   DVPEEEEPSPWHEGPGLQTDEVSPRAPVMSRSPPFSEAQSPSTTSMAGPRSDLSIYVAE
FT                   DLSRKFAEALGSPTLPQDRIATAAPLQESMAREPVRRRSSVNLRAIQETIYESWDADID
FT                   YCYEHAAESNCNFDWTRSSLDEPRQDDAEHGVTGTDENKALFEPMGLSGSVLPAADLDH
FT                   VPSAHVVVTSTTLDDNTGIAVTQRDSDYFQPVRFAPSLGKQINPDSLYDEYLTADTESD
FT                   RHFAFYSQPGVIQPMDQSVSPRSSFSPISKCNSQESLILSRAASVVRKHRSSVSTASVP
FT                   DLVHSLASSREFHPSEQRLSGELSGMGRPESSHHRQTKSLAREVESQLFRADGDASPEP
FT                   SGYASTVGPSIHDRAKSTTEVEAGPLIARAIKNDAASRAAPRRKGRASYSLFPTPAAN"
FT   CDS_pept        500640..502073
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114595"
FT                   /orf_name="An17g02070"
FT                   /product="Similarity to hypothetical protein ES2 - Mus
FT                   musculus"
FT                   /protein_id="CAL00548.1"
FT                   /db_xref="HOGENOM:HBG328971"
FT                   /db_xref="InterPro:IPR019148"
FT                   /db_xref="UniParc:UPI0000EFD202"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N5"
FT                   /transl_table=1
FT                   /translation="MSADSQALTKRQSDTSLMPPPPPPKRIKRPATVLDEDVYTNALSE
FT                   IIARDYFPGLLEAQVKQEYLDALDSRDKQWIASSKKKLTDLLKTPGRARSHSGSASMTP
FT                   RATNSGRPEDTPMGWGGDTPMSVMSTTSSSTTPNVDHVTTPDVSRLGLLEFQAKYTSED
FT                   NESFNKLLDKQNEKHRERYKWLWSGNKIPTARQIAHRRQEAKRIEAQGGNPDQLKQIAI
FT                   KTDLDARPANPDTWKTQPENSLMFAPSSIEDSYETIQQKAEASSRAGPKRVVFQNTRLP
FT                   DESIQQTSSDANAPPPSPSISAIKDAIAGHPRPTESEAVYTGGETPRVNGYAFVDEDEP
FT                   EYPLTSSNDNDNSAISPDDIRLLGGSDATPNPFEIKENRRREDIHHRMVDRVARSKRAE
FT                   KSLRETKTPVTPRFASSPRLDFGLRTPGAATPGGRTNKALTPAAQKLLHQVGSTPRLAA
FT                   SSSSSSLRNMWTPTPKRGK"
FT   CDS_pept        join(complement(503500..504658),complement(502766..503439))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891687"
FT                   /orf_name="An17g02075"
FT                   /protein_id="CAL00549.1"
FT                   /db_xref="HOGENOM:HBG328972"
FT                   /db_xref="UniParc:UPI0000EFD203"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N6"
FT                   /transl_table=1
FT                   /translation="MFVRLIPPRLQCRRRATVRAVLGCAIALAICVGRVAATADENDPD
FT                   TPSLASRSHGHFLFGEASPEFSFPLAEYNGLEFEDVVDEEGDARGLDLVRRAPTGVTSL
FT                   GNNQYQNGTLKMGETEWWYFPVNGDETNSTSENKKSRDLSKRSTTVYLSLTACSKPSHN
FT                   NTDSTSTAAVPQLTVYASELIEKPGPDKSESDQTIKSAEEGYVGMTLTANGDVYVGVTA
FT                   PNSTEYSGSFTYQIAASTDAYFHSVDESDQFMFLVDSDTGAALLTTRNLTNSDLTSQNY
FT                   SSWMDMTPPYTMFANNINSTSISGLERSFCALDSLAQIGKSEVATSITTRGAVDRPTEQ
FT                   LYVTGLNKSSTYYGIMAREGNSTEWGNGIVGGGGKVWPRMNFTTKTDDNCAVVYDLPFC
FT                   SEVAYAVPSNPSINMTELRKIYDDNAASFYQNFSYSLQQVQCNTSSESMFSLAVSCDTC
FT                   ADAYKQWLCAVTIPRCADFSSNATFLQIRNAGQPFLNGTSITNSSLLKSPATNNSRNPL
FT                   IDSLIRPGPYKEVLPCQGVCHSLVRNCPSILGFSCPEGPRANVSYGMRDPNGDITCSYL
FT                   GAAYYLNAVSSLHESIWISLYMVIGVWTSFWILG"
FT   mat_peptide     join(complement(503500..504547),complement(502769..503439))
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N6 "
FT   sig_peptide     complement(504548..504658)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N6 "
FT   CDS_pept        join(complement(505894..507305),complement(505245..505824))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963571"
FT                   /orf_name="An17g02080"
FT                   /product="Similarity to hypothetical protein SPBC27B12.12c
FT                   - Schizosaccharomyces pombe"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAL00550.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG328973"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0000EFD204"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N7"
FT                   /transl_table=1
FT                   /translation="MSESPKSEKYMCLTRFRTPVPELDDHRFQLDAPRLEATPDVPLSR
FT                   QNTVPQAFNPETPQRPDLLNIEDALREAGSLSRDFETAVVDDDRSDKDFNAMGRRFSVD
FT                   PTGNIRHGRTYSRTHQDIANLSRESSVSARSTSPPNSVEAFADPRRRERANTLESHAAP
FT                   DLEAILQRTVSGGTHPRRPTFSNASVVRPQPGDLTLEPTDDGCLPTFEQPGRIPVIDYE
FT                   ELEEFVALNQKAKPSANRRKHSVSSQSQKPRVFYDSRPGAQKSEKDVEKRSSSIERSSE
FT                   DILESTLEKDDKKDFSEVVNEKELLATLKNANEPTRFGFFSSEAQSTVHAAELGDLVLP
FT                   GDTFRDLFQLGPDGGVWWLDVLNPTEDEVGALSRAFSIHPLTTEDILTQEAREKVELFK
FT                   QYYFVCFRTFYQVDKADERFMEPVNFYMVVFRDGVLSFSFTDNPHAANVRRRIGKLRDY
FT                   VSLSSDWICYAMIDDIVDSFGPVIREIEVESEAIEDLVFIARMDDFESFLPRIGGLRKK
FT                   VMSLMRLLGGKADVIRGFSKRCNEQYSVTPRGDIGLYLGDIQDHVVTMMSNLAHFEKML
FT                   SRSHTNYLAQLNVTNLMLGNHVNKVLSKVTLIATMLVPMNLICGLFGMNVRVPGQDAAG
FT                   LGWFFGILGVIAAIVILSGVVARCYKLV"
FT   CDS_pept        join(510106..510529,510642..510940,511019..511360)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891688"
FT                   /orf_name="An17g02090"
FT                   /product="Catalytic activity: ATP + L-homoserine [ "
FT                   /EC_number="2.7.1.39"
FT                   /function="ATP binding"
FT                   /function="homoserine kinase activity"
FT                   /biological_process="threonine metabolic process "
FT                   /protein_id="CAL00551.1"
FT                   /db_xref="GO:0004413"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006566"
FT                   /db_xref="HOGENOM:HBG646290"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000EFD205"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N8"
FT                   /transl_table=1
FT                   /translation="MAATSFVIRTPCSSANIGPGFDVIGLALSMHLELHVTIDTSKSSQ
FT                   QPLNCRITYDDLSNSSEKISLDPEVNLITRVALYVLRCHSQRAFPAETHVHIVNPIPLS
FT                   RGLGSSGTAVVAGVMLGNEVGKLGLSKDRLLDYCLMIERHPDNVAASLFGGFVGTYLNE
FT                   LAPEDVARKEIPLSEVLPSPAGGIDTGKRPPEPPIGIGHYRKFQWAKEIKAIAIIPDFV
FT                   VPTANARNVLPTSYTRADVVFNLQRAALLPAALGSSPPDPDMIYLAMQDKVHQPYRQTL
FT                   IPGLTEILQSMNPRTQPGLLGICLSGAGPTILALATDRFEEIADRIISRFATNGIACQW
FT                   KLLEPAQDGTTVQY"
FT   CDS_pept        join(512202..512282,512362..512565)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891689"
FT                   /orf_name="An17g02095"
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="CAL00552.1"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG737791"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="UniParc:UPI0000EFD206"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N9"
FT                   /transl_table=1
FT                   /translation="MINVSINRTSKASALQSFLAQCFLFCRAVAFIVGYIFQDIHLTLW
FT                   VGLAGTLITGLAVIPPWPMYNKNPEKWLVPLTAGVGGGAGIMVDGVKVA"
FT   sig_peptide     join(512202..512282,512362..512370)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N9 "
FT   mat_peptide     512371..512562
FT                   /db_xref="UniProtKB/TrEMBL:A2R9N9 "
FT   CDS_pept        join(complement(513248..513358),complement(513103..513181),
FT                   complement(512971..513041),complement(512806..512904))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891690"
FT                   /orf_name="An17g02100"
FT                   /product="Complex: human ring-box protein 1 binds VHL
FT                   protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAL00553.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG381683"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0000EFD207"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9P0"
FT                   /transl_table=1
FT                   /translation="MADVEMKEAGSAAVKAKGSSKASEGASDGKKKFEVKKWNAVALWA
FT                   WDIVVDNCAICRNHIMDLCIECQANQGSSTTEECTVAWGICNHAFHFHCISRWLKTRQV
FT                   CPLDNRDWEFQKYGR"
FT   CDS_pept        514473..515879
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891691"
FT                   /orf_name="An17g02110"
FT                   /product="Similarity to hypothetical protein KIAA0324 -
FT                   Homo sapiens"
FT                   /protein_id="CAL00554.1"
FT                   /db_xref="HOGENOM:HBG328974"
FT                   /db_xref="UniParc:UPI0000EFD208"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9P1"
FT                   /transl_table=1
FT                   /translation="MSTQLPNPPTPKGSRNNRRNSKRTLTPSTQKVAILATPPSSPPRN
FT                   SSPGGTATDSSININATKKKHSRSGKKPRDASKASPAPNGHRHTTSQPNNTIATPQVKD
FT                   SPHYAGPTFHASPAPSALPIPSFFSKSLPESDLAPALESDGDHLDAEPDLENTPSKPKS
FT                   RPQFQEEERQSTPLDFLFRAAVEARNPQQQQQRSPEASSRVRSPQTDSKTLQHRRPNGT
FT                   ANGLFRLEMESPEFQHSQIGPSFATSYKDRMNALRSASSPSPPVCDFDEQEKRAKTEAL
FT                   KTLLLNPRPQRPSSASITAQDHSNPVMERPASNPGVPHFATPVRTTSGPPASISHGMSY
FT                   DQKQTFVGNGRHYSSSYTHSNAAQQYHLQNSPLRKEVLTSKVENMPSVHGQAFYPPAAY
FT                   DQPKSPPKYAQYPTYYSPPQHQSPVSRSVSVSNNAQPYDTKKIEDDLRRILKLDVNPTM
FT                   PANGMQSSFA"
FT   CDS_pept        join(519639..519649,519739..521305)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114596"
FT                   /orf_name="An17g02120"
FT                   /product="Catalytic activity: UDP-glucose + "
FT                   /EC_number="2.4.1.34"
FT                   /function="1,3-beta-D-glucan synthase activity "
FT                   /biological_process="cell wall biogenesis"
FT                   /protein_id="CAL00555.1"
FT                   /db_xref="GO:0003843"
FT                   /db_xref="GO:0042546"
FT                   /db_xref="HOGENOM:HBG328975"
FT                   /db_xref="InterPro:IPR009203"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniParc:UPI0000EFD209"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9P2"
FT                   /transl_table=1
FT                   /translation="MANAIGSAWRSFWHTMTSYDRHASHDSPYRTGKHVPLSQSRHEPL
FT                   TSIATSAIESRPDLTSPYDDDQPKGSNGWSGSPTGGGSPNRPYSPGMRSLSSQKRQSAD
FT                   PNADGAPEIQMQSFHDGAPPPPPIAHSWRKIEKWLENNYQELWDNLCEGCTQNDINELE
FT                   HELDCSLPLELRESLMVHDGQERGGLPTGVIFGCMLLDCEEIVQEWKNWRVVNEEFLSS
FT                   SMMNAPSRPTPSSSSAVPPAPGANGAWRNDLLERQDSQPPGAVQKAYAHPAWIPLARDW
FT                   GGNHIAIDLAPGPAGKWGQVIIFGRDYDCKYVVARSWSAFLATLADDICSGKVSVDEET
FT                   NEMKLLEFKSQNVEPPYLEILRWRADQKYGRRKPRRKAPNGLGLSTGGKSGKESPYGSP
FT                   TPSEERGRSPHRFPNRGSTQSPKTQFGMSSPLARVTEEAPSPVHTVEETGLPEKAAKEN
FT                   EEERSSEDLMEVATPQIGGKENEGAGKSEEERQSLEADKAQKRDSNQLSSATGLDAEVL
FT                   GEMKNVAI"
FT   CDS_pept        complement(522188..522916)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810393"
FT                   /orf_name="An17g02130"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAL00556.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG627010"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI0000EFD20A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9P3"
FT                   /transl_table=1
FT                   /translation="MSRAFEGNPPARDQDDHDADSDALFDALENEDDTAYRAHRIEQLN
FT                   AEFASAQNNKNNNDSRTRDHTILEDSLYPTISSDQALLDFTTQTHRCVIHFAHPDFARC
FT                   GTMDEHIRALATRHHEVRFARVDVRNTPFVVERLKIRVLPCVIGFKDGVGVERVTGFEG
FT                   LGSGGRDGTDGFSTATLEKRLIWKGILAQEKFRAGDGATDGSEDDDSDDGERRDRGKRS
FT                   IRTGNARSYRHADDDDDDWD"
FT   CDS_pept        join(524114..524356,524437..524524,524593..524964,
FT                   525030..525472)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000031183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114597"
FT                   /gene_name="gmt1"
FT                   /gene_synonym="vrg4"
FT                   /orf_name="An17g02140"
FT                   /product="GDP-mannose transporter "
FT                   /function="nucleotide-sugar transmembrane transporter
FT                   activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="cytoplasmic vesicle membrane "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAL00557.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005338"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030659"
FT                   /db_xref="HOGENOM:HBG328976"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI0000EFD236"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R9P4"
FT                   /transl_table=1
FT                   /translation="MAEGKKTDDYTIQMDSIDQGNKSFEAPPPPQPRSPPSGSLSNNPI
FT                   LPVLAYCGSSILMTVMNKYVLSGTDFNLNFFLLCIQSLVCIIAIQTCKSCGLITYRDFS
FT                   ADEARKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTGL
FT                   TLFSFGLMVLSSIIAAWADIKHAVESNGDATAKVSTLNAGYIWMLVNCLCTSSYVLGMR
FT                   KRIKLTNFKDFDTMFYNNLLSIPVLIVLSAFLEDWSSTNVNRNFPPMDRNSIVFAMILS
FT                   GLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIAISGLIFFDAPVTFPSVSAIVVGFV
FT                   SGIVYAVAKIKQNAKPRTGVLPTANPPVSASSQSMRDSLRS"
FT   CDS_pept        join(526622..526919,527208..528256)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963572"
FT                   /orf_name="An17g02150"
FT                   /product="Similarity to hypothetical protein YIL096c -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAL00558.1"
FT                   /db_xref="HOGENOM:HBG328977"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="UniParc:UPI0000EFD237"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9P5"
FT                   /transl_table=1
FT                   /translation="MPKSKKAGVSSPAGQQQQQHPKKHRKMASFAKLSTTTTTNPAKPK
FT                   AAQSAHHQPGSGNAKNSNNDRKMKNSQQQQQQLQKNQRPIVPFGRKDRILLVGEGDFSF
FT                   ARSLVLQHRCKNVMATCYDSKDTLHSKYPKAGNNIHDIQYAFSKATTEELASDSKEISS
FT                   IGGDAGIVETNAQGFLEDQAQRRGPKVIYSVDARKLGLPAGGGKEIRTGFPRQERRRPA
FT                   WKEAKSGASSAPQGGPWDVICFNFPHVGGISTDVNRQVRANQELLVAFFKACVPLLSHR
FT                   PERVDSDDEDDWDNWEGSGVESSGGENHHDSSGDGNQLRTANTTGQATCRNRVEPGQIL
FT                   VSMFEGEPYTLWNIKDLARHAGLQVVTSFRFPWASYKEYSHARTLGDIEGKDGGRGGWR
FT                   GEDRDARMYVFEVKHEDHPVMRRNAPSSKAGQSARKKRPRDASDSDDSE"
FT   CDS_pept        join(complement(529120..529788),complement(528857..529051),
FT                   complement(528568..528799),complement(528466..528497))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000241232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891692"
FT                   /gene_name="fyv10"
FT                   /orf_name="An17g02160"
FT                   /product="Protein fyv10"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAL00559.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG735590"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="UniParc:UPI0000EFD238"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R9P6"
FT                   /transl_table=1
FT                   /translation="MAAELTSTRLNAENHLLLVLNSSPPTYCWLAPHSDTNSVDYLQDQ
FT                   PLLRLPHELARRNFKSVQRLVEREKEYVLPALKETANASLSNEQTPDQALAALDAMISR
FT                   MQGLKRKMENLHQEERKIQEQSRKRIQHLEKLHQIPSLADVQYDQWARVRLDRLMIDHM
FT                   LRSGYIKSAQQLAREKGIEDLVDLNVFVQCQRIAESLRTGETKDALQWCGENKAALKKS
FT                   QYNLEFELRLQQYIEMVRAGHKERFNDAMIHAKRYLAPYLETQSVEIHRAAGLLAFPPD
FT                   TKAEPYKSMYAHERWAYLSDLFVRTHHELLSLSSRPLLHIALSAGLSALKTPSCHSAYT
FT                   SSSSNSLSTTTSVCPICSTELNELARFTASNGCWR"
FT   CDS_pept        join(complement(531830..531941),complement(531612..531768),
FT                   complement(530921..531552),complement(530640..530866),
FT                   complement(530253..530582))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963573"
FT                   /orf_name="An17g02170"
FT                   /product="Similarity to centromere/microtubule-binding
FT                   protein Cbf5 - Saccharomyces cerevisiae "
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAL00560.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG397258"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0000EFD239"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9P7"
FT                   /transl_table=1
FT                   /translation="MAVAVAKEEMDYSIKPEASASKIDTSEWPLLLKNYDKLLVRTGHF
FT                   TPIPAGSTPLKRDLKSYINSGVINLDKPSNPSSHEVVAWMKRILRAEKTGHSGTLDPKV
FT                   TGCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKIPGGEAQFKRALETLTGALFQRPPL
FT                   ISAVKRQLRIRTIHESKLYEFDNERHLGVFWVSCEAGTYIRTLCVHLGLLLGVGAHMQE
FT                   LRRVRSGAMDENSGMVTLHDVLDAQWLYDNQRDESYLRKVIKPLETLLTTYKRIVVKDS
FT                   AVNAVCYGAKLMVPGLLRFEAGIEVNEEVVLMTTKGEAIAIGIAQMSTVELSTCDHGVV
FT                   AKVKRCIMERDLYPRRWGLGPVALEKKKLKSAGKLDKYGRANEATPAKWKNDYKDYSAP
FT                   EEEGAQAVAQPVAQEETATPAEQTETPSSPNKMDVDDDDDEKKKRKRHEGETPEERAER
FT                   KRKKKEKKEKKERRKSKQEKEESDDSD"
FT   CDS_pept        join(complement(533811..533845),complement(533578..533756),
FT                   complement(533431..533528),complement(532970..533012),
FT                   complement(532499..532911))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171884" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810394"
FT                   /orf_name="An17g02180"
FT                   /product="Similarity to hypothetical eIF-3 p110 subunit -
FT                   Caenorhabditis elegans"
FT                   /protein_id="CAL00561.1"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI0000EFD23A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9P8"
FT                   /transl_table=1
FT                   /translation="MDQFWAAPPVTRTLTALTFLQSILVHGGLLSGYYVLFLRRLVFKT
FT                   LPEIWRLFSPFMITGPGLSLIFDLYFMFTYGSRLETESPRFSAPGDFFTYVSFVASIIM
FT                   LTAGCLLNSVIFTSALIMAFVYTYSQDNRGRKASFFIVQIPVEFLPWAMLTLTLVVSGW
FT                   PAALRDGMGIVAAHFYDFLTRIYPTFGGGKNYLVTPEFVRRFFAARKPRSEPRAFGTAY
FT                   RATDQAQGSSGSWASSFQSPWSRRGPGRRLGGD"
FT   mat_peptide     join(complement(533578..533710),complement(533431..533528),
FT                   complement(532970..533012),complement(532502..532911))
FT                   /db_xref="UniProtKB/TrEMBL:A2R9P8 "
FT   ncRNA           complement(533110..533306)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR43"
FT                   /db_xref="Rfam:RF01256"
FT   sig_peptide     join(complement(533811..533845),complement(533711..533756))
FT                   /db_xref="UniProtKB/TrEMBL:A2R9P8 "
FT   CDS_pept        join(complement(534989..535718),complement(534542..534924))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891693"
FT                   /orf_name="An17g02190"
FT                   /product="Similarity to hypothetical protein SPBC1105.15c -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAL00562.1"
FT                   /db_xref="UniParc:UPI0000EFD23B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9P9"
FT                   /transl_table=1
FT                   /translation="MRMFSLDSRRMRLLLRSWQQQQQQQQQWRILPASLRACSSLSERL
FT                   HRDLTSRRLPLTFDYLHPQPSYLLSLTLAELLPTLTPASNELPSAHSRFPVPAGHHLVY
FT                   FPPQVTLSQILPDGTDTLHAPGSPFDRRLWAGGSVRFSTPNGLVLNGSRAVCIETIRDV
FT                   VMKGRSGEEKVMVRIERRIGAVQEGEDHRNIRERIWKEAEEDVGDACVIETRNLLFMRK
FT                   KTPEQLSHDKAGFDMENRAIRSPSGSYFLHRLIPNKTLLFRFSALTFNAHSIHIDKTYT
FT                   QDVEGYRNLLVHGPLTLALLLAALQGHLSKFELAVTHIEYRNIAPLYVDEELAVCGKPK
FT                   SGKGYAIWDVWIEGRDGRLAVRGTAFTSPL"
FT   CDS_pept        join(535937..535990,536048..536938)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810395"
FT                   /orf_name="An17g02200"
FT                   /EC_number="4.2.1.51"
FT                   /function="prephenate dehydratase activity"
FT                   /biological_process="L-phenylalanine biosynthetic process "
FT                   /protein_id="CAL00563.1"
FT                   /db_xref="GO:0004664"
FT                   /db_xref="GO:0009094"
FT                   /db_xref="HOGENOM:HBG693866"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="UniParc:UPI0000EFD23C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q0"
FT                   /transl_table=1
FT                   /translation="MEPLKVAFLGPVASFSHQAAVESFGSSAELLPHVSFPDAFAALQG
FT                   GRVDYAIIPCENSTNGSVVQTLDLLADPSGLYSDVKVCGEHYLTVHHCLLTRKGLFPPG
FT                   QRDYSSITKLYTHPQAWGQCDTFLEKTFKGIERQDVSSTSKGAEIVSKETTERCGAIAS
FT                   RFAAEHHGLDVSEENIEDKANNTTRFLVLRNVKSERTGRLVFQYVNGSPAQRQTSTTPT
FT                   AQKTLISFMIRQDCPGALADALLIFKDRGMNLTSINSRPSQIRAWKYVFLVEGQYVPTS
FT                   ENADAVSKIIDGLQFVTEGCRHLGTWADQLVDV"
FT   sig_peptide     join(535937..535990,536048..536062)
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q0 "
FT   mat_peptide     536063..536935
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q0 "
FT   CDS_pept        join(complement(538994..539114),complement(538881..538930),
FT                   complement(537690..538818),complement(537468..537614),
FT                   complement(537373..537416))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810396"
FT                   /orf_name="An17g02210"
FT                   /product="Similarity to peptide chain release factor eRF-1
FT                   - Homo sapiens"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAL00564.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG497188"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI0000EFD23D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q1"
FT                   /transl_table=1
FT                   /translation="MSAAQPNEAEKNIEIWKVKKLIKRLEAARGNGTSMISLIIPPKDQ
FT                   ISRAAKMLAEEFGTASNIKSRVNRLSVLSAITSTQQRLKLYNKVPPNGLVVYCGEIITS
FT                   EGKERKINIDFEPFKPINTSLYLCDNKFHTEALSELLESDQKFGFIVMDGNGALFGTLS
FT                   GNTREILQKLSVDLPKKHGRGGQSALRFARLREEKRHNYVRKIAELAVQNYITNDKVNV
FT                   AGLILAGSADFKNDLNQSDMFDQRLQAKVIKVVDVSYGGENGFNQAIELASETLSNVKF
FT                   VQEKKLIGKYFEEISQDTGKVCYGIDDTLKALELGAAETLIVYENLDVTRHVLKSSSGS
FT                   DVVIHTTKSQEENRELFMDKETGAEMEVSEQQSFLEWLAESYKDFGATLEFVSDKSSEG
FT                   NQFVKGFGGIGAILRYKVNFEQLADYDDEDEFYDESEDERPEDSSSDLLTARPVIRDGG
FT                   SPGNMAAMVHTLPLPSQSPMKLLRTGPSKLRNMFTEVM"
FT   CDS_pept        join(540765..540940,541009..542126,542183..542280,
FT                   542392..542562)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891694"
FT                   /orf_name="An17g02220"
FT                   /product="Similarity to hypothetical protein YJR001w -
FT                   Saccharomyces cerevisiae"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAL00565.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG397737"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0000EFD23E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q2"
FT                   /transl_table=1
FT                   /translation="MPESTIPTAAGAQASSSHRPIAPGRSSVDSAIEPDVYPYGLATSS
FT                   GSYSRVENSYPRPRSASISARFRQAGGVNSIDNFARSWQRAAYFPEVLPRRSSFVVDSD
FT                   EEWAGTTNDIFRPQEYSGHEADFTRPLLGADGGNEDNGMTGQLSKRTSNADIFEPSLGG
FT                   SYGTISSRVSATTRKHAIQLHREQQSHGDTSVGYEREPVLVKQVHHEDGTRECIVVGQS
FT                   TVPQTIFNSVNVLIGVGLLSLPLALKHAGWLLGLLFLLFAAVATNYTAKILAKCLDVDK
FT                   SIVTYADLAYISFGHHARLATSLLFCLELVGACVALVVLFADSLQALIPGLSLLQWKIV
FT                   CGLMLIPLNFLPLRLLSVTSILGILSCTSSMCAFFPNPLYFREANIVEVVIITCIDGLT
FT                   KPTAPGSLLQPARTYLLPDKWATLPLSFGLIMSPWGGHGVFPNIYRDMRHPQKYGKSLW
FT                   VTYIFTYSLDCTMAIVGWIMFGDDVRDEVTANILRTDEYSQVLSICMIMFIAIIPITKV
FT                   PLK"
FT   CDS_pept        complement(543058..543921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891695"
FT                   /orf_name="An17g02230"
FT                   /product="Similarity to hypothetical protein YBR141c -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAL00566.1"
FT                   /db_xref="HOGENOM:HBG396270"
FT                   /db_xref="InterPro:IPR021867"
FT                   /db_xref="UniParc:UPI0000EFD23F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q3"
FT                   /transl_table=1
FT                   /translation="MGPSNKQLRKRPGLLSRTRPPTVRAKHAALSAKATRNLIRSHHRL
FT                   LKALAQAVRAGDDVLVGKIEAQIQENGGLESYQLASKLGQSLDRGGDSSKVLVDWIAPR
FT                   LLPIENTPYKLRVLEIGALSTKNACSMNRLLDVTRIDLNSQEPGILKQDFMKRPLPQNE
FT                   SDRFHIISLSLVLNFVPDAAGRGEMLKRCISFLTTSPPSGSSLDIIPSLFLVLPLSCVT
FT                   NSRYLTESRLQDIMSSMGFALAKTKQTSKLIFQLWDQVGGYNAKPFKKEILNPGKTRNN
FT                   FSIIVK"
FT   CDS_pept        join(544279..544306,544583..544644,544714..545000,
FT                   545066..545153)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20657729"
FT                   /orf_name="An17g02240"
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAL00567.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG439330"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniParc:UPI0000EFD240"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q4"
FT                   /transl_table=1
FT                   /translation="MAPKVENKQGKTKPSDKAGAAAKAVIKGAGAHKARKVRTSTTFHR
FT                   PKTLQLSRSPKYPRKSIPHVPRLDAHKVILYPLNTESAMKKIEENNTLVFIVDVKSNKR
FT                   QIKLALKKLYDVDTVKVNTLVRPDGLKKAFARLTPDVDALDIAATKLAIV"
FT   CDS_pept        join(546374..546545,546617..546747,546883..547026)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891696"
FT                   /orf_name="An17g02250"
FT                   /product="Similarity to protein G10 - Xenopus laevis "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAL00568.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG328980"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="InterPro:IPR018230"
FT                   /db_xref="UniParc:UPI0000EFD241"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q5"
FT                   /transl_table=1
FT                   /translation="MPPVRTSRNRKPPPAGFDDIEDTLLEFSNKMKDAENASHDGKKKH
FT                   EMLWPIFQISHQRSRYVYDLYYEKEAISKQLYEWLLKNNYADANLIAKWKKQGYEKLCC
FT                   LRCIQTKETNFNATCICRVPKAQLKEDQTIQCVSCGCRGCASSD"
FT   CDS_pept        complement(<549283..549978)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18963574"
FT                   /orf_name="An17g02270"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAL00569.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000EFD242"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q6"
FT                   /transl_table=1
FT                   /translation="MSPTRSAPLTSRPTSCGKAIPKPRPRLEPSPLPLQPVEHVPSTQG
FT                   QFLNATASTTHNVSPAKAVRGSSSLFSGHGNLGYVPITAPPAPEFITDSPSKHPSFGYH
FT                   HTAASSSSMPQSALFTTFSTSSSGKQSPKETQSSDEPNSDNFADFPEPSFIPKPLKRTL
FT                   MDAAPLKERQTKKQKREEPSSMRLPEPHEMPPIEDDGTKPPYSYATLIGMSILRAPNRR
FT                   LTLAQIYKWI"
FT   CDS_pept        join(complement(554256..554404),complement(554106..554186),
FT                   complement(552719..553968),complement(552562..552659))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000293094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810397"
FT                   /orf_name="An17g02280"
FT                   /product="Catalytic activity: ATP + L-Aspartate  "
FT                   /EC_number="2.7.2.4"
FT                   /function="amino acid binding"
FT                   /function="aspartate kinase activity"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /protein_id="CAL00570.1"
FT                   /db_xref="GO:0004072"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG724395"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniParc:UPI0000EFD243"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q7"
FT                   /transl_table=1
FT                   /translation="MDGHQQSQKDPLEFARSESKNSPDSNWIVQKFGGTSVGKFALNII
FT                   DQVVLPSLLEHRVAIVCSARSSSTKAAGTTNRLLRAARDAEDALSQEYASLVEAVRLEH
FT                   IQVVDDQIQSKVLKSRLVSEINNECDKVLRVLEAAQTLGEISARCVDKVISTGEKLSCR
FT                   LMAAYIQDRGVDSQYVDLAEVIDFPISNQGLDQDFYNNLAAALGRKIRACENKVPVVTG
FT                   FFGTVPGGLLDQIGRGYTDLCAALVAVGIDAKELQVWKEVDGIFTADPRKVPTARLLPA
FT                   ITPAEAAELTFYGSEVIHPFTMEQVMRAKIPIRIKNVMNPRGDGTVIFPDSTFELEKTT
FT                   PGHDPRLFRTRSPSLVQRPKRPTAVTIKHKILVINVHSNKRSLSHGFFAGIFSVLDRWR
FT                   LSIDLISTSEVHVSMALHSEMPLLNGVGRDEYQVIDEDLKGALRDLQRYGTVDIIPEMA
FT                   ILSLVGKQMKNMIGVAGRMFSTLGENNVNIEMISQGASEINISCVIEERDADRALNIIH
FT                   TSMFTFLD"
FT   CDS_pept        555687..556187
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114598"
FT                   /orf_name="An17g02283"
FT                   /product="Putative uncharacterized protein "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAL00571.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EFD244"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q8"
FT                   /transl_table=1
FT                   /translation="MDHKNDSDPTCPFCPFSDPGISRVVEHVDVYHPEVDTQAGHSRRP
FT                   ANAPSTGTGECSGDYTECPHGCGEIVLNTELSAHLDLHFAETVALDEISSCQPELPVDM
FT                   ESAVSSHDAERQEWLEGGTPGLLPSEDRTLSSWSLIGGTKTPHNGRAKRLGVRKSSFIL
FT                   YPS"
FT   CDS_pept        join(556251..556682,556737..556768,556817..556971,
FT                   557033..557237,557305..557338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235067" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891697"
FT                   /orf_name="An17g02285"
FT                   /protein_id="CAL00572.1"
FT                   /db_xref="InterPro:IPR012462"
FT                   /db_xref="UniParc:UPI0000EFD245"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9Q9"
FT                   /transl_table=1
FT                   /translation="MPSWLRRMLERGSMSIFTNTIAVDGTLRRREAVENETRDVIPVLA
FT                   RLCEQDKSVQRAFFCSPKVHQISKIPKEGGFCGYRNIQMLITYMKETQLPGHERFPQEL
FT                   PTIFQLQDMIEDAWDNGFNSVGRVETGGIRGTRKYIGTPEAQALFSSLGIQCEANSIGA
FT                   SKEVRAHDALYMNVAAYFRESCALEEGHKVMQTNLPPIYFQHQGHSMTIIGFEIRDGGS
FT                   ANILVFDPMFRTPPAVKRLRGPQALTSDPARVLKVYRRGTAYLQKYKVFELLKLKYSAN
FT                   SSSK"
FT   CDS_pept        complement(559200..559472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891698"
FT                   /orf_name="An17g02287"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAL00573.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI0000EFD246"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9R0"
FT                   /transl_table=1
FT                   /translation="MASLEKLNFITGNKNKLAEVKAILGTVIDVENQAVDLPEIQGTIE
FT                   EIAREKCRRAAEVVSGISKAESAQLYHTDSPRSGRRPGVDGRYCA"
FT   CDS_pept        join(complement(564684..564858),complement(564518..564610),
FT                   complement(564278..564467),complement(560361..564222),
FT                   complement(560229..560302),complement(559958..560172),
FT                   complement(559796..559905))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891699"
FT                   /orf_name="An17g02290"
FT                   /product="Complex: MYO2 of S. cerevisiae belongs to the
FT                   actin-associated motorproteins"
FT                   /EC_number="3.6.4.1"
FT                   /function="ATP binding"
FT                   /function="actin filament binding"
FT                   /function="motor activity"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="CAL00574.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="GO:0051015"
FT                   /db_xref="HOGENOM:HBG717149"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="UniParc:UPI0000EFD27A"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9R1"
FT                   /transl_table=1
FT                   /translation="MAHNYEVGTRAWQPDPTEGWVASEVKEKLVDGDKVQLVFLIENGE
FT                   VRTRLFARLFRMEDNNPKLPPLMNPAMLEASEDLTNLSHLNEPAVLQAIKLRYAQKEIY
FT                   TYSGIVLIATNPFARVDSLYVPQMVQVYAGKHRASQAPHLFAIAEEAFADMLRDGKNQT
FT                   IVVSGESGAGKTVSAKYIMRYFATRESSDQPGKYTTSRADAISETEEQILATNPVMEAF
FT                   GNAKTTRNDNSSRFGKYIEIMFDDRTNIIGAKIRTYLLERSRLVFQPLKERNYHIFYQL
FT                   VAGATDPEKQELGLTSVEDFDYLNQGGTPTIDGVDDRAEFNATKKSLSTIGVPEGTQAE
FT                   IFRVLAALLHLGNVRITATRTDSSLSSSEPSLVRACQLLGIDANEFAKWIVKKQLITRG
FT                   EKITSNLTQQQATVVRDSVAKFIYSSLFDWLVDRINQGLATDSILNKFKSFIGVLDIYG
FT                   FEHFAKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVREQIDWTFIDFSDNQPCIDLI
FT                   EAKLGILSLLDEESRLPMGSDEQFVTKLHHNFAADKQKFYKKPRFGKSAFTICHYAVDV
FT                   TYESDGFIEKNRDTVPDEHLEILRGSSNDFVKEILDTAAAVREKDSASISSKPVAAPGR
FT                   KIGVAVNRKPTLGGIFKSSLIELMNTINSTDVHYIRCIKPNEAKESWKFEGPMVLSQLR
FT                   ACGVLETVRISTAGYPTRWTYEEFAIRYYMLCHSSQWTSEIRDMCHAILQKALGDGTQQ
FT                   KQDKYQLGLTKIFFRAGMLAFLENLRTSRLNGCAVMIQKNLRCKYYRRRYLEARASILT
FT                   TQALIRGFLARQRAAEIRQVKAATTIQRVWRGQKERRNYSRIRANFVLFQSVAKGFLCR
FT                   QNILDTIHGNAAKVIQRSFRSWRQLRAWRQYRRKVIIVQNLWRGKQARREYKKLREDAR
FT                   DLKQISYKLENKVVELTQYLESLKRENKSLNSQLENYETQVKSWRSRHNVLENRSKELQ
FT                   AEANQAGITAARLTAMEEEMNKLQQHHNDAQATIKRLQEEEKISRESIRTANQELEKLQ
FT                   QLNTDAENEKASLRQQIVDLEEQLELAKRVVPANGVNGDQQNGGPIQPPASGLINLVSS
FT                   KKPKPKRRSAGAERIDIDRFSGAYNPRPVSMAIPSSAMGRQHFSGNAFSPGLDSVEVEL
FT                   ENLLSEEDELNEEVTMGLIRNLKIPLPSSTPPPTEKEVLFPAYLINLVTSEMWNNGFVK
FT                   ESERFLANVMQSIQQEVMQHDGEDAINPGAFWLSNVHEMLSFVFLAEDWYEAQKTDNFE
FT                   YDRLLEIVKHDLESLEFNIYHTWMKVLKKKLYKMIVPAIIESQSLPGFVTSETNRFLGK
FT                   LLPSNNNPAYSMDNLLSLLNNVYKAMKAFYLEETIITQTVTELLRLVGVTAFNDLLMRR
FT                   NFLSWKRGLQINYNITRIEEWCKSHDMPEGTLQLEHLMQATKLLQLKKATLNDIEIIQD
FT                   ICWMLSPNQIQKLLNQYLVADYEQPINGEIMKAVASRVTEKSDVLLLTPVDMEDSGPYE
FT                   IAEPRVITALETYTPSWLQTPRLKRLAEIVSAQAMAQQERLEMTESGATMME"
FT   CDS_pept        join(complement(567530..567576),complement(567363..567442),
FT                   complement(566598..567311),complement(566201..566544),
FT                   complement(566091..566141))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891700"
FT                   /orf_name="An17g02300"
FT                   /product="Function: NAP-1 is involved in assembling
FT                   histones into an octamer"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAL00575.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG619916"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI0000EFD27B"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9R2"
FT                   /transl_table=1
FT                   /translation="MSEPIRNKKADFPVAPTPQNTPANNAPISSHAQQPGIASIKEESL
FT                   DHATAASLFARNPGLVSMIQGKLGSLVGRSSGYIESLPVSVRRRVAGLKGIQKEHAKLE
FT                   AQFQEEVLELEKKYFAKFTPLYQRRSTIVNGAAEPTDGEVEAGQGDEEDVDSKDEAEAT
FT                   KEEDQESQIAGIPEFWLSAMKNQISLAEMITERDEEALKHLVDIRMEYLDRPGFRLIFE
FT                   FSENAYFTNKTISKTYYYKEENGYGGDFIYDHAEGTKIDWKADKDLTVRIESKKQRNKN
FT                   TKQTRIVKITVPTESFFNFFSPPQPPTDDDDTVATDIEERLELDYQLGEDIKEKLIPRA
FT                   IDWFTGEALQFEELGDDMDADEYDEEDDEDEDEDDEDDDDERRSDRDVDDDSDEEDGAS
FT                   KPKKEAAECKQS"
FT   CDS_pept        join(568743..568831,568885..568924,568981..569496,
FT                   569550..569888,569939..570073,570122..570188,
FT                   570252..570383,570435..570784,570837..570982,
FT                   571034..571183,571270..571502,571565..571708,
FT                   571762..572094,572143..572231,572289..572423,
FT                   572510..572742,572802..572925,572980..573025,
FT                   573092..573242,573305..573453,573503..573789)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891701"
FT                   /orf_name="An17g02310"
FT                   /EC_number="3.6.3.8"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAL00576.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG735026"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000EFD27C"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9R3"
FT                   /transl_table=1
FT                   /translation="MERDVQPPLEARSPMFPIGTDRRRNSIRSSYSVVSDVEMARNEIY
FT                   DGPISESIPSSIVSFSHRRNRKDSTTSFTYFQEDQDHPDWPNEAAIDAESDVDNLSDIE
FT                   PNESIRSSKRPSFSRDSVQDPLLRRSLSASSHDYCHRGDQRVSQKVHIVSEDLTIVIAG
FT                   FSTSPTGLLLYYLSCLLSLGVFYLLFRWFPKYRVRLMGMPTPLQSCQWVVIEDQWNQLD
FT                   IHTVHTEVYGRPLSTVFSPNYEFYDEDNDPTISQLRYIDYRYLRLIYHPADDKFCLIGG
FT                   WKDPSWKNAKGMRAGLDADDRDSREQVFGKNLIDIQQKTAIQLLMDEAFHPFYIFQLAS
FT                   LVLWSLDQYYYYAVCIFLISVISISATIIETKATMNRLRDISLFECDIRVLRNGFWRSV
FT                   PSRELVPGDVYEFSDPSLNHVPCDCILLSGDCIVNESMLTGESVPVSKVPLTDDALKYL
FT                   NLSAPSIHPALARHFLFSGTKVIRARRPQGVDDDEAIALAVVVRTGFLTTKGALVRSML
FT                   FPKPSGFSFYRDSFRYISVMAIIAILGFVASFINFIRLGLSWHLIIVRALDLITIVVPP
FT                   ALPATLSIGTNFALSRLKAHKIYCISPQRVNVGGKLDVICFDKTGTLTEDGLDVLGVRI
FT                   VDHNRRFICMHTTLHTFAYQYNNTLYTMATCHSLRVVDGELLGDPLDVKMFQFTGWSFE
FT                   EGGSHTEEADSETILPSIARPPLSENHPSAYQRHKIEVELGILRTFEFVSHLRRASVIV
FT                   RQYGDTGASTFVKGAPESVKAICLPSSLPHDFDELLSNYTHKGYRVIACAAKYEPKLSW
FT                   MRVQKMARADAECDLEFLGFIIFENKLKPNTAETVAELNKAGIRNIMCTGDNILTAVSV
FT                   ARECGLISGDEQCFVPRFVQGHPPDNVSDDCLCWESVDNPALKLSPSTLMPSLDSTAVD
FT                   LSIPGNACSLGHYSLAISGEMFRWIVDFGSELLIKRVLVRGKVFARMSPDEKHELVEKL
FT                   QSLDYCCGFCGDGANDCGALKAADVGVSLSDAEASVAAPFTSRRFDISCVPTLIREGRG
FT                   ALVTSFCCFKYMSLYSAIQFSTVSFLYASGSNLGDFQFLYIDLCLILPIAIFMGWTKPN
FT                   PVLSRKRPTADLVSRKVLIPLLGQITICIVTQLIAFETVKSQPWFQPPQLDLEESNIEN
FT                   SENTVLFLLSCFQYILSSVVLSVGPPFRRPMSSNKPFLSMIIVDLMISCYMLFTPSKWL
FT                   KQVIQLTYLPESFAWWLLTLAVMSFLFSWLAEKDLFPRLAHLLGRVYTALRPDHPKKRR
FT                   QYKVLLEEMQG"
FT   CDS_pept        join(574946..575055,575106..575187,575244..575340,
FT                   575390..575544,575594..575621,575672..575885,
FT                   575936..576130,576201..576981)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114599"
FT                   /orf_name="An17g02320"
FT                   /product="Function: SGV1 is involved in pheromone
FT                   adaptation pathway and in cell cycle. "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAL00577.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000EFD27D"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9R4"
FT                   /transl_table=1
FT                   /translation="MVIVSLERDSNGNNRFHGCTSIRDFEFLGKLGEGTFGEVYKARSK
FT                   KDNTVVALKKILMHNERDGFPITALREIKLLKMLSHTNILHLKEMAVERSKGEGRKKPS
FT                   MYMVTPYMEHDLSGLLENPAVQFTEAQIKCYMLQLLEGLRYLHENRILHRDMKAANLLI
FT                   SNRGILQIADFGLARPYEEAPPQPGRGGGEARRDYTTLVVTRWYRPPELLLQLRRYTTA
FT                   IDMWGVGCVFGEMFKGKPILAGNSDLNQAQMIFSLVGSPTEETMPGWSSLPGCEGVKNF
FT                   GNRPGNLREVFKEQGPIAISLLSELLKLDWRKRINAIDALKHPYFSTPPLPARPGELPS
FT                   FEDSHELDRRRFRGQKAPMPPAPAGGGLGIGGPNGNRASGSGNRTGIDGRNSRLPNAAR
FT                   GTWNNGVPGVPSQRSVDNRNCEMHAAQSRTGGEDLSQGAWHKGGLPPRPPTSNHQTWAS
FT                   GSIGKLGRDRSHQARGRSEGNLDSYIPSYAGGGERHWERDPNWGYNTDRRDINNGDSAY
FT                   QPVRRDYSRENLSRRRSRSPGSREGGRDAARKFHRR"
FT   CDS_pept        join(complement(579059..579372),complement(578688..578995),
FT                   complement(578048..578637),complement(577949..577991),
FT                   complement(577836..577894),complement(577655..577783))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000136696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114600"
FT                   /orf_name="An17g02330"
FT                   /EC_number="1.1.1.95"
FT                   /function="NAD or NADH binding"
FT                   /function="amino acid binding"
FT                   /function="phosphoglycerate dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAL00578.1"
FT                   /db_xref="GO:0004617"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EFD27E"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9R5"
FT                   /transl_table=1
FT                   /translation="MATSARDINAREGSNLNPSQSLNFSTSPTASFQSAPSSHGGSAFG
FT                   SRTIPLANAKHLKPFATEDIKVLLLENVNQTGRDILTKQGYQVEFLKSSLPEDQLIEKI
FT                   RDVHVIGIRSKTKLSARVLKEARNLIVIGCFCIGTNQVDLQFAAEHGIAVFNSPFSNSR
FT                   SVAELVIAEIIALARQLGDRSNEMHNGTWNKVSNKCWEIRGKTLGIIGYGHIGAQLSVL
FT                   AEAMGMSVIFYDVVNLMALGTARQVPTLEILLSESDFITCHVPELPETRNMIGQRQFEQ
FT                   MKSGSYLINASRGSVVDIPALIHAMRSGKVAGAALDVYPNEPAGNGDYFNQSLNDWATD
FT                   LRGLKNLILTPHIGGSTEEAQRAIGVEVAEALVRYVNEGTTLGAVNLPEVALRSLTMDE
FT                   PDHARVIFIHQNVPGVLRKVNEILGDHNVDKQMTDSRGDVAYLMADISSVDNTTIKDLY
FT                   ERLESLGCTKSLSSISHYDFPD"
FT   CDS_pept        join(complement(581699..581831),complement(581564..581634),
FT                   complement(581299..581460),complement(580818..581239),
FT                   complement(580672..580762),complement(580253..580621),
FT                   complement(580021..580197))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810398"
FT                   /orf_name="An17g02340"
FT                   /EC_number="6.1.1.11"
FT                   /function="ATP binding"
FT                   /function="serine-tRNA ligase activity"
FT                   /biological_process="seryl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAL00579.1"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006434"
FT                   /db_xref="HOGENOM:HBG629391"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniParc:UPI0000EFD27F"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9R6"
FT                   /transl_table=1
FT                   /translation="MLDLADFISDRGGDPNKIKESQRKRYAPESVVDEVLSLYEEARRA
FT                   RYEVMQINSQLNALQKEIGKRKKNKEDANDLMEQKANLEKSKKDAEELAIQKEKQRDSK
FT                   IRTIGNIVHDSVPVSNNEDDNAVIRKWAPDNVKVEKRNCLSHHEVLTRLDGFDSERGVK
FT                   VVGHRGYCLTGYGLFLNLALINYGLEFLWGKGYKPNQPPQFMLKDMMAKTAQLEQFDEE
FT                   LYKVTESEDKSTDKYLIATSEQPLSALHDGEWLQDKDLPIKYAGYSTCYRKEAGAHGKD
FT                   AWGIFRVHQFEKIEQFVLTKPEDSWQAFDEMMATSEEFYRSLGLPYQVVAIVSGALNNA
FT                   ASKKYDLEAWFPFQGEYKELVSCSNCTDYQSRALEIRYGTKKATDVKKSYVHALNATLC
FT                   ATERTLCCVLENYQTDDGIIVPEPLRKYIPGAPEFIPYSKELPKDSTSNKNKAKQTTKA
FT                   TSGADETAKKLEGLQV"
FT   CDS_pept        join(complement(583083..583137),complement(582874..583013),
FT                   complement(582685..582813),complement(582392..582631))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891702"
FT                   /orf_name="An17g02350"
FT                   /product="Function: rheb binds"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAL00580.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015602"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI0000EFD280"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9R7"
FT                   /transl_table=1
FT                   /translation="MPSAPKQRKIAIVGSRSVGKSSLTVRFVEHHFVESYYPTIENTFS
FT                   RIIKYNGQDYATEIVDTAGQDEYSILNSKHFIGIHGYIIVYSVASRQSFDMVRVIRDKI
FT                   LNHLGADHVPLVLVGNKSDLKSEQRQVSLDEGRQLCEEFHCAFTEASARLDYNVAKAFD
FT                   LMIGEIEKSQNPSQPAGGNKCAVM"
FT   CDS_pept        join(complement(584067..586124),complement(583733..584014))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201267" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19810399"
FT                   /orf_name="An17g02360"
FT                   /product="Similarity to hypothetical protein CAD70983.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAL00581.1"
FT                   /db_xref="InterPro:IPR022771"
FT                   /db_xref="UniParc:UPI0000EFD281"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9R8"
FT                   /transl_table=1
FT                   /translation="MPQKDTARRALGKSSRSSAEASPGTRSQTPKVTTGPPTLFDKRSG
FT                   SAGRHLAQQPYTPSNRGPIQSERSRKKRRYMHPEQSRPALDQSDVHNSDDAASNIHEPI
FT                   YDCAADAVYKFNDIEGGSSSQNESDIERRGSDYPYTSATSVSRRLHIEEQQPISDSNTP
FT                   SQTSAEAGHDRRTVSARKRLVDMLGISVPSTETSSSDFDSVVAENIHSDNSRPSQETDN
FT                   PRANQSEHPDEVADHNSEKAIKAETPMLSRLRGSRITYARQRSFLGNTLSLTALEQRDT
FT                   SVPSPDPGDADLGHITNNDGNQNLVSDDEEIESRPVRSIHELRQAGDNARFRESVEVIF
FT                   EDIEDPYNSLSGKCSSFAQLCTKLLEHAFVRRFSEYGFNERLVKCIADDQDVLITSMAL
FT                   CAFRLICSNGLFSHTSLRSFWTIILRMSHKLLTMTDDITNMATEGITGLSKTVQRSFKK
FT                   TLPQISSVFFSGSPSPRLSPCLVTLSCIQFCLSTFLEKGDDIKPLPATLTEQIVELLIT
FT                   QRDNSASIASLESYELTRMSFLILESHSMLPGTSTSSYRNFSRLLFENHGKFLPYCQFD
FT                   RNKQIQMLYARVILNLTNNAPSLCEEFATPEMVSDFVELATTGLSGTSMDCNVDEDGPF
FT                   NAPILALGVLINLSEQSELSRAAFLNPASDSTSLLQLLLQHFSAGLTFVDQARSVSEVH
FT                   YNVVIGYLSIVLVTLCLNEEALNQIRESIRGEGLNLVLSTAEEFLKFHQKVEQDSQLFE
FT                   SSGERGGRSTTRLKDVLNQIRQKARL"
FT   CDS_pept        join(587806..587954,588025..588387,588429..588640)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891703"
FT                   /orf_name="An17g02370"
FT                   /product="Putative frameshift"
FT                   /EC_number="2.4.2.9"
FT                   /function="uracil phosphoribosyltransferase activity "
FT                   /protein_id="CAL00582.1"
FT                   /db_xref="GO:0004845"
FT                   /db_xref="UniParc:UPI0000EFD282"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9R9"
FT                   /transl_table=1
FT                   /translation="MSEATPSPAQGVGPIYRPDGEKPTATVSKDIFYENVHVLPQSPQL
FT                   IALLTMIRDRRTSRADFIFYSNRIIRLLVEEGLNHLPVVEQSVTTPVGRVYLGVRFEGK
FT                   ICGVSIMRAGEAMEQGLRDCCRSVRIGKILIQRDEETCKPKLFYEKLPGDIANRWVLLL
FT                   DPMFATGKGSATLAVEVLKAKGVPEDRILFLNLIASPSGVADFAERFPKLRVVTAFIDQ
FT                   GLDDKKWVSHVIKKEKIK"
FT   CDS_pept        join(complement(589468..589470),complement(589179..589317),
FT                   complement(588925..589118))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15891704"
FT                   /orf_name="An17g02380"
FT                   /product="Remark: ORF is identical to EST an_3047 of
FT                   Aspergillus niger"
FT                   /protein_id="CAL00583.1"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniParc:UPI0000EFD283"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9S0"
FT                   /transl_table=1
FT                   /translation="MREPLPTTFACLFCNHENSIVVKLDKKLGLGNLSCKVCGQRFQTG
FT                   INYLSAAVDVYSDWVDACDAVAKDTATKYEDSDPRVRRSNDFATSPSARDVGFEEADRN
FT                   DTYADEY"
FT   CDS_pept        join(590921..590934,591013..591097,591144..591169,
FT                   591296..591797,591860..592004)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18114601"
FT                   /gene_name="rps1"
FT                   /orf_name="An17g02390"
FT                   /product="40S ribosomal protein S1 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAL00584.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG402643"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="UniParc:UPI0000EFD284"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2R9S1"
FT                   /transl_table=1
FT                   /translation="MAVGKNKRLSKGKKGVKKRTVDPFTRKDEYSVKAPSTFQTRDVGK
FT                   TLVNRTSGLKNANDSLKGRIFEVSLADLQNDEDHAFRKVKLRVDEIQGKNCLTNFHGLD
FT                   FTTDKLRSLVRKWQSLIEANVTVKTTDDYLLRLFAIAFTKRRPNQIKKTTYARSSQIRA
FT                   IRKKMTEIMQREAASCSLAQLTTKLIPEVIGREIEKATQGIYPLQNVHIRKVKLLKSPK
FT                   FDLGALLNLHGESTTDDKGHKVEREFKEQVLESV"
FT   mat_peptide     join(590924..590934,591013..591097,591144..591169,
FT                   591296..591797,591860..592000)
FT   CDS_pept        join(593004..593042,593126..593205,593487..593496,
FT                   593554..593605,593741..593805)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15892647"
FT                   /orf_name="An17g02400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAL00585.1"
FT                   /db_xref="UniParc:UPI0000EFD285"
FT                   /db_xref="UniProtKB/TrEMBL:A2R9S2"
FT                   /transl_table=1
FT                   /translation="MPFAVSYYVEWTKLFAVVSDQRIENPALLIQSYCFQLTFVYLEEF
FT                   LVDLLKRFLDLDIFNKKYTTTQLNIIRINFNRYTLL"
XX
SQ   Sequence 594599 BP; 146081 A; 150200 C; 149248 G; 148070 T; 1000 other;
     gatctacgtc aagcattatt ttctttaagc gtccggggtt tgccactcct ttcgtttcta        60
     tccacgtaga tagaactggt ttggaatcta cttcgcctcc ttgatagaca ggttattaat       120
     tagcattatc aaactatctt gttagtagct cagacccact tcacccttcg tggctcaatg       180
     acagcctggc agtgatgcag aacgcgttgt attaccccgt ccgcgatcgg tctgctgatc       240
     ttgcatcagg aggggaacga agactgactg ccatcccttg gtgaacctga taggggcaac       300
     cacatccgat gcctagatcg gacccttcca ggccgacgct cgggtcagtc tgcgaatccg       360
     gggtagccta tctcaccggt agtcttggac aaggttccga ttgccgcttt gagtcgcggc       420
     ggagaagcag tcggcactag accgcttcga ggcaaggaat ccgtgcgtgc ttatcgaggc       480
     gtatcttatc ggtggtgcag cagtcgtgct gtacaatcat atcctcctct ggcaatgcgc       540
     tcgtgcagcc atgcgcttgc tgcttataag gtgggttgtc cccctctgtg tcgactatgg       600
     tttcacacag tctgtgtggt agcatcactt tacctcttcg ttacttgtcc taccgtacaa       660
     cccggccagg tcgccggttt attttccaag tgaggaaaac atatactctt acctctccca       720
     tactttctgc tgcacaccac ggacttcgtt gatacgcaat tccgcttgca ttacaccgct       780
     ccttcatcat ggttctcgag cgccttcaac agctgaccca ccaggtccaa gctacttctc       840
     ctcctcctca tcccctggat cccctctcga cagtagaaat tgacaccgct gtcgccctta       900
     tccgcaagga gtatggcaag gtcaacttca atgcggtcac tctgtatgag ccccgcaagg       960
     cggagatgat ggcatggctg gaaaacccgc agaaggctcc ccgtcccact cgtgctgcgg      1020
     atatcgttgc cattgcgcct ggcggcaagg tctacgatgg aatcgtcgac cttgataaca      1080
     aaaagatcct gagatgggaa cacacgcctg gcgtgcaacc cctgatcacc atggaagatt      1140
     tgcaggaggt tgagtcgatt gttcgccagg atcccaaggt cattgagcag tgcgcgatca      1200
     tcggcattcc taaggaggaa atgcacaagg tttactgcga tcgtaagttg ttgttgtacg      1260
     acttgttctg acttgcatgt tgctaattcg tttgcagctt ggacaatcgg atacgacgag      1320
     cgtttcggca atggtgttcg tctgcaacag gctcttatgt actaccgtcc ccacattgac      1380
     gattctcaat acacgtttcc tctggacttc tgccctatct tcaatgcgga aacgaagcag      1440
     gtcattcaca tcgatatccc gccggtccgg aggcccatca gcaaggcgcc tcccaacaac      1500
     taccaccccg cgtcgattga gaaagatggt ggttacagga cggatattaa gcccattcac      1560
     atcactcagc cagagggtgt ttctttcggt atcaacggac gtactatcga ctggcaaaag      1620
     tggaacatcc acgttggttt caactaccgt gagggtatcg tcttgaacaa cattaccttc      1680
     aatgacaatg gaaatgtccg ccccgtgttc taccgtctct ctctcgcaga gatggtcgtc      1740
     ccctacggaa atcctgagca ccctcatcag cgcaagcacg ctttcgacct gggagagtac      1800
     ggcggtggct acatgaccaa cagtctttcc ctcggctgcg actgcaaggg cgccatccac      1860
     tacatggatg ctgcctttgt caaccgtgcg ggtgccagca cgatcatcaa gaacgccatc      1920
     tgtatccacg aggaagacgc cggtatcctc ttcaagcaca ccgacttccg tgacgagtct      1980
     gtcattgtaa ctcgtggccg gaagctggtc atctcccaca tcttcactgc cgccaactac      2040
     gagtactgcg tctactggat cttccaccag gacggtacta tccagctcga catcaagctc      2100
     accggtattc tgaacaccta cgccatgaac cccggcgagg acaccaaggg ctggggtact      2160
     gaagtctacc ctggagtcaa cgcacacaac caccagcatc tgttctgtct gcgtgtggac      2220
     gctaatgtcg acggacccaa caacaccgtc ttccaagtcg acgcaactcg cagtgaagcg      2280
     gaggtgggaa gtgctgagaa cccgtacgga aacgcattct acgccaagaa gacaaagttc      2340
     actacccctc ttgaagcaat gtccgactat gacggcaaca catccagaac ctgggaaatt      2400
     gcaaacacca acaagctgaa cccccacagc aagaagcctg tctgctacaa gctcgtcagc      2460
     cgtgaagtgc ctcccttgct tccgaaggaa ggtagtttgg tctggaagcg ggctggattc      2520
     gctagacatg ccgtgcatgt cactaagtgt aagtcactgc cctgcatttt tgtacatgaa      2580
     ccatttcact aacttccgaa taaagactct gatgacgaaa ttcaccctgc cggtcgccac      2640
     gtaccccaaa cctcgggtga accatcccat ggtctgccag cctggattga agccgctggt      2700
     ccgaattcat ctatcgagaa cacggacgtc gtcctatggc atacgtttgg ccttacacac      2760
     ttccctgccc ctgaagacta tcctatcatg cctgctgagc cgatgaccct gcttcttcgt      2820
     ccgagacact tcttcgcgag gaaccctgcc ttggacgtcc ctcctagctt tgctcgcacg      2880
     ccgtctcaag ttgcggctgg cactggggcg tgctcttctt gcaagaagag tgatgggtct      2940
     agtgttcagg tctaattttg tctttcaagt gcgtttcctt tgttagagta ttctctatga      3000
     ttcccatcat ggtttctgtt ttagtagcat ttagttagct tttgaatagg attctcaaga      3060
     tcagtttgca ttggccacta agggattgtg gtgaagacct gtagattgct gccgtagtaa      3120
     tctgcttgat tgatgccctc tgcttctctt ggtttcttcg aacatggaaa tcctacaatc      3180
     tggcggtgca tattccaaat ccgtacagat cgcctttgcc cacatcatga tggcttccat      3240
     gtcacatttt accaaactcc cttttattac cacactgcac gtgaattcat taataactca      3300
     tcccgtgaag ccttagtcac ttcacaccct tgcaatagtg acgcaataag aatcaacaga      3360
     taccgggtgt tgattcacac tggtgggtga tttaatggaa atttccgaat cacatattct      3420
     gctgcatgcg cagacatctt cactctcttc attagttccc tttccccaat tacccggaat      3480
     tccttttggc tatatcctca gaagctaatt ggtctatggc gagataccag tgcatgcttc      3540
     tcttgtctct cagccataga aatgcatcgc ctgatgaaat tatgagcact cactacgact      3600
     tctgattcac gattccctac ccttagtgat tccatacgtg tcgcgtattg tatgaatatt      3660
     gttcttcacc aactcgcttc acactcgtgg atggtaatta gatcagctga tacccggtct      3720
     gcagctatta taaaagcccg cttcgccccc ttctcctttc ttttcctcct cacccctctc      3780
     ttcctcacac gcccattggc atcttcaaag tatatactct tctttattat atctatatct      3840
     catggcacca tcgacaaaag atacatccta acaccatctt cctcttgata taatgagcgt      3900
     cctacttttc ctcttcatcg ttggacgtct atactatgtg ctggaatggt cctcttctca      3960
     tctcctcgaa tggctctggt aactgccata tgagtcacca tatcccctcg tatcccgtga      4020
     agagacctat atccattctt aaatcatcag cgatatctca gagctgaaga tattgtctgt      4080
     cgtctcattt catatcactc tccctagctt cctcacacca gcataactac gatgctcaac      4140
     ttccattagc gtcgaggtta gcacatcatc gatttacttg gtgatagtcg atacgtcctt      4200
     caatgacacc ttcatgatgc ccctgtcgaa aggaatgtac tatttcgtcg acaacatcgt      4260
     tgaagtgact gccgatatga tgaatgctgc atttcagtcg gtcgatatcc ttgaatacta      4320
     tggcttgcca gatggagaga acgaatatat acccatcgat cggcgtggtc atggtgcgat      4380
     cgcctggtgc tgcagaacgt gctatgctgg tatctttatg cttcggttat acgatagggt      4440
     tggcttgatt gagcatccct ccctgaagca ctcagtactc tcgagtcacg aactattgca      4500
     acgattcggt cagtttaggc gaatggtcac catacatata ggtctcagac gaacactgca      4560
     ttcgaaagtt tgcttaacac gagctgcgga aactgaggat ttactcttct gtgcatctga      4620
     aactctacgg tctacggagg tcaaaagcct taccagggac aagacacaat gcatctttta      4680
     cttcagtgcc tctataccgc tagggaatat cctcacgaat agcctagcac aagaccattt      4740
     tgacaggtcc tatctctcta cgtctttagt aatatggcca ctcttccgat gtaccttcat      4800
     tatgctcaat acgcatgatt ggtctgctag ccaacaccgc tgctgttata attgcacctt      4860
     ggtgctccga caaaccgtca tactatcggt tcttcgcgga aatcttcaat atgttcatgg      4920
     gtctagacta accaagagat gcacagtgag ctcagcctat gttgccgcca tctacgccac      4980
     taagatcttt gagtcatctt tagcatcact ccagtcaaat cgtgaaacac atgggcaaac      5040
     ctcctataaa actacaccca cgaactttcc aattgtgcag tgcgataggc tacctgacag      5100
     cataacattc cgtcgatacc aagacgaagg gaccatgggt tctggagaga tttagtccac      5160
     attgtccgat acatcctcga gcatacatcg tttcccacat gggcctcttc aaatttatct      5220
     tatgacattc ttccctcatt tggcaaagca tctgatccag ctaggccatt attgtggcta      5280
     gccactccac cggaatgttt gttgcacctt acggcttgag agcgtaatgc tcttgaggaa      5340
     tctcggactc aacgtccaga gccatcaaag ccgaatatgg gtatccgaga ctgcagagac      5400
     catcagcatg tgccgaaagg ttcctggctg cggccaggga agaaaactca ttctttgaag      5460
     agctcattat ctggttctgg ttccagggca gaaaagtact atgaagtgcg tttgttcgaa      5520
     tcaaacaaag attgcttcat tattcacaac aatgaatcaa ctaccgccgg cttggtggta      5580
     gatgtctccg ggagcacatc ctggcgtcag cttgatgagt agaactagcg tttccgttag      5640
     ttactttctc tatgcacact gcaactagcg ctaatcggtg gttctatgtc ttgttccact      5700
     gtgttcctta ttctctcgat atagacaaga cgatattcta tcctgcctca tgacttccat      5760
     tccgattcag gagccgcgaa tctggaaacg tcacacttaa gttgtctgtc ctcacgatcg      5820
     agttcagctt acgcgcgtca gtctgtatcc aatgtcatgt tgcaggtatg aatgagcaag      5880
     acagtgtacg atctggcgag tgatgctgta tccatccccg ctggatcttg atgatgtcta      5940
     ctgaccctta taagacgtct aagaggtatt ctgcgagacc aaacaccgag gacaattatg      6000
     ctatcaagtc aagacaagcg acgccagaga gaagggaaag aggtcatatc acccacatct      6060
     cgctacctca cctatgaatg gagctgctct aggtttaaga acggccaggc cttcgttcag      6120
     tcaaggcaag atgttgtgca gcacatccaa ccacccccaa ccaataacac tgaaatccac      6180
     ccaacccaga atttctggtt cttgtgccaa aattcattat gtgagaaaga ggtttcgttc      6240
     tcaacctgcc atatccttcg tctaaatcgt tcacgtcatc ccctccagta ctgcatcttg      6300
     atctggactg tgcctggtct cgacgcattc ggcctggtcg gagagtatat gatttccctg      6360
     agacggcgtc gttcgatgcc tacgtcttcg ggcgaacgaa ggaatggggg catggagcgt      6420
     aatatgtgct cggaagctcg ttcggtcaag cagctcaatg gaactgcttt cattcgccca      6480
     acaaacacgt tatgaaccag tgtgctgcct acctgctcca ctgccagtga tttatctgtg      6540
     tcgtcccctt cttataaccc ttctcgttat ttggcagggg ccggccgtct ggaggctttg      6600
     gcggatctgg tgcgcccagg taaccaaagg cgccatcctc gctgacgctg tgggcctcgg      6660
     gaagacaatc gaattcattg cattcattct gacagtaagt gagccctgca aggaatcctg      6720
     gtattaggca aatacagcta acgcctagca ggtggcccgg gacaagcgca agaagctgca      6780
     agcaggcgag aaattcacta ccaagcctac tttgattgtg gttcctccac acctgctgga      6840
     ccagtggtca tctgaattgc gcaagctaag caataaacta gacgtttgtc tatttcggtg      6900
     ataatcggac acagacggga agctccctct atgtcaagaa taagttgact aaaaagcatc      6960
     cgatgtttca gccagatttc gatggcagat attcaatggt acttactacc tacaatactc      7020
     ttgagaagcg ccatggtctc tctgcagtct ctgagtggca caagaacaaa tactcggaga      7080
     agtataagcc gactgagtcc atccgatccg actttccgca cagtcttggt ggatgctttg      7140
     acctcgtcat atgcgacgag gcccattatc tgaggaacag aacttcaggt aatactgctg      7200
     ggctttctga attgcatatt gtttacgacc aatgatgttg tcgctgttgc tactttctct      7260
     caactggtat atctctggct ggcgctccat catgctcggc ttgccaggga atattgctgt      7320
     tgagcaaatg cgtgaccatt ctaaacttaa aatggcgtct gatgacatcg accagataat      7380
     gcctctggat accacagttc tggacattcg atgtctaaag catcttcgac cacagacaag      7440
     aagcaccgcc tccgagaata gctggaaatg gttcgtaaat gtaaagggat caccaaaatg      7500
     caccactaca tatcgctgat gctgattcta catgcagaca atgtcgttcc gcaaaaagtc      7560
     cagtatcggt taataccatc atatacaaag cgcaatctga gagagtcaag gagaatagta      7620
     tcatcctttt acgcagatga aagcgaagct ggccaaatgc aaccgcctat gatcgaaaca      7680
     gatggagatg gatggatccg tcttttcgtt tgcatcggac aatctggaaa ggctagaatg      7740
     cctttggccc tgcggaagaa gattccgaca ggcataagcg atcgaaatcg acgggactga      7800
     gatagttctt ctaagacctg gaaagctgat gatgttgcta tcggtccaca aacaatcaca      7860
     tcctgcttca tcaatctacc aactctattg agagacgtca ctatatccac cacatccacc      7920
     aatattccag aagtattgtg gccagctagt cacagccgcg ggccaactga gtcatgagta      7980
     tgtcaagata ctttagatgg tacttgttct tctccactta ttcagcctag gaaagctatt      8040
     tctggtaaat gcagcctttg aatgccagcg taccttcagc tggtgcgtcg acgcaaggca      8100
     ggctgtatga catttaccat ttcattttcg cgttatgatt ttccaaaggc atccttgcta      8160
     actgtcaaag ataactcagt ccgttatggc tacagcgggt tttctgcgcg cactgatggt      8220
     ttttggctct ctggaagtgt caaatcttgc gtcggctggt cttcacggcg acccgctttt      8280
     gttcagggtg cgcggtagct ggtgaaggct atgggtgctg ccttggctat tatatatcgt      8340
     actttcgaaa acccgttcga atacgtccat cgcttcacat cattgcttat cctactgatc      8400
     gagcaaggcg tgattggaac cataattagc atggtcaaag gctgaattgg ggaagatcca      8460
     gcggttcaga gtgctctgtg ttgaccagtt tcggaacttg atcttgacat cccgtcaagc      8520
     aaatgattcc gaaaacgcag tggtgagaca atgcttttgt tcttatactt gggtgatctc      8580
     atctgcggtt aacccagtac acaacacttc catactgatg ttcgatgggg ctgcccactc      8640
     ttcattgcgg caagggatca tgtatgaaga aataccgttc cttcaagact tcaacgtgac      8700
     tctggtggtc cacatcatct tcacgggcca cacagactgc caagcgatat tccggcaaaa      8760
     cctcgaaaag accttacatt gtcctccaac agtaaggttt gaagccgagc tactgtgggc      8820
     gtcttagctt ccccgagtac gcaagtataa gcaaatgcgg caccttatat ttccattgtt      8880
     ccgttcagaa ctggataagc tgcagtttca tatatgactg ttctagtcca tcagaccagc      8940
     gtaagctggc tggtgagcag cgcttgagtg aatttctcct agttggatgt ttacttcctg      9000
     gaaatattcc gaaaatgtac ttgctctcgt ccatcttcgc actatatttc aagcagtgtt      9060
     aagcagagag tgtattctga tttacctccg tcacgaaaga ataccatatt ccttgggctg      9120
     agtgcatgaa gaatccggga tgaaacgaca caccacaagt ccccaaactc cccaaagaca      9180
     gaccgaggat aacgacatcg gattaacaaa ctttgccaaa ataattggag cttataatac      9240
     agttggttgg atcgactatc acaatctcaa acctgaactg ggcagagcgc catacaaata      9300
     tgccgctttc gacgttggca ttgtcatttg cactgcgttc tacgcttgaa taacggtata      9360
     aacgtcagct ggtgtctgac ctcatacagc gttgaatcaa gcgctctgct gcatttcatg      9420
     cttacgaaga ctttctcagt caccgggctg ttcatttcaa tatgaccttc ttgcttctgc      9480
     tcatcgacct ctcatcaaca aagtcgcttc tagacaacgc aacagataca ctacatgaag      9540
     gagctcagat tggcaatacc ttgcagtccc atccggtcat tttctgtctg tttatgatat      9600
     aatcaactgc tttgctcttc cacacagcac atacggtgcg caattaccgg tcgaacaacc      9660
     tgccctataa aagtcatata ccctattgtc catgaaccgg accatctcat aaatgactag      9720
     aaggcaccca gagccttgtt gttctatata tacactgcac tttaccctca tcttgtgctc      9780
     tctcgaagaa ccgtcgaggc atgatgtcat cgtctgaaca ttttaggtaa agcttagcac      9840
     tgatgcctta gacttcgacc ccgaccagct tcacaggcgg ttctctggtc ttcctggaac      9900
     ctttggagtc atctctctat aatgcagacc gttggccact tggtatcctc gcaagaatcg      9960
     gcctcttcga cttctttgtc tttcccggcg gatcccttca tggcttatgc tccaaacagc     10020
     ttgaaacgcg cagctgattt ggcaaacccc acgaacaagg cagcgaactg cattatttgc     10080
     tgctctggcc cacttttggc ggtgccggca agacggtttt gaagagcagt aagtccagga     10140
     agaacgcacg caacattttg attcttgcct accagcttcc ccgtctgtcg tttctctcag     10200
     gtgcctacta tctttaaatc ttcagactat gaagaactcg gtctccatct atcgcccaag     10260
     gttgcactat caatgctcct tacgttctgt actgagagct gctctttggc gcgcggaact     10320
     ggatgcactg aattctccgc tactgaaaag gcatcgacgt gatacgaata tggattctga     10380
     taccgataac tctgatgtcg catggttgcg tctccgcccg gcatgcttgg tggcgtggaa     10440
     cagtaacaga ctatctcatc cagcttataa atccgaaagt aatccagctt caagaccatg     10500
     aagcaacaaa gaccgcactg atcgcagttt gtgatatact ggcttctttg ctgagctcaa     10560
     ggaaggcgaa gacggctggg atggagaatt gagcattgtc aaggtgagct actacgtatc     10620
     ggccagaagt gggttagtcc gtccattcta tggccacgac tcactcctcc ggttgaacct     10680
     tggtgtcttt ctgaagggca cttggtctaa ggaattggcc tcagactgat cggagcaccg     10740
     gcttagctgc gactaatggt cctattgtac aatgacaata ccattttatg atatggttga     10800
     tggatagtga tatattataa gaatattgtc gataacatat tgtgtcgctt tatcggtgca     10860
     cactcatctc agagccaacc tatcgcaaca cggccgaaat gacgatatag ggcacggggt     10920
     aactcgcaca ttgctcatca tcgtaccaca aatcatgggg caatgggcta aaggcccacc     10980
     tacttatact ttggaaacaa tcgcagcaga gctggttttt gtatgcacct ggttagcaac     11040
     ttgagatgct atggaaacaa gatatctcct gcttcaaacc cgctattagt gtcgtgtggt     11100
     tttactgcct ggatcctagt aacactggaa ctgccccagt cgtcaagaac ccgtggagcg     11160
     atcatgctca aagcatccga gcagtgatgt tcgaattgac attgtcaagt actactgctg     11220
     tgcctctaac cccggagtat gattgttcga catacttgtt tagctgaact gtacttgatt     11280
     cagcagcaat tgctctctct tcgtgcagcc ttgcatcttc tcatcaacca tcactttttg     11340
     cgcgtcttta ctcctcccgt ggtctcttca tgtgtggacc ttaccccttt cactctcgct     11400
     tgcatcatgc ctcgcaattg ccatcatcca gcgactcttc cgggcatatg ccactctggg     11460
     cgatgctctc ttctatcgac tcaaaggagc tcgtcagcca gatctagctt actaacagca     11520
     ttacttttcg gtgtagatga gcgatctgag gggtccgagc attgttacta cgtggtcggt     11580
     agtcatccag caggatgttg ttcatctgcg agtactgctt gcggggtgcc acatttttgt     11640
     gatatatcgc cccaacctca aggctctaac gcgttattgt ttcttcatta aactggcact     11700
     gcctgctttt gccggcattc tactcgattt agacatctac tctccaatcc ttcgtcgttc     11760
     cagttatccc catgtcaccc tctgctataa ggatgactgg ggacggccat acaaaccctc     11820
     atttacagga acatcaacgc agatgccacg tcttcatacc atcaccaccg tttttttcaa     11880
     tgacctccgg tactcttgaa ggtttaaagc tactatttgc tccaaacata gaaagtgcgg     11940
     tgactactat ggcctgtcaa tactgtttac aaaacaaaag cattcagtga ccagggatgg     12000
     gcctggttac ctctcatatg ttcccctcag agatggttat ctccgacgct ggaagcgggg     12060
     aataagatca gagataacaa ctctatgtgc actttcggta gaagccaagc cgttcctttg     12120
     gaacaaaggt gagctgagaa ggcacaatct gaatccagcc cttgcacttt atcggcatgg     12180
     agagagttat cgcgccatat attctctgtc cctagcggcc attcagcaac tggatcctag     12240
     ttggaagaag ttcttgaagc caagactgtg ataaagaaag agcgaacaaa aggcattcat     12300
     ggtcaccaga tgggggttac aagcatattg ctctcgtgac tgggactgtc aacttaaata     12360
     aaagccgatt tcgaatatga attttgccca gaacttcact gagaatgcgg ggcatgctgc     12420
     ccatcctccg cgatcaagtt gacctgaagg aagagaatga gactgtgtgg atgtctgttc     12480
     ctggcaaaga gctatgcatc aacccagcat tatgagaagc tcgacttggc ggcgccatta     12540
     tatatcctct atatggctac gtgccgggtt ccgcgtcctg ttaaccgcca cacccttcta     12600
     taatgatgta cgcgattttc tgggatacat cggacttctc ttgccctcaa atcccgatgt     12660
     aaaggcaacg ttcaccagca gccgtgtacg ccagattgtt gaggcccctc ccgggacaga     12720
     ggtcgagcgg ttgctctgca tccgggagtt tgtcaccaag cacatcctta gtaaggaggt     12780
     acatcaccgt tcagcgactt ctgccggaga ggatatagta ctctcaaacc tcgaatggtt     12840
     caagcaagcc gcgaactagt gccagcaatc gaagcacgcc tgagtaatgg ccgctcaatg     12900
     catgtcgtcg tccgtcccca ttcgttcaat cagttgagag ctggaatgaa gtctgtgaca     12960
     cagagattca acgccttcta tactatgcgg gtaaacagct accatcacat gcagtaccag     13020
     ccttgctcat gtcagtagac agatgcatca ctgctcgaca agatatatct cctttggtct     13080
     agttaatagc tgtcagtgaa cttaagcgaa actgacttct acgcacccag aattagaggg     13140
     taacccagac acttgctaca ttacgagtcg atgatgagaa catcgcagtg tccatccaat     13200
     ggaagagaca gccctgtgca gacgaatacc caacatgcga gcttcgcctt gggtatgcga     13260
     agctatcccc agacgggctg ctcacgaccc gcgaatgcga ttggagggga aaagctctct     13320
     cgctggagga catcgttgag ctggttgttg gagatgagca cgctggttca caacgggcga     13380
     taagaaaggc ggtgctggac cagttcatgc agaagctgta acagttccga tagaatatgc     13440
     gggctgccgc gaacaagggc gcccgtctcg tcgaggccat ccagttcatg gaggatatca     13500
     agggatggga caccgcggtg gctggagtat gcaccatcgc agaacaggcc cttcgcggca     13560
     agccaaactc catagaagag ttcaacggta tgcccaggag ctctaggagg gagtacacca     13620
     ggaaagcagg cgaattacat tccaaggtat ccgcgataac cgaacggaat tggatggcga     13680
     ttggcgcgca tctcagcgca gaattgatca ccaaactcac cttctccaag aaggtcaagg     13740
     ccttcgctga gttccccgag gcagagcagg gtacgaccat ccgccgactg aatcagaaag     13800
     tatacaaacg atgcgctgca ccgcctggga taggtcggaa tcgagatccc gtgagcacaa     13860
     tgcagctgtg agcattccca tctatgaagc aactatatat ggagtttcaa tggatgatga     13920
     agatccagac caggaatcta ctgagattcc agaacaaaag gaatgcacga cggcaaggtg     13980
     ctccgttggc agctagtagc tgtcacgggt tggtggagat ccttctgcgg tgcctcatgc     14040
     tggacgttat gttatttgac tgtcgaactc gggaaaacct gggaaactat ctccttttta     14100
     ctccataaga gtatatatgg ttgacggttt atgtcctgaa ggatctaaag gtcaagtcaa     14160
     tattcatcat gctcagtcct gagaagccga ggccggaatg aaacccgcag attaaggcct     14220
     gacacaatgt tcaaccgacg ccgacgcgat gttccattct tcaagtcact cgctggcgcc     14280
     catgaccttc aggtcatgga gatgggcgca agaggctctg ggattgtctg ggcctctcaa     14340
     agatcctaaa ttcctccata ctaatggccc gtgatgaaag aaaaccggga tccgggtctg     14400
     cttggacagt gagggagccg aaaaccaagt ttggtctact gatgactgcc actattctac     14460
     ttcgcaaccg cggaacctca gctcttctga ggtgtctctg cctctcaatt tccattcaga     14520
     atgactcgag gggagcaact aatggtggaa gggtttgggg tttatctatt cattgatgtt     14580
     tatgatatcc aactggcgct ctatgcgacg ctgtgcagtg atgacaatgg tgtttaccga     14640
     gtatttccag tactactggt gcttgccttt actcgagtag aaagaattga aactactcct     14700
     gccaggggcg agtagttctg tctcctgacc cgaaactcta ggaagtgata ccagacctgc     14760
     agccgaacaa aaattatacg caatcatggg ggagactcta tcgaccatca acaccgacgt     14820
     gagaaaaggg agctcacatc cgagtatggc acctctatac taccaggagc cgcatcactt     14880
     ccgctatatt ccaatggggg cctaatactt ataagtaccg tctattagct actagtacta     14940
     cggagattta tatcatcgac ctctataact caatgaacat catactaccc aaactactaa     15000
     aactaaaatc cttcccaaga atcacaaatt tataaccaac tatacaccag tatatagaca     15060
     agacactctt aatgcaacca cctcatacta atccaaacca acaataccag cacccacaac     15120
     ccaaccctcc agtagccaaa cgaaccccca acgaaccatg acgcaaacgc aaaaccctca     15180
     cctcccgccc cactccaccc aactggaacc gtccccactc gaaccacacc ataaaaacct     15240
     ttcagtccaa tataatctac tctgtaccac agatttccaa caaagtccga tgtggtgtaa     15300
     tggctaacat cgctgtctct cacacagcag ctcggggttc gattccccgc atcggagttt     15360
     cttttttcat tcatcatttt ttcatacttt gtttttgcgt cactgttttg cttttggttg     15420
     tgagggttga tcgtcaccgt gtttcatatt ttttattttt ttggagtttc agccttactg     15480
     ttactgtgta ggtgctaggc tgtttttggg atagctttgg agggaatttg tttgggtcat     15540
     agcgctgatc acatagcagc ttctttctat attatgaaga tacgtagtag gattgggagg     15600
     atagaacgca atcaatgcat gatgatattc atacaaccat aacgccatta ggaaatataa     15660
     taatgaagta ataatgtacg ccagataatc gaatcccagc tcgattcaca tccttctcct     15720
     aacacatatc cacaggcatc ctttcatcca acatatcgtc ctacaactcc gactcaagca     15780
     ctcccactac tcctcttcaa cccctcctcc acctcaccca gcaaccccaa aagctccttt     15840
     cccccctcac taaccctccc ctcaatctcc aatcccttct ccgcgaaccc cttggcctcc     15900
     tcccatctgc ccatctccac caagcacctc ccacccctcc accaagcctt cacattcgcc     15960
     acgggcttac tctcaacact acatctagca tcgaccaacc cctccggcca cgcgcgctgg     16020
     ctcatccacg cctgcgcccg attcgcatac aaccccgcca actcgtccct ggccagcgtg     16080
     accggttccc acccggggcg gcccaacgcc atatcgatgg cgtatgtgta caggcgagcc     16140
     gcctcagcgt ggttcgattt gcggtatgcg gtgttggcgc tgtcgcggag tttggtgatt     16200
     tgggcgctgc gcttggggtt gatgggtagt gggggagggg ggatgttggg cgggtcgagg     16260
     gaaattaggg agcggtggag tgcattgaga tgtgtgagtt cggtggttat tgtgctggtg     16320
     ggcgtgggga ggggcgtggt ggtggtgttg ctgagggaaa tggctttgct ggttgggtcg     16380
     aggtggaggg ggtattgggt gaagaggtcg atggaggcca ttttgaattc ttctatgtgt     16440
     ggtaatttgt ggggttgatg gtgttgggta tcgttgtcgt ggtcgtggtt gtggtcgtgg     16500
     ttgtgtgaag atcttgtata gctagatgct agctagctag gtagatattg tgtgtagttt     16560
     caggtttcgg tgtgacccag aatatggtct gtgcggcgtt gttagtggtt tcgattatat     16620
     tgtaaggggt ccttgactca cgttcgagaa taggtattgt taggaacacg cggggacgac     16680
     ctgttggatt gattgattgg caacagacgt atgggagatg acagactgta ggaaagaagc     16740
     aaggctggac gcaagttgtc cagtcctgcg ataagtccgg gcggtggcag aattgccggc     16800
     acaatggttg gtggcggtca gcaaccggtt aagtattttg cagactgcag ccatatcagc     16860
     tacgcttttg atgaagttca tattcatttg tcttgtaaag tgttaacatg tctctgattg     16920
     attaaaagat cgctcaagtc cagctctagt gggacatata taggcctctc gcataacccc     16980
     tctggaatcc gtacatgctg taacctagtt ctatggtata ctttctacga ttgttagaat     17040
     tggacaatag tgccatactg tgcaccagtg tattgatata caaaagactt agaaagtcta     17100
     tgtgttcatc gctatagcag caaatgttcc tatatctcat aatatagtgg acctgactcc     17160
     caccagcagc gcttctatag aatgcacttt atgtccgcca ttataggaaa agcgtcgatt     17220
     atagacccac cagaaagcaa acaccagcca accaggacaa gagaaaagca agcaattcaa     17280
     ataaatactt acttcttata cagtcagtct ataacgaaca tcagccagta gacctcgata     17340
     gtatggtaga taattatacc aaaagcgtag aatttgttgt gcattggaga gcaatataat     17400
     taggcagagg cagtatcaag attccatgct cgcaccacat gccctcaacg actctaacca     17460
     tgccttctcc gcaccgtcga gcaatgcggc aaacttttta cattgaataa ataattgtaa     17520
     cggaactact tatcagggta gataacctgt cgattaggca aggaaatgcg attggagaat     17580
     cttaggcgca acttgtatgt ccattcatta cgagactaaa gcttggagaa tcttaataca     17640
     tggagggggg ctgcaggata tctatcagtt ccaccctctg ctcggccaca agttccgtgg     17700
     cttagattgg tcgctctagt tatttaaagc tagttcatgc cctttaataa tcttgtctaa     17760
     tcgcacttct agtgaagatg gtgggctctg cgtacgtgct cgaaggagct ttttcacagt     17820
     agatgcttgc ttttccagct gcctagttgt atagggtgtt ttaggtgctg aattagttga     17880
     tcaactgcct ggtggtgtag gggtctttag tgaatattca actcactaag tatcctatct     17940
     ggatctaatg gaattagacc agcacctgca aagctaatct gaacagtttt cgcattaaaa     18000
     gcaatcgcgt gagcttgggg aaaggcctta agaaagccaa gcttgacata atgattaagg     18060
     cctgcccgta tattctctgc tattaagtat ccatgagcat ctttcagaga cttaaaacag     18120
     cccatatcta aaggctgcag tttatgagaa gaatgagcag gcatacagat aggaataata     18180
     tctttctcac tgcatatctg atcaaaatga ggtgtgagat ggctgccatg gccatcaaga     18240
     ataagtagac agtatttccc agtcgtacgg ctaatagtag caggaataaa gagattctta     18300
     agccagcgaa ggcctatctt atcagtagtc catccattag gactaacttc aattctccaa     18360
     tcacgcgata tctttgaatc ttgataccag ccctcaatat ggacttttcc tttgaagata     18420
     atacatggag gaagtgccca tccagtagag ttgatacact caatagaagt aacccattcc     18480
     ggattgcctg ggtacaagag aggcctttcc ataataatca gctctagtaa ctagttaggt     18540
     aactagatat tcgattagtc agccatcgcc ataacgtcat acaatttttt accgatttta     18600
     tgattctatc tatatgacaa tttttcttat ttttgctatt gatatacgtg gccaaaattc     18660
     tcagtgatta gtatatagtc gcctagtttg ctctagttat ccaggaattc agacgctcat     18720
     gcattaatat ctttggccat agaattacta gtgtattccg aatactattt acgttgacat     18780
     cttggaaagt ttttctgtat tagggcctca ccgaagaagg gttgtgctta cctatatacc     18840
     aaggagcatt acaggttgat gtcaagcaaa atgagattgg tctaagcagc tgcagccatg     18900
     caatctaagg tctagtccag gcgccaatcc aggttccaga cggtctaaga tacaaagtat     18960
     gtttctgctt ggagtggcat ccccagtgaa ccatgggcag caacgttgat tcctcacaca     19020
     gtggcctgtt tgtccgactg aagcttatca gtttgctctg tacaatgcat atcgtcatct     19080
     tcctgcgttg ggcgagtatt gacccatgga attccgctgg atagaatgaa tgctagagcg     19140
     ctaccagcta ttggaagata ctagtcgagt cagcatcgcc agcttaacac ggaggtgaca     19200
     agattagaag attaactcac aaagatagtt gtgatggctt tattgtatgc aatgataata     19260
     tcggctaaac ggtccggaaa tgcttgtaca gcaacttccc gcacccttag ggttccagta     19320
     ttaagaagca tctcgatctg cttataatcc aacgatgcct gatcttgtag ctgtcttttc     19380
     aattcgttct gaaagatagc gcctcctatg ctttgcatca ccgcacttcc aaagtattgc     19440
     gtgaagagaa cagtcgctat cccgactgga acgtagtgag gactgtcctt caatacaagc     19500
     tgaactgtaa gtaaaggaat ctgggctgca aatccacaac ccaggccctg gaagatctga     19560
     taaccaatcc acgatgcgga cgttgaggat acagtaaaag ttgtgtaaag cccgctcgca     19620
     atgcagagaa aggcagaacc aattaagagc cacggattat aatatctgag gtgtttggct     19680
     atagcaatac agcgtcagta tgaatttttg tgaaatagtg agaatatatc ctgtctttac     19740
     ctagtattcc agagacaagg gatccaaaaa cctgagtaca aaccgaaggc agaagcataa     19800
     ctccactgcg aatggggctt gcagacttaa caatttgaaa ccattccggt agatagtaga     19860
     ccggaatgac gaatgacccc aaaaacaaaa aggcaaatgc aatactaagc attgtcgatc     19920
     tgccccgcag aagcacgatt gggatcatag cttgatcccc catgtaacat tcccagaaga     19980
     taaagattgc tatcatcact gcaaagccga tgaagagtcc gatcacggtc gctgagtccc     20040
     agggatattc gccacctccc cactgtaagg ccaacatcac cataatgatg gaggggataa     20100
     agagagcaca tccgatcaaa tcgagctgtt ttaggaagga cacacgttgg gccccggtgt     20160
     tttgaggcgg atggaaaaat aaaagcaacg tcaccacagt cactgctcct gctggaagat     20220
     tgattagaaa gcaccacctc caagtatatt cagccaaagc acctccgata attggggcga     20280
     caacagttcc cagggcataa agagaagtta tcagcccagt gaacagtgga cgctgctgag     20340
     gggttgttat caatgcaatg actgagagac cacccgacac taccccagag cctccagcac     20400
     cagcgactgc tcttccaatt atgaacattt cggaactgtt tgccacaccg caaatcagag     20460
     atcctagaag gaatatgccg tagaacccga ggtatgtcca tcgcagcgac agcaatgacg     20520
     agagcttgcc actgataggt tgaagagcgc acatcgtgag cggataggta gctccatacc     20580
     agccgatatc tgttgtagca tggaggtggg ttgatattga aggaatagcc tttgagaggt     20640
     aacttttagt tcaacaaaaa atcaagcaaa tagaaccgag agaatttcaa tgaactcaca     20700
     gtagcaataa tagagacatc caatgatatc aggaaagtgg ctatcataat tccggccaag     20760
     atgctataga gcttcacaga gccgaccggc tgtgctctga acatcgcgtc aggacttgaa     20820
     gacattatca acaaggttgg cccagatttc aaacgattgt attagttgtc tatggcaatg     20880
     aagttattcg aaattttact gtaggtttta tgctgtccct ggtctcctaa cagtttactg     20940
     aattaggtag tctgttggca tagtaggcca gggccggtcc cggccccgtg accgactctg     21000
     aggccgactc cgactccgcg ccgcgttgcc ctctgcctcc ggcttctacc acagtgtcac     21060
     tcctcaccct ggtaccagag ctatctccca atacaaagag caatgcaacc caaagctccc     21120
     tcaaggcggc atgcatgtgt acgatgcatt cagttgaaag tgaaatgtgt tccggttgag     21180
     aatggacggt gtcaacgatg tgcgagactc gaccgacact gtgcttttcc agacggctcg     21240
     cgtaggaata caagcatcag gttagcccaa tgaaaatata cacctgtgtt ggggtaggct     21300
     gtcgggtaac gttctctccc tctctccaga aatagccgcg tcgatgtcat ccagcatcag     21360
     atcgatacac ttgctgctca attatatact gataaggtat cctatttcaa actgatgcct     21420
     cccctttcct gccagaagac tatctcaact gtttcaacta ggtcccgagg gtggagctgt     21480
     cacgtataac agaaacgcca tccccttcta ccatcagtaa tacttcgtta cagccaagcc     21540
     ctgtacctga accgttcgac gattttatta cccggggact tctcaatatc actgaaggtg     21600
     aagaacttct cttgaagttc cgcactgact tgatgcccct gtttccattc gttattatac     21660
     ctgaagtgag ctttgttgaa ttgcgcaagc agtctccatt cctcctcttg tgtataataa     21720
     cagcttgcct cgagcacaag cccactctac agcagaaatt ggaatttgaa gctcgaactg     21780
     tagtctctac ccgcatagta atgaatatgg agagggacat ggatttactt cgggggttac     21840
     tggttcatat cgcatggtat cactatcatt ggcgcatcta tcatacccag gtgtacatgc     21900
     ttcttcagat ggctatggcc atcgttgttg atttgggact tgacagatac aacaacttca     21960
     aaatgcagtc tatctcttat aatggaaaag gggcggagga gttacacaaa ggacaagtac     22020
     tctacctgac tcctgatggg cagcgtgcct tcttagggtg ctattatcta tgttccaagt     22080
     gagagcttct aaatcacagt acagtgatat taactaacag aataagagcc tcgatattcc     22140
     ggcgacagct gaccatgaaa catacagact gggtcgagta ttgtgctgat agcttagggc     22200
     aaagggcgga gtatcccact gaccagtctc taaaagcact aattaagatc cagtcgcttg     22260
     ctcagcaatc ggagctagag ttcgaagacc ctatccgtgc aatgagcaag gacgagctgt     22320
     tccagtctat ggatgtgctt gagaatcaaa tcgagcatct tcttgtacag gaaacacagt     22380
     gtaatacctg tatgtctatc tgagactgat tagtttcgcc atttactgat ctgactaggg     22440
     tcccttcgtt tggagctcaa cgcaattcct gccattgttc tcgggcatgc tcttcggcga     22500
     caaagagatg tccatcacca gtatgagaaa cagcaactgc tcgccattgc gcgttccgcg     22560
     ttcaacattg tgacggtatt ccttgcatcg ccggcttcgg tcacacctaa tctccctatg     22620
     ttcagttaca catccatctg gtacggcctt cttgttttat cgaagctgag cttgctttcg     22680
     gatgccgcga caaaaggcaa ggcagtcgaa gtctataaca gagatatcca caacctcggc     22740
     cttgctgcta tgcagaaaat ggaggcaatg tcacgaagaa acgatgtttg ggataattgc     22800
     cgtgcagtta ttggatccat gctctcatgg ttagagagca gtcggataca gccccaatca     22860
     atacaagttc gaggagatac atcaaacacc caggacgctg agaaccctca tatgctacca     22920
     caaccaatac ccgaagatcc ccctcgagcc acagagtctg cagcggtagt tgaagattgg     22980
     gatgctaccg tatggcaaca catgttgcaa gatttgacct ggataggcag cagttcactg     23040
     tagatctagc ctacatgcat tgaagcaatg tgactttcat acccctgtcc accggattac     23100
     gctggctgaa ttatatttgg tttaatctta ttgaactatg gtcaacatta accaggttcg     23160
     caatctatca ccgcgcctgc gaaacggaac ctttccggtc tcacttcccc atcgctgacc     23220
     ggtgtacatt cagtagcctg catcgatgcg ataacgccat caattctctt ttttctggga     23280
     cactggcttg acatgtgaac attgcgccag gtgatacaac ttcaaagctc tgcgctgcta     23340
     ttattctggg atgagacgaa acttcagttt accgtgctgc tccgtcaaca ctgaacttat     23400
     atgtcgaaaa tgtagtataa aggccgtcca ttccccagac tgtttttgac tcttgttgcc     23460
     actggggatt attgattcca tcagtccagt cctgcatttc cagtgagatc gctccatact     23520
     ccgccactat accagtacct tgctttcgtt tcagtggtac ttgatctgtg tgacaataga     23580
     aatatatcag ttactactac taaatccttt ggactccaga gccagaattg atccttgcca     23640
     agaacaggct gcacatggtt cgtgcgcaac ctcaggccga gcagaatgac cgatacaatg     23700
     aattcgttcc gccgacctat tatgagagaa actaccttgg gaaccaatga tctccagctg     23760
     gaatatgatg ggggcgccta cgtgcttcgg gagaagcacg atgctcccga gcctcacaaa     23820
     gactaccgta cggttcaggt cgagtattcg cttctttccg caatcaaagc caatgatggc     23880
     tatttcttcc tgtgccttgg aatctgccag ggtacatgcg agaaggttct gtgcttgtcc     23940
     accgataatt cctccattgt cagtgtgccg cagtcaatgc tggtcaccgt ggacaacaac     24000
     gacctcatcg acgcgcaatt catgtcgttt gtggttgctg atcttgttcg ccagcatatc     24060
     ctgagattga ggcccgctgt gggtacactg cttatgtaca agcccgatcc tggccttgtg     24120
     tctttgctgt ctggtcgaac ggttggcgag ggtcagtcga ttgtgttcac aacatgcaag     24180
     ccaagtaatg cgaagagaag aaactggatc tatgtacacg aaagaactcc tgcgcgcact     24240
     atcgatgcac ttattccgcg cgacgttgcg ttgattatcg atctatcttc cactgctgcg     24300
     tccaagtatg gacttgggac cagaattgcc tcattgcgac ctcaggccgg ccagaaactt     24360
     ggcttttcta atcttgtcca cagcacggca tcgccgatgt caacccctgt ccctgagagc     24420
     attgggctgc ttcttaaaca agtctcgggg tttgcacaat cccaaatgaa tggagttcca     24480
     gacagagcac cgctcgacac tctcactatt ggagaagccg tgacgaagca gctcccagag     24540
     tcgagcctag cattaattca atgggaccca aatcagtccg tttcagtctt agtggagcca     24600
     atcaccgtga ggaatgacct cttccggagt gatagaacct actggttggc gggcctggcg     24660
     ggagacataa aacaatccct ggctgatttc atgattcaac gcggtgcgag gcacatcgct     24720
     ctcagtagcc gcaacccgat aatctgccct gaatggcaga aattgtgtca agcccgtgga     24780
     gcgcacatca agtactttac atggtacatg aactgcccaa ctatatccta tccgaaatcc     24840
     tactgacaga gtgatcgttt ttgtccagtg acctgaccca gtatgcgtca gttcgatcga     24900
     cactcagcgc gatcgaaagc aagatgcctc ggattgccgg cgttgctaat ggtgcccttg     24960
     tgctttgcga cactcccgtg gcgacgatgt ccttcgatga cctccagact agtcctgaaa     25020
     cccaaggtgg acggcaccgt gaatctcgac agcgcgttcg cgcaccatgc gctggactgg     25080
     ttcatcgcct tctcgtcgat cgtcgggacg gccggtaaca tgggccaggc ggcctactcg     25140
     gcggccaact gtttcatgaa ggcgctggtg aacaaccggc gccgccgggg cctcgccggg     25200
     tcgatcatcg atatctcccg ggtcatcagg gtcggctacg tggaacgtga gaccaagagc     25260
     gaaggacgac tgacaaggag gaaacggagc ggctcatgaa ccgcaccggc accatcccta     25320
     tgttcgagcc ggatttgcat cagctgttcg cagaggcggt ggttgccggc ctaccgggga     25380
     cggcgcccgg ctcggagctc atcacgggcc tggcgcccat cgggatggcg caggcggaaa     25440
     ctgccttctg ggccgccaac cctaagtttg gactcttggt gcgcgatcaa accatctcct     25500
     tgactgtctc cacgctcggc gagaatgggc tctccattgc ccaggttccc gtctggattc     25560
     agctgcagga tgctacctcg ccgcaggagg tgtcgaccct tatccaaggt aagtgatcat     25620
     gcatcccccc taccttcctc ttccggtcca ccttctcaaa tttacggtac tcctcgccag     25680
     agcttccatg tatacaaatc cagaaaagaa tccagaagaa agacgccaga ccatgcatga     25740
     atgtgtgttt ctcgccaaac agtaatctaa tagctataaa tgctcttgtt cccgttttcc     25800
     cttttgcttc agaagatgct tttctctgtt cccggatagc gaggtctaaa tcgataagaa     25860
     cagccggtca atgtccagcg tggtcattgc taagaataag gctcccgata gaaatatcgc     25920
     cttgcaatag tcctgtcttt gaatgcagtt catagcctct tgtaagggat aagacccgaa     25980
     acgttcgata gactatcgta gctatcaaaa caagaagaaa acgctgaaaa agaaaggagg     26040
     aaagaaagaa agagggaaat caacacacgg tgagaccatg aggtatgact gcactacata     26100
     gtggaaggag aggcaaaata caccacacga taaacaaacg agggtcaacc tctcgagtaa     26160
     tctaacgggc tcgctggtgc ttcttctgtt cattcagtag gatgtgttta agtcctttat     26220
     tctgaagctt aagcagaaca ttctgtagag agatggtggt actactttaa tttttggggt     26280
     tctggtcata cacatcagag atgatctgct tgagaagtct tttaattctt ctccaagctt     26340
     ctgcttataa aatagagtat gatgatgact tactagaaga ggatctttga tcctcctctt     26400
     tagtaaagtg tgttaaaata atctccgggt tctagggcta taaaccgacc gatttcgatg     26460
     cactctcagt attgcttgta gataaggcct tattccagct cgaccagaat agcctaaaga     26520
     aatccctctt ggtaatatga cttaggccct ggctggcatg caaaagagcg tccagctggt     26580
     tactataggc aagagataaa ggaccaaaga tactaatcaa gcagctgcag agaatatgta     26640
     gaatgaggag gatatatagc ctagaggatc ttatttgcat cacagaagtc aataaacttt     26700
     attgtgatat gagatccatg tccattagaa attaaaagac gccaacgcct tctagctttc     26760
     tctttagtct gtctacagat gacaaaggag acatctcccg tgaggaattc cacagcatgt     26820
     acgctaaaga ccctgaacgc acctttgata tgatccttca cgttttgaat catctggaga     26880
     caaaaacaga gcgccgagat cgctgttgac gacttgacca ctgagagaga tgcattgctc     26940
     aaacgggtcg ataatctggt tgaagaaaaa gataatatgg ccactgaacg agatcttttt     27000
     gctgtacagt tggctcgcgt tggttcccag gctgcacgag ccgccaacga gcctcgtaag     27060
     tccacaaaga tccctggccc tccatgctca gtgatgggaa ggaccctact ttgaagattg     27120
     gaccctggct atgcaccaga aactggacac caatgctggc cactatagca ccacgatcct     27180
     tcgcaaggcg tatgtcacga gtcgctgtga aggggatgca caacatcact tggctccccg     27240
     tctccgccca gagtcccata gtccctacaa caatgctcag gacatgctga ctcacccctg     27300
     aagaacatct tttccgaccc gaacaaagaa cgcaatgccc gccggcagta caataacttg     27360
     aagatagctc ctgaagataa gttttacacg ttcatctcaa acttccgtta tcttgcagtg     27420
     gaggctggta ttgatccaga ctgctggagg gaagacctgt accagagatt gccgttcaag     27480
     ctccaggaac ttacaatatc tcgtttcaat gacaacgaag ttgactttga ccagtatgtt     27540
     gaggaatgtg cccgttcagc tgacctaatc gacgagatcc tgaagcgttg caactgcaca     27600
     ggacagactc cctcttctgg ccgtcgacag agcctaaatg cccctacaac agcgaatcgc     27660
     acttctccag cgatcaagac tgaagaagcg ccttcagcga ccagtgaaac aaatatggac     27720
     actgaaaccc gcaatcgtct gatgaatgaa ggcaaatgtt tccgctgcca aaggccgcgc     27780
     atctcagccg tgattgtcct gacaagaaat ccgtacaaat aaagatactt gaggaaaata     27840
     gtgatgaaga accgtcaaaa gattcggcct aggaagagtc tccctcctag gcgagatgcc     27900
     taattcctca gatgaatctt ccatattcac ttttctttca ggccccctgt tttcagccta     27960
     agaaatttct ttaaatcccg gaacctgact tcctcttctt caaccccctc gcctctgcat     28020
     ccgccaacga caaccatcag cttttatctt taatatcgat ttttcatctc aagttgaact     28080
     aaggctgtcc tctgtacgta tccccgcgag acttcaccag ttttgagtga ctctgggcga     28140
     atgtatggta ggccgtgtgc gttttgtgtt actgacttta atatttgata attatctttg     28200
     cgaaaatgcc tgctccgttg aactcgtctc atccgggtgc ctttgtgtct ggtatgctgc     28260
     tccgtgtgtc ctacgtagaa agattcgttc ctaacgttca agacactatc gagaaattta     28320
     ttcatgaagc cgaggccaga tttattgagg ccattaattc cctccaggcg gccaaaaaca     28380
     gccttcaatt gatcggtcct ctctcgggga tgccaggtac cctcctctcc gctcaagaga     28440
     gacatagtgg cttggtgatg ggtcatagac agttgagaag ctctgcggag ggtcagtcgt     28500
     gaggctattg agtctcttaa gactgctgtc ggtcttggct taagtacagc tgagcggaca     28560
     gaaagcccta ttttccacac cctgtcgtcg tatgtgcctg aatctattcg ttacagacac     28620
     ataactgttg gatttggaat cgcaattttg ggttgttact gatgattttc atgtagtagt     28680
     cgagtccatt gtaggagatg tggtggaatt ccgagtctgg gtgggagctt agttccatga     28740
     tttgtgggga ttcgatggtt catggatgtt tgaggtgctg tgaaggggtg ggggtactgg     28800
     tggatataga agggggtgta ttgtctcggc ctaagcatag tgaattatat ttgcagctac     28860
     tccgtacgga cgtcggaact gttgcatgat tgtcaagatt cgactactat ctgaccagtc     28920
     agcagtaccg ttaaagaaag caagctcgca cggattcgaa gactctgctt atagcagtgc     28980
     tttggcgagg taggcgagaa attggcatag gccatataca tttacagaac aaatgctatc     29040
     tatgtcatag tccaacagtg tcatccagat catcaataac catgcagaca taaggtccga     29100
     tgcgaacacg taagggactt atcccgtcca atcacagcat acagtcatca ccagtggaag     29160
     cagcagacag aaatgggcag ttgagaactt cacgcaaaat ttcaatcaaa agggtaatac     29220
     agcacgagtg cgcccacaaa caccgctcca tggtcgtttc gaagagataa acgcagaaaa     29280
     ccaccagcta gccacgctca gcgtccatag ccacttacac tggatccgaa ttcggacgct     29340
     cctccataat gttggccgtg tgcaccgcca tagctggtgt tgtagtcgtg cagcacgctt     29400
     ccaccagaga ccgtcgggtc atatgtgcct gatagcgccg agcgtgcagc gtgtgagttt     29460
     ccaaactcgt ccacctcgct ctgctgcagc agagcgtagt cctcgtccct gtcgccacgg     29520
     acagaggagc cgataccagc gcgggagcgg aagtcgtctt cttcctcctc gaaatcatgg     29580
     gcagggttcg aggaaaaggc ggcttttgtc tgcgcggcaa aggtgggatc ggagacagcg     29640
     tcgggcaagg ttccggtgcg gcggaaatgc gagacattgc ggaaggacat gaaggcagtt     29700
     acgcagaaga gcaggctatc acatcattag cacatatgat aggaacgccg tatgggtata     29760
     cttacaagac aacaacgccc aggatcacag tcgctgtgct gaccttgcat ttacttgcgc     29820
     ttccgtaggc ccagttatcg catccgcttt tgctgctgct gtcactgctg ctggtgtccc     29880
     ttctgctcga cgaactgctg gagctactgc tgctggagct ggaatcggag ctagagtccg     29940
     actttccctt actcttgcct tccgccacat agctagccac acaaacccaa gcagagaacc     30000
     acaaaatggc gtacaggcag tcgacggttg cgaaggcata aacatttccg aagcgtcgtg     30060
     cgcgcggcca catgggcact gccacgaggt agatcaggcc ggggatactg aaccagcact     30120
     aaacaaacaa gaatcagtac atggtcatca ggcgcctgaa gtttggcggt tccattcatc     30180
     gcaacgtacc aaagcaaagt accaggctga acgcccatca atgccaccac cctttgtgaa     30240
     cacagcgatg gtcaaggccc acgccaggaa gatgatgaac ccctggaatc cgtggatgag     30300
     gtttttcgtc ctcccggggt tgaacgaagg ccgagcgatt ctcatgttgt gggaggaggg     30360
     aaggaggaag acggggtaga gcggtgcctg acgacaaagg gcgcttcctt gtacggaagc     30420
     gaaagagagg atagagcgat cggacgttta cgtgaggaat caaatcgaga atagtaatgg     30480
     tgcgctgtat atcgagccag acgtctcgaa gggcgttgtg gaggggcgag aactggggtg     30540
     gaaatggatt gtttatgccg atagcgatcg aaaaacccaa gaccaggtga acggggcaac     30600
     ccgatcaatg ccgcgcggac gctaaagtgg gcggtttcaa atggtagcgt tggcgaaccg     30660
     acagcgcaac ggtatcagca gtgaacccaa gaccagacaa acaattcgtt caaacgatga     30720
     ggaattaaca gagatgaaag aggaaggggg cgaaaaggag ttgacagatg aacgtgaatg     30780
     agatgagatg attgtggctg aagcgaatgc gcagcatctc ttcagcttca gtctttggta     30840
     cggtaccgta aatttggatg ccgatcttac cgcttgacta attatagcct aggctgaagt     30900
     ggccgccaga aatagcagca cctgacatac gcctccataa gaggtaatac tgctagacta     30960
     tctacagcga tgtttagaac attaggctca tacaagggct gtcggcccct acggaaaacc     31020
     gttgtttagc cgacctctca atatgagtag agtaagaagc acctcggtta ctcacattcc     31080
     tcgtcggtac tgtacctgtt ccgaaagacc tccatataaa gtttgtatcg accaatcgga     31140
     aaacctgcgg gggtgccttt caaggctgac gaatgccagt aaaccagctc acctggaggt     31200
     catgggagca tttcaggcag ctgtattaga agaggatata atgtgctggc agtggcactc     31260
     actttgcaag ataatgtcta agggtattgc tacaattcgt attcatctgt gcccaatctg     31320
     ttggaataca gtgacaaacg agagatagat atcgaaacac ccaatatccc aaatggtaaa     31380
     gatgatcgaa caaccagctc aaacgaatgg gtccatgcga gtcaagacat atctcaaatg     31440
     gcttcacact cttgatagac actgagaaac ctaataatga tacatatata tatatacctt     31500
     gttggttctt gagaaagaag accaccacat gtgaataaat acccacggtt tcgcttacta     31560
     caggagtata aaaatgagat cagcaaaagt ggtcttatat tggcttacat tattcctgct     31620
     gcactagtgt aacatgacgt atgttcatct gccagaatta tatacccagg tctttgtact     31680
     ccagacttca aagaaaccga gagtgatgca tactatgtag gactatagaa tctttaacct     31740
     ggaacttgtc ttgcctgtac ctactgaacc tgctcgcagc ccaatctgac agtttacttt     31800
     tagatcaact ttcatgattc atcagtactc tatgtctgca tcaatgacta tgcaatggcc     31860
     cctttacctg gtactccgtg acaaacatac caactgcaat ggcggttggc agaccacgga     31920
     tatcccagca actaaaacag agacttacat ctaaacactc agatgaacaa tactattgtg     31980
     ataaccattt aacttcccac tcaggtagtc ctatacatcc aacccgcgat aaaaccatac     32040
     ccaacgatga taatccaccg aaaccagcac gacattgcaa gacaggcaaa tacaatttgc     32100
     tttttcacaa ctgattagtg catattatat agcaggcact acaaccaatc taagcatcta     32160
     gcgggagtat tagccgtttc aagatagcgc taaagcactg ttctcatgga aaccgtctat     32220
     agtctagact atgcctagca cgcggcacat cagccatgct ccactgcaga tctcagagct     32280
     tacatctaac tattgagtac tgttaatctt tttaaaagta aaaccataaa tcattgctat     32340
     actatcatta ccacattgca aaaaccgagt aatatcccaa ggcgccacct gatgctcctt     32400
     tatataagta atcgtaacat cgtgtcctgt cctgtggttc cgtccttctt gtccttccat     32460
     gctgagtgga acaaaggaaa taaccaacaa ataaatataa gtgagaagag gaatgaatga     32520
     atgaaggggt agaagacaga gagcataagg aatcacgccc tcttcactct cttcggcttc     32580
     acaatcatct ccaactccct caaaggctga tagacatgag catgccacca ccacggcaac     32640
     ggatccagct gcgagaactt ctgattcttc cagaagaaca ggagcttact cccctcatga     32700
     agagcacgat caacctgctt ccccagcgat ccaaatacct tcacattggc tttcttcgcc     32760
     gtgcgaaaca gactgaaccg ttgacgcgga ggaggcgtag tgatatccgc cttcaaggac     32820
     gcagacgcag acgcagcacc cgctgtgcca ttcatcacag cctccccctc ggcgacacca     32880
     ttcgtctgcg gcgtcaacgc ctccagatat ccgtctacca gagtcttcaa atcgtcctcc     32940
     aagatgaggt acttgaccgc cgacgcgcca tgcgtgcagc tatcaataag tatcacatac     33000
     cgcagagaat tgtcgctcac ctcctcatcc accatcacct tcaaccgcaa atgccccgtc     33060
     aaccgggcgc ccatctggct ggcaaaccgc tccatcagcg cctgaatcgc cgtcgccagc     33120
     ccgcggtcca tcggtgattg gccccaacca ccgtctccat cctcctcagc ggggtagatc     33180
     ttagtcgcct tgaccttccc ggcaacgacc gccatctcgg cataaaaccc tcccaacctc     33240
     gtctgctgct gcaacatcca cggcctctcc ctggagatgc gaatctcact gacctcggaa     33300
     taggtcagac taagagtccg tttcggcagc atcacctctc tctcatccgc cctccgcata     33360
     ttccacactt tggtcggcga ccgatggagg atcttatgca ccgcatcccg agacagcacc     33420
     tcgtgtctct ccacaacagg taatcccttc tcgaccaaaa acgccaggaa agcttcccgg     33480
     ttcgatgagg attgtgagag tatatccgcc attccccgat caagcgtcac gcacttacac     33540
     cccgtccgcg cctcaatcac tcccttcgcg acggcatcct cttccccttc cgtctcttcg     33600
     cagcatggga tccacacgtc cacgttctct ttcatcacca cgtctaacaa ttgcgctgcg     33660
     tagcccttcg tagcggtgct tgcgctagtg gtagaattaa tgcgataata cccgctcagt     33720
     acccgcgaca tactctcccc gcacgccacg cccgattcat ccccacctac cacttcggcc     33780
     ccaattaccc gatggcccga gtaataccat ccgcgcgcga tggccaggcc atacggtgtg     33840
     tcgatacccg tgacgaggac agttcggggc ttgaagttgc tggagcggag agccgcggcg     33900
     cggcggcgag cgccggcttt gttgctatct gttagagaga aggggaagaa tcctgctgcg     33960
     taggcggcga gaaggatggt gttgtcgagc ggtaggagag cgagggagag ggcgacgcgg     34020
     aataagtgca ctaggacttg gagttggagg atggagaatc ggggagtgga aagggagcgg     34080
     gatttggtcg ttgcggtgct gagggcccgg cgtaggcgga tggggtggcc gactgccatg     34140
     tttgtttcct ttttggttgg ttctttcggt gtgatcgttg gtatgattat ggattggggg     34200
     ttagtataat agtgggtatg taggtgggtg aatggtgggg ttgaatcgtt cgtggtatag     34260
     tataacccga attgaccgaa aagaaaacta aacgaagaag agaaatgaag atgcctctac     34320
     ggactgccca cgggcgggaa aattccctat attatgtact ccgtagtatg tgtcgcgcga     34380
     atgcaaatgt aatgtgtgtg tggaatgctg caaggcgacc acgtcagcac agagtgcgca     34440
     ttcgtgatgc gagagggagg agtagggcgg gtggcactgg atagatagat agactagtag     34500
     ctagtagtta ggagatgtgt tgggttgctg ctgatgccga gtgtcaaagt tagtgagtga     34560
     ctgaggtggc tgggactgcc agctagctag cgaggctgct agctaaacag ctgtccgtct     34620
     atcttatgtt tccacatcgc aaagtggggg atgcggagcc tatgggaaag aaaaaagcaa     34680
     tatgcggatt tcactttttt ttttgcctcg ggctgggctg ggctgggatg ggtgtctgag     34740
     acttgcatgc gattgtaggg ttgcagtgta agtgaggatt gattggatgg gtgcggccga     34800
     ggtaagtaca gggtagccag ggtagctgct tggctacggt tgcggcattc cttgccttgc     34860
     tagctagccc tgccaggtaa gtatctatct agtacgcagt aggtggataa gaatcagtag     34920
     atgaataccc aatttaatgc cgggcgggat gtgcttgtgc agtgcatgcc gctactcgtt     34980
     gggtttcgat ttcggttttg tttcatgttt tgttgtgcgg ggaattattg gttcgttcgt     35040
     ttcattgtat gtgtcatgca tgcaggcagg aaagtaagca cttgggaaaa ggactggatc     35100
     gcatgaggta ctcgagataa gtaaaataag taggtagtaa ctaacctgaa gtgcatgatc     35160
     tacagatgac tagtctctgt agtagctaac tagttaacta actaccgact cggttactac     35220
     tactactgcc gggaaagtgt tccttggttc atccatcagt tccgaaacac cattcagtgg     35280
     atcagggaac atgtacccca tatgctcgaa agcatacaat gaaaagcaaa agccagctca     35340
     aagctgctcg caatataccc aatgcagtaa tcgcacagtg acatttccga tcgtccgtcg     35400
     gagattccat ggccggcgac ggatgcggac gaaggggtag atccggtacg gagctctcac     35460
     cttagcactt accatggcat gctcgtgtgc aaggcgactg ccctataaac aagcctttga     35520
     acttattcta ttgtggagct taactgcctg gtacatttgg gtcgacgtca ggtagtcaga     35580
     agcaggttca atgcgagccg accagctgtg gaggcgtaga cgtggatcgt ggcgtcgctt     35640
     gaaccggttc gggtttcagt gtcggagtga gtgctttgtt accgtcaccc tcaataacgc     35700
     cgctctatgg gatcatgtct gaatgaatga tattaagctt tcgaggttga gcacgggact     35760
     gcttctaagc ggaactgggt cgtatcatat tattctcgac caggggcagg ccctccagtt     35820
     ctgtattgtt ggaggggaag ttccattgtc tccctgttcc tattctgcac ccctccatgc     35880
     atgatccgcg cccacatggg ccttctgacc ctgccatcgg agtcgccgag atgaggagac     35940
     acattcccga tgccgactgc tttgctcgac aagccagatg aggggttgaa actttatcag     36000
     atggcagctg aagtgtcctg tgacggattg acgcgggaac cgggaccaca cctacctgga     36060
     ccgatgtggt aaccatctcc gactgcccgg ggttttgcga tgtcgtgcac caaggcctcc     36120
     gccactcggg atggaatagc atcgcttatt tgctcacgac tttccatgga aatcatgatg     36180
     cgatcattat gagtgtggcc cactgccgga tggcgacatt ccgcccttat cagctacaaa     36240
     ggtccaagtc ggtgtcgacc cgactagtcc gcgcgtcttt caaagctctt aagtatcctg     36300
     ctgcccctcg aacgtggctt cagtgtccac gctctcccct tactacacct agaccttacc     36360
     agcctccttc tcctttcacg cagcgcctgt tatcgaccat gggtgatagt gctacccccg     36420
     aagccccttc tcaccctcca gtggaacgtt cggtaagctt gccccgtaac tcttgatttg     36480
     ctgcgctcct actctgacaa ttgactgtgc cagcgcgagg atggccgaga gcgaaagctg     36540
     cttcacttca tctatgacca acccaaccgt gacgagatcc agggcaaccc agcaaaggtc     36600
     ctagatctga tcgaagagtt cggtaaaact taccacttca tgaacatcgg tagggccaag     36660
     ggcaagttca ttatcgacat catcgaggaa aagaagcccg aagttatgat tgagcttggt     36720
     ggctatgttg gctattcggc cattctgttc ggagatgccg tgcgccgggc tggcggacga     36780
     cactattata gtttagagtt gaaccccgag ttcgcggcca tcgcgaacat gctgcttgaa     36840
     ctggcgggct tgcgcgactt tgttacaatt ctcgtcggtc gaagcgattt gtcccttgac     36900
     aaacttttct cgagtggtca tgtcaaacac gttgaagtga tgctaattga tcactataag     36960
     cccgcatata cggccgatct gaagctctgc gagcagctcg gcaagatcgt ccccggggtt     37020
     tcggttgtgg tggcggacaa cgtgctctac cccggcaacc cgccgtattt ggagtatgtc     37080
     cgcagcacgg tggagcagaa gcgtgaagcg gccaaaaagg ggccggtcca agcatacgac     37140
     actaccaacc tgccacagag atcagtcggg tcattcatgc ctgcggatgc gacgcccagc     37200
     tttgaactca ccgggaaccc gaacctggtg tatgacagca aattggtcaa acccgagacc     37260
     acacgagtga gtttacccgg tatttccgag gagcggggtg ggaatttcac tgacatgcga     37320
     gttctgtagg acgcgatcga ggtgagccga tgtgtgggga tccaggaatg aaagggtcca     37380
     ggcatagaag ttgagtgaat tattcttcat ggctgctcgc aaaggctgga ccgagtggcc     37440
     tcagtaatca tcggcgagag cgcgcagaat gaattccgaa agtaaaagtg acgcattgag     37500
     acatcggctt ttgccgcgtg ccccgcccga gccaaaggtt gccgtcgcca ggaccttccc     37560
     ccgcgccagc actcaaatgg ccacttgcta tggggaatga ggcgggttgg cttcatttgt     37620
     aatccttaga cgatatccat agcgtatata agcagagaat tccctccgtt tcccatggtg     37680
     gattactatc ctcccaatcc tccacgatat accccccctc atcgcaagta acaccaccca     37740
     tcatggcttc gaagacctgg aacgtcggaa ttgtgggata tggctttagt gccaagacct     37800
     tccacattcc cttcattcag gaagtccctc aattcaaaat cgcggctgtt gtgcagcgca     37860
     cccccaagcc ggacgacgat gccgagaagg accaccccgg aatcaagtcc taccggacca     37920
     ccgaggagat ggtcaaggat gagggtctcc aggtggttgt catcaccacc gcgcccgatt     37980
     cgcattatgc cttggccaag ctggctctgg agaatggaaa gcacggtaag tctcttgcta     38040
     tccaggtata gcgctctcac cttgcatgag tactgacttc atttgcgaca cagttgtctg     38100
     cgagaagccc ttcaccccca ctactcagga agccgacgag ctggttgctc tggccaagaa     38160
     gcagaacaag ctcctggccg tctaccaaag tacgttttct acccaatcgc cgactcgaaa     38220
     agaaacataa cctaatgatg atatttggta gatcgtcggt gggatgccga tttcgtgacc     38280
     ctgtcgaagc tggtgaagaa tggctctctt ggccgtgtcg tggagttcga gactcacttc     38340
     gaccgtcatc gcccccagga gccctccccc gatgtttcca agtggaagaa caaggtcatc     38400
     ccgggtggta gcgccatcta tgacctgggc gctcacctct tggaccaggc tgtgcacctg     38460
     cttggcaagc cggagcgcgt gactggattc attggctccc agcgcgaggt gaacacttcc     38520
     gggttcgagg actctttcac tgttctgctc cactacccga agggcgtgct tgtcacggct     38580
     aaggctggtg tcgtcagccc ggaagaggag caactgcgct tctgggtccg gggagagaag     38640
     ggcagcttca agaaggtgag acaacggcct ttcaccctag gatgtcggtt agtaacaaaa     38700
     tactgatgcg tacacgctcg atagttccat ctcgacgtgc aggaagagca gctcaaggct     38760
     ggtgtgaagc caggtgacag cggatatggc cgagagcctt ctgagagata cggtaagtca     38820
     aggattgccg ccgttggact ttcgcaacag gctaacagtc tctgttaggt actctcacga     38880
     ctattcagga cggcaagccc gtcaaggaag tcatgcccac agtagagccc ccgacctgga     38940
     cggaatacta ccgcaagctg gcgcgggctc ttggtggaga gggcgacctc cctgccagcg     39000
     gcgccgaggc tcgtgaagtg atccggctga tcgagttggc tcaggagagc tcgaaacagg     39060
     gaaagaccct ggatgtataa gtctcgtgta aagagtgtgc ctatcatggg tcatgattta     39120
     atgatggata gaattgtttt cgcattgtac gagtggtagt gtgaagtttt tagattgttt     39180
     ctctttgaag gaatagatac agcagacctg ctcaatgcca ctaacatatt agtgtgctcc     39240
     acctgctgca ggcgagtgtt cgactgttgt acgtaggctc tagttactcc aaggacagac     39300
     atccctatac agtctggtcc caacagcgtc cccaaatccc ccctcatttc ccctcacgac     39360
     gggctttacg agtgagaggc gcgagggttc ggggggcgcc atgtttttgg ggaaccccag     39420
     attgatcgac gattgctcaa gtctgggcgg gaatgaggtt agttacgcgg tctgaaatcc     39480
     cgataccagc aggagcccat gaaacagggg tatttggggg gaaaagacag ccgggttcgg     39540
     gtaacagtcg gcgtaatatt acaggccagt gacctcatcg tcagctgccc cgacgctaaa     39600
     ccggaagcag agtttccatt acccaacgcg aatatcatga gtggcagaaa gatgtcttgg     39660
     accagccagc aaaagggcgt gtttcccttc tttccagggc atcaatggcc atctccaact     39720
     cagcgctgca ttcctgccct ctgcccgctc tcttccgcgg agatcctcgt ggttacaatg     39780
     tatgagtcct cgttttgcgt gccgactttt ccaccgtctt ctcagtgctg gccggatggc     39840
     cccattctag tattttaatc tcgaggaacc ccataatggt cctgtccact cgctcttcgt     39900
     ctgtttcaga cctccaatgg gattctttgg tttatattta gcttctctct cccctcctgt     39960
     caatccacgt agttcaaggt aggttctgtc ctcgcgggcc cccctgatat ggacccgtcg     40020
     gggctccatt taatcaaact gatgcctggt cgcttgatcg gtgtcaatgc atggccatag     40080
     gccaaaatct gcacctgtca tttctcctcg aatgtgtgtg cttggctgcc tcttcattcg     40140
     tggtgttttc agtcttcaat gccttctttt gcatgattga cagctgtatc tgaccattat     40200
     atacatcagg gtggcgagcc gtgttgcgtg ctttaggact gtctgggctg gttgccggca     40260
     gtactgaagc gatgagtgcg cagaaccctc agtcggcgtc catgctccag cgcatcgact     40320
     tctctcgact acatgtggac atcgatgcct ttctcaaccc atatctaccg cctccaccgt     40380
     ggcgtcatct gcctcggccc atctcccgat tcttcgggta cagaaagact cttgctccga     40440
     aacccctggg gaatctcgtg atcgccttct ggtctttgat cggagtcttc tgtggtgtgc     40500
     tcgtggttgc ggaggtgtct gagcatattc catcattcca agcccaccat gccccgatca     40560
     tcgtggccag ttttgtaagt tccacttgag atactcagac tccactagta ctactgctcg     40620
     atgtcgacta acgagcttat agggtgctgc tgctgtcttg gaattctctg ccatcgaatc     40680
     accctttgcc caaccacgca atgccgtcct gagtcagatt gtggctagtt tcgtcggcgt     40740
     tgcgataggc aagctcttcg cgctgaacga gaacgcccac tctatgccgc aagtcggcgg     40800
     tgctttggcg tgtgccatca ctaccgccat catgacgatt acaaacacgg tccatccccc     40860
     tgccggcgcc accgcccttc ttgccgtcac gcaatcctac gatgtgggat ggtacttaat     40920
     cttaattatg ctgctgggct gtgtgctcat gcaggcagtg gccttggtta tcaacaacat     40980
     tcaacgccgc ttccctatat actggtggac gccgcagtct ctggaacgcc ccaagcccga     41040
     cgacaccgaa agcgccaggg aggccaaaga gggaagtgtt gcttccgtcc aaaccaacga     41100
     tacctttccc ggcgttccaa cccatattgt tattgaaaaa gggagtgtca tgcttccaga     41160
     caatgtcacg gtcacggagc aggagatggt agtgctgaaa agaattagcg aacgattata     41220
     gacatacata atactagaac ggtcggaagt tgcctggctt gctttgttct aagccaggag     41280
     aaggctctcg accaattaat aacagtcatt catgccgtgc aacagaagcg taaaatacta     41340
     ggtttagatg cttagagatg aggctgaaag taggttggct ggacatggcc agtactatgc     41400
     gcgacagact cttcagccaa ttacaaagtg agccgagaac ggggattcac gatggttatt     41460
     ctatttggtt ctttatgact tgttgcttgg ttatttaata tataacgcaa ggtgccctgt     41520
     agtggactaa gaacttcccc gctgcgttgg cagttcccgt aagttgtagt gatatataca     41580
     tatttcttga tgtctggtgg agttcaatgc tgaccattat cttggcctgc cttgggcgca     41640
     aggctctgac acacgtgact gtggatgccc aaagcggcaa gcgtgcgcca cgtcccgtgc     41700
     agtgacgtcg tgcagccaat caccgcgagg ctcggccacc cactgaagga attttcgagg     41760
     caaaaacaac catccattca ttgattcttc gttgtctttt cttcttcttc tccttcaact     41820
     tcatcgggat tctcccttgt gtattgagtt tgagtagtat atttgctcgt atatatcaat     41880
     cactaatttg gctgtctttt tcctcatttg aaatcccatc tttttgagag cgatctcgtt     41940
     ggatctgttc tctctttgcc tggccagcct atcgataagg gctatccaag gaaccacccc     42000
     ccactcagaa gaagactttc ggtcgccccc ctcccacccc ccgctattag ctggtccacc     42060
     ttcgctcagg ttcttttttt cccttttcct ctctcgcctt catcggacag cttttatcta     42120
     ggcttcctga ccgtcccttc ctcttccctt tccgccttaa cctacccacc accacctccc     42180
     cctcctctcc tctcctctcc tctcctccat caacaactcg cttatccgac aagatggtgt     42240
     ctgcctccaa agccgctcgt ttggcaaagc gtgccgccga tggcgacaag aagaaggcca     42300
     ctaagggcaa gaaggacgac cccgtcgtcg acggtgaggc cggcgatgac cagcctgcca     42360
     ccaccgacga gaagatgaag gaggttgaga agttgactgc tcagatggac aagcacggtc     42420
     tctccgatcg tgtcaccacc ggtgtcctcg cctctctgcc ctcctctcgc gacgtcaagg     42480
     tcacttccgc ctccctggtg ttccacggaa aggttcttat taccgactcg actctcgaac     42540
     tgaacttcgg tcgtcgttat ggtctcctcg gtgagaacgg ctgcggaaag tctaccatcc     42600
     tcaagtctat cgccactcgc gaatacccca tccccgagca cattgatatc taccttctga     42660
     acgagggtgc ccctcccagt gagctcggtg cccttgagtg ggttgtcacc gaggcccaga     42720
     accagctcga ccgcatggag aagcaggccg aagaactcct cgagactgag ggtcctgact     42780
     ctcctatcct cgaggatctg tacgacgtga gttgtccccg ctatcgcacc tctttcatct     42840
     cttgtttggt tctctaactc tttttttgca gcgtatggac aagatggatc cctcgacctt     42900
     ccacacccgt gcctccttga tcttgaccgg tctgggtttc aacaagcaga ccatccacaa     42960
     gaagaccaag gacatgtctg gtggttggcg tatgcgtgtg gcccttgcca aggccctctt     43020
     cgtcaaaccc tccctgcttc tgcttgacga ccccaccgct cacttggatc tcgaagcttg     43080
     tgtgtggttg gaagaatacc tcaagaagtg ggagcgtacc ctgatcctcg tctcccactc     43140
     catggacttc ctgaacggtg tctgcaccaa catgatcgac atgcgcatga agcagctcct     43200
     ctactacggt ggtaactacg actcttacca caagactcgc gccgaacagg agacgaacca     43260
     gatgaaggcc tacaacaagc agcaggaaga aattgctcac atcaagaagt tcattgcttc     43320
     cgctggtacc tacgccaact tggtcagaca ggccaagtcc cgtcagaaga tcctggacaa     43380
     gatggaggcc gatggtttca tccagcccgt catccccgac agagtcttca gcttccgctt     43440
     cgccgatgtc gagaagcttc ctcctcccgt cctgtccttc gacgacgtct ctttctctta     43500
     ctctggcaag tgggaggaca ctctctacga gcatctggac ttcggtgtcg acatggactc     43560
     ccgcacagcc cttgtcggac ccaacggtgt cggaaagtcc actctgctgc gcatcatgac     43620
     cggcaagctg agccccatcg gcggtcgtgt ctcccgtcac actcacttga agctgggcat     43680
     gtacagccag cactctgctg agcagctgga tctgaccaag tctgccctcg agttcgtccg     43740
     tgacaagttc cccgagaagt cccaggacta ccagtactgg cgtcagcagc tgggccgtta     43800
     cggcctcagc ggtgaggccc agactgccct catgggtact ctgtccgaag gtcagaagtc     43860
     tcgtatcgtc ttcgccctgt tggccattga gtcgcccaac atgatcctgc tggacgagcc     43920
     taccaacggt ctggatatcc ctaccattga cagtttggcc gatgccatca acgccttcag     43980
     cggtggtgtt gtcgtcgtgt cccacgactt ccgtctcctc gacaagatcg ccaaggacat     44040
     catggtctgc gagaacaaga ccatcacccg ctgggacggt actatcggcg agtacaagaa     44100
     ccacctccgc aagaagatga tttccgaggg tgctgtctaa ggtacaaacc actgaaaaaa     44160
     aaaaaaaaag gaagaagtga ttaatcttct tgtttatgat tggaatgttc gagacgacac     44220
     acacatgcaa atataaaaaa ggcttgtaag gggaaggaaa aagtttctct ttaccgttac     44280
     aggagagatg aaccatcctg atgaatgaca ttcgcgcgga aggttatccg ttttttattt     44340
     ttcctttttt tttttttaaa tacctggaga tatctttgct cattactacc actacacatt     44400
     tgggtgcttt gttttagatg gtctgtgctt catcttttca taccttcatc gtcactcccc     44460
     ctaactagac ttgagcgttt gagggtttca atttgatatt attcccttgc tatactactt     44520
     tcagagttac gtagacatta ttatctatgt agaatgtcta ccctcgtatt atcacgataa     44580
     taagtacata tatgtggcct actgaattcc ccgggtccga tggtcgtcta gttatccaac     44640
     taggttactg tgcctataac aggtagtata agcctggata ctagtactct cccaagccga     44700
     ggtcaactgg tagtagtatc acttctgaaa tttattcaaa tatacagata caatataata     44760
     ccagatccaa ttgagatatt tgcacaacca agaccccact ttttaaatga ataaagtaat     44820
     taacaatatg cttttccatc taattgcgcc tatctgcacg ctcaaaacga cgattcacca     44880
     acgtcttcac caaaaacggt agatatagta ttaatgacat gataaggata ttgatatagc     44940
     tgctgctatt acccctccat ctgcctctcc ttagtccgct gcgtgactaa ctcccctccg     45000
     aagaggtctt tcgtctcact cccccgctct agcttccgct tcttcgctag acgctccatt     45060
     tcgctttctg acgtnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     45120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngtttgg     45180
     ccgggaacgc cttcggcgaa ttgccgtagg gagaggtagt agttgtcggt tttggtggcg     45240
     aggaagaggg cgcacggcat gatttgtttg gggtggtagg tcatcgggga gttggtgagg     45300
     tagaagcggc ggaggtattg gattgcggtg gcctttgggg atgggtaggt tagctttgag     45360
     gtttgcaggt atgggatagg agggctgtcg tactctcacg atggtgggaa gtggtggctt     45420
     gtagttctcc cctagttgta tgatttgttc ggagtagtag tccacgactt gctgctcttc     45480
     ttcgggtgtc aagcactcga tttgtttctc ttccgttgcc ttgttctccg catcgcttcc     45540
     gggggccggt gtccctgtcg tggaggaggt ggctgatctt cgagcctctt gtgctcttcg     45600
     tagagctgct cgcactcggt cactcgcgac ggagttggtg gttgctcgta attgcttcag     45660
     cgatgcttcg gtgaaggacc acagtcggaa ctgagaggat gaccggtata tttcgtcttc     45720
     gatcatggtg gaaaacagct acacaatgcg ctcggtgtcg taaaggatgt agtagctaaa     45780
     gatggagtgc tcgttgcgag aggattctgg ggacggcgga aagtcaaagc tgatctgcat     45840
     cggactttgc cgcatatcca cgtgcttatc gataggcccg ctgtcttgac tttccattca     45900
     ttagacatcc actacaattt gctgactgcc tgtgatcgtt caaaatagct atttacgtta     45960
     gaagacacta tcctttgggt catacagata ttgattgact aaatgcaagg ctaatagtat     46020
     cctgacttga gctatgctgc cgaaagatgt agaaagcaat tggatatatt aaacaaacat     46080
     aggtcatcac tgtttgggat ctgacgtgtg aaaagagaaa agagattgtc tttatgatgt     46140
     tcgtgcgaag aggtccccag attcaagaga gcaaacccga ctgaatcgcc tagcaccgtc     46200
     gctattgcaa aatttaaacc atccgaaccg tgtgtcaaca catcacacca actacggctc     46260
     gccgaggagc cgcgctgtaa tgtctcccat gtacgcctcc tccagctcgt agtcttctcc     46320
     gtccattcga tcaatgccgt agtatttgaa tgcggctaca acgcgctcga cgtcaaatcc     46380
     catgttacag aatcggtcga tcaagtcttt gttgtagccg tcgtacctgc acagaaagat     46440
     tagccaagat taggtttgtc ctacaaacgt gtacatactt gcttaagtcc tcttgttcct     46500
     gttcttcttt cgacttgatc tcctgcagtc gaagagtttc gtctgtcaca ccgccgctgc     46560
     cttcacctgc atgccttctg ggagctcctg catacatcac agcccactcc tgagcaactc     46620
     gtgcaaattc ctgcggtctc cgaaggagca tcgtggcgac ctcggcatct tgaggatctt     46680
     tgggctcggg tgtgcttagc agggattgca gtgacagaag ggcagacttg atggtgagca     46740
     ccggcgacca cgcagtggaa agagtgtcta ggcagatggc accctgggca atcagcttta     46800
     ttagcaggaa actagagaca gcctgatcat acatgactgg aggtgactta ctgtttgact     46860
     gctgacgttg ggatgccaga ccttggttac aaacttcatg tggggaggcc gaaatggata     46920
     atcgttgggg attttaatgt cgatggtata ggttccacct tcatagggtg ttcctggagg     46980
     ccctgggaac gtgcctcgaa gatgtgtaag atcctcccca ccgtgcagtg gttcagccgt     47040
     gatttgcgac tgtgtgtcgg cgtggatgtc ggcgatctct ttggcgatac gccttgctcg     47100
     attggcagac atcgtgcaag aagtttggtg atgggtaaat aaatctggga agaacaggca     47160
     atttgtgtta tttttcctct tccgaataag caggcaaagt aggtttgtat cgtctggata     47220
     gttgaaagat aagaatagaa aggattcaag aactatgagg caatagtcaa agcttcgtca     47280
     gcctcacagt agctaactac cgagagggcg aggaagtgca gcagatggtc tgtagcagga     47340
     ggatcgagga ggagaagaaa atatcagaga aggtctaatt agtatggacg ctggagacca     47400
     acgacggatc tgtaacagcg tcacctaatt tggtgggagt ggactagaga ggatcgttgt     47460
     tgtagtatgg gcgaaagtga gggggatcaa tgctctcgga ggggcgcaag taagcgctct     47520
     atcacggaag agcgctaaac aatcgaacca gatcagatca caggaactta gtcgggcccc     47580
     aacgcaggat ggacccggct ggactatata taaatgacac cgggaatata agttccgatt     47640
     aagaaaaaga caagtcgtag gtgcagttta ggggaaatga cccgtcggcc tgcctgggct     47700
     gttcggagaa gagctgcctc ttactttctg tacggagtac agatcgggtc cagctcggtc     47760
     ggcgccaggc tacttttggc ttctgggcgg aggatcccaa gaggggttag cggcgattga     47820
     tgccttagcg atcggccatc agtctctcag gcaccaaggc tcgtcatgga tgccggatca     47880
     catcacgtgc tgccaaatgt gctggacggg cgccaaggcc cgagcggatg gctaccaaca     47940
     gcttcccagc tgcgcaactc atcagcttca cgccccatcc tccttccccc atcctcatct     48000
     cttcacccca tccacgcaca tcgcgaatcc ttcattacat tctccaaaca cctgcatagg     48060
     ttatctatat taagcctatt gcttctcaca gtttcggact atggttggtg cccagcgttg     48120
     gccctagttg acagctcttg tcggctcctg atgtcactta tctgaccaat ctttgcaaca     48180
     gggtaaccag cagtccaaca tcggcggagg ccccggtggc gatggacggg atgagaaaga     48240
     caagaaggta agctatactc ccatgttcat cctgccggtt gccggtcggc ttacaatacg     48300
     ctcctctgca gaaggacaag cccagatacg aaccaccacc gccgcctacg actcgtctcg     48360
     gacgtaagaa gcgcaaggct gccggcccga gtactgcctc caagcttccg gacatcttcc     48420
     caacgtcacg atgtaaatta cgatatctcc gaatgcaacg agtccacgac catttgttgc     48480
     tagaggaaga gtacgtggag aacatggagc gcctgcgcaa gaccaaggcc caggctgcgc     48540
     tggactcggc gaaccgtaat gatctcgaca tcatggatcg gaacgccgat gagagaagcc     48600
     gggttgacga catgagaggc agccccatgg gtgtcggaaa tctggaagag ctgattgacg     48660
     atgaccacgc catcgtctcg agcgcgactg gaccagaata ctatgtttct atcatgtcgt     48720
     tcgtcgacaa agacctgctc gagcctggtg ctagcattct tctacaccac aagtcggtct     48780
     cggttgtcgg tgtgctcacc gaagaatccg accccctcgt atcagtgatg aagctcgaca     48840
     aagctcccac agaatcatat gccgatattg gtggtctgga aacccagatc caggaagtcc     48900
     gagagtccgt ggagcttccc ctgctgcatc cggagctgta cgaggagatg ggtatcaagc     48960
     cacccaaggg tgtgattctc tacggtgccc ctggtaccgg aaagacgctg ctggccaagg     49020
     cggtcgcgaa ccaaaccagt gctactttcc tccgtatcgt gggtagtgag ctgattcaga     49080
     agtaccttgg agatggccct cgtctggtcc gtcaaatctt ccaggttgca gctgagcacg     49140
     ccccctccat tgttttcatt gatgaaatcg atgcgattgg tacgaagcgt tatgattcta     49200
     cgtcaggtgg tgaacgagaa atccagcgta ctatgcttga gcttcttaac cagctcgatg     49260
     gtttcgatga tcggggtgac gtcaaggtca tcatggccac caacaagatt gagaccttgg     49320
     atcctgcttt gattcgtccg ggacgtattg accgaaagat tctcttcgag aacccagacc     49380
     gtaagccacc gagtccatat atttgtgcca gattgctaac tatgcacaga aaataccaag     49440
     aagaagatct ttaccctgca cacttccaag atgtcgctgg gagacgatgt cgacctggac     49500
     gagttcatca accagaagga tgatctctct ggtgctgata ttcgtgcgat ctgtactgaa     49560
     gccggtttga tggcgctgag agagcgccgg atgcgggtgc agatggacga cttccgcgca     49620
     gcaagggagc ggatcatgaa gacgaagcag gatggaggcc cggtggaggg actgtacttg     49680
     taggcgggca gatattgatg ttgtattaga tcttccctag ttgaaccgtc gtatcgtggt     49740
     ggtattaggt caagaatcta tcccagtgta tctttacaat agtagcacca ggtcgcctcg     49800
     gtggcccgta tgtaacgctg tcagggcgct gcccttgcaa ttgcacatgc aggtaacctt     49860
     tccgtgcaca ttgtagaggc tgctagtcct gggcgtagtt ggaggccctc ccgcccattc     49920
     cccggtgacg tcgcgaggcc agtttatcaa ggactttatc ttatcaccac gtgactataa     49980
     agcccaaaca gtgcaaatcc atcaaatctt acaaacaata aggataccgt ccatagcatc     50040
     tgcagtcatc tccgtcaaat cttcatccaa gacgaatgac cagctgccat aatggacgga     50100
     tttgacgagg aagcattcaa gaagtttttc ccgactagct ttggcaagca agagaagaaa     50160
     gccgatgtga gctcacagat tgatcgcacc aagcgcgcag aagtctctgt gaaccctgat     50220
     ggcgacggca aaaaagcggg ttcaatagga gagacgacga ctgaggcgat tcccgcggcc     50280
     gaggaggata accagaagaa cgattcagaa agcgatgatg ggagtgacga ctctgatgac     50340
     gactctgacg atgaggatga gttcccggtc tctcacgaac tcactctcaa aacacacgac     50400
     cgcgcagtga caaccttgac cgtggatccc gcaggttcgc gactgatcac cggctcgacc     50460
     gattgtacta taaagctaca cgactttgcg tccatgaccc cgtcgacaat acgcgcattc     50520
     aaatccgtcg atccttctgc caaaaagcag tctgctgcgc aggaggcgca tgccgtgcat     50580
     tatgcagctt tcaatccctt gtcccccagc tacgtcatgg ttgtttcggc cacaccccag     50640
     ccaagaattt tgagtcgcga tggtgatacg attaccgagt ttgtcaaggg tgatatgtat     50700
     ttgagggatc tccacaacac caaaggtcac atctctgagg tgactggcgg cgtgtggtgt     50760
     ccaaccgacg agaacctgtg tgccaccgca ggcacagata gtactgtgcg catctgggat     50820
     gccaatatcg gtcggtcaca gaaggaggtc atcgtgcata aatcaaagat ggcgggatcc     50880
     gctggccgga gtaaaatgac cgctgttgca tggggttctc ccaagcaggg tggccccaat     50940
     gttctcgttg ctgctgcgct cgatggcagc ttgctgatgt ggagcggaaa cgggccgtac     51000
     actcggccaa gcgcagagat tagagatgca catactaagg atacctggac gagtggaatc     51060
     gacatcagct cggatggacg gcttgttatc actaagggcg gagatgacac tatcaagctg     51120
     tgggatacca ggaagttcaa gcaacccatc accacggtcg cccatccttc cagcactcgg     51180
     tacccgtcgt cgaatatcat cttctcgcct acatcggcca atgttctcac gggctcggag     51240
     actggacacc tgcatatctt gaatccagct acgttgaaac cggaactggt tacgcctgtt     51300
     acgccgggat cgcctcttat tagtgttttg tggcatgaga agatgaacca gattattacc     51360
     ggctcggcca acgccgaaac tcatgttctt tacaacccta atatgtctac caagggtgcc     51420
     gcattgatta tgtccaaggc cccgaagcgt cgacacattg atgatgaccc tagccttacc     51480
     atggatctca cccaggggat ttctggcgat tctgtggttg tcggatccaa cggggtgcct     51540
     cattacagtt cgtccacctg gtccgcccgg cacccgacca tcggactcac ggcgtcaggc     51600
     cggccaagag atccacggag acctcatcta ccagcacaaa cacctttcgc gaaatcgcag     51660
     ccggatgaga agcatatccg tgagaacatt cctcttagtt ccatgcggga tgaagatccc     51720
     cgggaagctc tgctcaagta tgcagacaag gctgagaagg acccggtatt caccagggcg     51780
     tataaggaga cgcagcccac gccaatctac cgggatatta gtgatgatga gaacgagcag     51840
     gggccggata agaagcggac aaagcgatga agtgttgcga ccgatcggaa ataatagcga     51900
     tcgtttccat tcgctctatg ccatgattca ggacatgtac acactatact tttggagcaa     51960
     gggcggcgtt ggcagatcaa gtgtgttaat aatcagccgc cctctcaacg ggagttaaaa     52020
     aaacaacaga gataccccta tggcagtaaa tactgtgaaa ctctagtcat agtcgtgcat     52080
     aacgagtaag tgtactccgt aggtacttgc ggcatgggct gcctgctcga tgacgttgaa     52140
     ggggctggtg ggtgggccag gatgtgcaag tcgcccattc tccggatcgg ccactcgacg     52200
     ttgatctgga ggaggcgagc aagccaatga ttccacgact gcggctggct cctcgataat     52260
     ctcctgcagc ctgtccagct ttgattgcac agcaaacctc acgcgatgct gtgcttttac     52320
     gtggtatttt ccaccctccc aacttgagca ggctcgcacg tgcgaactgg tcgtatccaa     52380
     ggattttagg cccgagttta gggactgcga ctagttagtt cctctcgccg gttctctcgg     52440
     catctctctc tctctctctc tcagagaatc cccccgtccc tcctccccca tcttattctc     52500
     tacatccgtg cactttacca ctgtcggacc tcgctcacgg ttgacgggcg tccatactca     52560
     ttttattgct ttgtggtgcc tttcggaatc tctttccatc tgttggtgaa cgaagacttc     52620
     cgcgctcgga ttttatcact taggggatac agaatgtcgt ggctcacagc agcatgaacc     52680
     cctgcccccc aagaagctga tgccaataac ctgaaggaat atatgctgtg acgattaccg     52740
     gaagtctcct cttcgttaga gtcagtcggc tgccattttc ttgccgattt gtcgacatcg     52800
     gaggctttcc gcatcctacg accttatagc ggcggatcag tcgggacctc cttttcactc     52860
     ccgcgctcgc cttttagtca ggcctacctg cgccaggcat aacctcgagt caacctccta     52920
     ttgcggatgg cttacttgca cgaggtgccc ctggcagcag gcctgctcac cgcgctcgcc     52980
     tcctccgctg ttcctacgcc gacacccacg ccgtatcact acttcccctc ctcgtcccag     53040
     ccttctccga cgttcacatc aagtcccggg tctgacaatg gcgatggtgg aagtggtgga     53100
     ggaatgcacg aatggtcttc cctgattgga atcgtgactg cgctggctgg caatgtgttg     53160
     atctccttgg cgctcaacat ccagcggtat gctcacattc gtatcgataa ggagtgggaa     53220
     caggacaagt taagacatga gttggactgg aaacgtgcca accatggaca cggcagctcc     53280
     ggagcatatg ggtctatcga tgacgacgaa ttcgacggag acgcaagccg aggaagacat     53340
     cgtgcgtctc gaccagctcg ttaccgagat gaatctccta cttctgaacc cgatcattat     53400
     gaggaacgcc gcggccattc cggacgaacc cgccgttaca gggacgacga gacagactca     53460
     caggatcata tgcaggactc catgatatcc gaccggaccg cgcggtcggg gagtgagcgt     53520
     ttgcgccgca aatcgtatct tcggtcgccg tactggtggg tcggaatcgt gctcatgtca     53580
     cttggcgagg tcgggaattt tatggcctat ggatttgctc cggcgtctat cgtgtcaccg     53640
     ctcggcgttg ttgccctcat ctcgaactgc gttatcgcgc catttatgct gaaggagaaa     53700
     tttagacagc gtgacttgtg gggcgttctt attgcaatcg caggagcggt ggtggttgtc     53760
     ctcagcgcga agtcgtcaga agagaagatc ggccctcatg atatctggga gatgattaca     53820
     cgctgggagt tcgagttgta cctgggcgtt tccgctgtgc ttattgtcgg gctcatgtgg     53880
     gcaagcggca agtacggatc gcgatcgatc ctgatcgatg tcggcttggt ggcgttattt     53940
     ggtacgtaca cattttcccc ctagttatat acaatctatc cctgctggtg gatcgttgct     54000
     tatctcttga ctaggtggat atactgcttt gtcgaccaaa ggtgtctcat cgctgctttc     54060
     gtttacgcta tggcacgtca ttacattccc agttacctat cttttagtct tcgtccttgt     54120
     tttcagtgct cttatgcaga tccggtacat caatcgagct ctgcaacggt tcgactcaac     54180
     tcaagtcatc cccacgcagt ttgtactttt cacactctcc gtgatcatcg gaagcgctgt     54240
     cctgtatcgg gacttcgagt cgtacacggc tgagcgtgca tgcaaattcg tgggcggttg     54300
     tgtcctgaca tttatggggg tctactgtat taccagcggc cgtgtacgcg cagacaatga     54360
     gtctaccttc tctatcgatg acgaggagga ggctatcggc ttgttaggcg gagaccgtta     54420
     tcacgacagg gtcgacatgt ctcctcctgc tccccaagct cgggcccata aaacaggacg     54480
     aagagcccgc acgcccgcgg atgatcattt gcagtctcct tcggggtccc tcctcagcca     54540
     tggtatcgaa gatgtggatg acgaccagcg gacacccagg ggcgtcttat cggctgcacc     54600
     atcttccccc cgcggctcac taaccgctga gtctctcgaa caaccgtctt cggagccttc     54660
     gtcgcccatg catgctcgtt cgcttttgac gaacccatgg gcagactctc tcgagtcagc     54720
     cattcaaccc cccaatgccg aaccaccggt gcatcgccct gctacgcccc cggctcagtc     54780
     ggagcttaca gcacacgact caccgtttct tctccgcttc cctcctgctc ctggcgctga     54840
     ggatgcgccg gaaggcccga taccgggaca tggacggact ccatcaaacg ttcggaaagc     54900
     cattgtcccg cagacgccgc ccgctcggca tttacgaaat tccatctcaa aattttcgcc     54960
     tggtcctctt ctgccgacca tttcggctgg ctttagtgca gtagtggctg agacgctacg     55020
     ccgcggcgag ataagtccca ataaaggacg aagactgcgc caccggatgg accggagaaa     55080
     gcagttaagc acaacggtct tggaaggatt ccctcggcag cgtaacggag acgccagagg     55140
     aggcgaatat gaggcggatg gcaatctgga aaacgctcat gaccttgggt ttccgctttc     55200
     taccagccgg cttccaggga ctggtgccct tgcaactgct ccagtaagta ctggggatct     55260
     gacacctgct gtcgactcgg aggacggccc catcagccag cacgaagata acaccacctc     55320
     actttcgcgg cttcgcagcc taagtgactc ctggagcggt ggtctcgcct ggctaggtgg     55380
     cgttcttcat aaaccggggg cgaacagagg gtcggaggct acgacgagca tccaagagaa     55440
     cgaaggtgaa gacggcgccg agtcgcaggg gaaccaagaa gggcagggta ccggcgcagg     55500
     tacgcgggcg taaattgagc tcttgatggt gactggctca caccgaatgt tagtacatac     55560
     gtttgttttc ctatagataa ttcatgggtg ggggttgtct cataccactg cgagcattag     55620
     cattcttcga ctatatagcc gtttaataga attttgagaa acgagtgtgt tgttttccgg     55680
     tagctcgagg ccagtggcga tgttaatttg cgttcgactg ctagtcacca ggaggtggaa     55740
     cctgtatcca agactttctt cagctggccc accccgcggg catcccatca atatcgggac     55800
     gggccttagt tccatccttg gactttgcag gtctgctggc ccgaggaaag acgacgatag     55860
     gtggagaaag agcagcaagc agctggcacc ctggccgact agcagctgtt agtctgctgc     55920
     atggatcgtc ttagggccat ttcccaagat tacttgcccc tccccgccgg ccatcgcctg     55980
     aatttagccg tccttctact caatacacct cccatcctag gaaattactc cattgtctgc     56040
     aatatatcgt gggactcgtc cgacatccag tcagcaggct cattttcagg ttcctactca     56100
     gcatcatact ccctcattcg ttgctggttc cccacgctcc cagcactacc gactcccatg     56160
     ggtactgggc tcatctccga atggatcgca tgagcacagc ctaaattaaa cggattcctt     56220
     gcccgtcact gccgatgaaa tccagtagtg tgcttgctgg tattttttct tcccttcctg     56280
     ttgtctggag ctccgcttgg tctgcgcgct ggaaattata tgctgcctgc atgatgttaa     56340
     ataccgaggg ggatctcccc ttggagcttc cccttctgtc ttttccccaa tatctgcctg     56400
     cctacctgca taagctcgct cgcacccaag gagctgggag agcagatcat tggctcttca     56460
     tttagccatc atggtggccg gtcttgtcgc aaaggcgctt ttgctccttc agcttgggtc     56520
     tggggtcgtg gctgcacaga atgcctccag acctctttac aagaatcccc atgcgcctgt     56580
     ggaggcgcga gtctctgatc ttctcagtcg gatgactatc gaagataaga tgtctcaatt     56640
     gatgcagggt gcgtatttcc ttttccacgt gtagaaacac ggtcgtgaat acaaatcaat     56700
     gtttcgctcg attccaatcg cattcattgc agaggcttat gctgggtggt ataggagacg     56760
     tcggtaactg gatggacagc acaactgggg ctttcaacta cacaggcttg gtggagaaca     56820
     tggagatgaa ggctggtgca ttctacggta tgaatttact ctgaatattt gctgccagac     56880
     aactaacatt agtagttgga tatgctgttc cctgggactg gcttgcgacc aatatcaaga     56940
     gagcccaaga ctacctgctg cagaatacga cgcttgggat tcctgctctt gttcagactg     57000
     agggtacgtc agtctccata cccagctgga tatctatgct aacccgtggc tgctctttac     57060
     aggtattcat ggtttcctgc tcgagaacgc cacgatctac aactccccga tagcatacgc     57120
     ctgttctttc aatagagaag tatgtttgcc tgctgtctgc tatctatgac tgagacttac     57180
     tccctactat agttggttga gaaaatggga cgactcattg cgcaagaggc ccgtgctatt     57240
     ggtaccacac aactgtttgc gccgctggct gatctggctc gtgaactccg atatggtcgg     57300
     gtaaggactg caatatctca agcgatgatg gactggctaa tgatcatcga ttacaggttg     57360
     aggagacgtt ctcagaggat tcttatcttg ccggcgaaat ggcctatcat tatatcgtag     57420
     gcctgcagag tctcaacgtg tctgctactg tcaagcactt tgtgggctat agtttgcctg     57480
     aacagggtct gaacactgcg cctgtccaag gaggagagag atatctgcgc tcaacgtacg     57540
     tgtgcattct ccatataagt agacgaaaat ctaacacggt ctaggtggct gccatccttc     57600
     aaaagggcca ttgtggatgc tggggcatgg agtattatga gcgcatacca cgcgtaagct     57660
     gctacattca acgaccttcc ttcggctatc aactcactag ttctagatac gacggtatcc     57720
     ctgcggtggc cgactggttt accctcacga agatccttag acaagaatgg aactacgatt     57780
     actatgtgat cagtgactcc ggtgccacgg atagactgtg cacagccttc aagctctgca     57840
     gaagctctcc catcgacatg gaggctgtga ctacccaggc attgcctgcg ggcaacgatg     57900
     tcgagatggg cggcggttca ttgtgagtac aacaattact ggagtaaaca atacagctaa     57960
     caggtcatag caactaccag aaaatccccg agctcgtcga atcaagccag ctggatatcg     58020
     aggttgtcaa caccgccgtc tctagagtgc tcagagccaa gttcgagatg ggtctctttg     58080
     agaaccccta ccctgctgct ccccaatccg aatggaacaa gctgatccac agcccggagg     58140
     cagtcgagct cgcgagaacc attgacaagg aatccatcgt cctgctagag aaccacaacg     58200
     agacacttcc cttgaagaag agcggtaaca tcgccgttat cgggcccatg gcgcacgggt     58260
     tcatgaacgt gagaccccta atacctcctg ttgccacgag cgaatgcaca aatgcctagc     58320
     atcatgctaa caacatcagt acggcgacta cgtgatctac ggcagccaat ggcgcggcgt     58380
     cactcccctc gatggcatca aagccgccgt cggcgacgcc gctaccgtta actacgcgca     58440
     aggctgcgaa cgctggagca acgaccagtc gggcttcgac gaagccatcg cagcagccaa     58500
     gaagtctgac gtagccatcg tcgtcgtggg cacctggtct cgcgaccaga ccgaactgtg     58560
     ggagaactac aacgccacgt acgttcctcc catcaccccc tatccttatc ccacccatcc     58620
     caccacccac cactaacccc caatcttccc catttagaac cggcgaacac gtcgacctcg     58680
     actccctggc cctcgtcggc gcccaaggcc ccctcatcca agccatccgc gacacggggg     58740
     tccccacgat cgtcgtcctc tccagcggca agcccatcac ggacgtaacc tggatcgcga     58800
     acagcacctc agccctggtt cagcaattct acccctccga acaaggcggc aatgctctcg     58860
     cggacgtcct cttcggcgac tacaacccct cgggcaaact ctccgtcagt ttcccccatt     58920
     acgtcggcga cctgcccatc tactacgact acctcaactc ggcgcggaac attggcgacg     58980
     ccggacgcgc ctaccccaac ggcaccctcg agttcggcca ccaatacgtc ctgggtgatc     59040
     cgcacgccgt gtacccgttc ggatacggga agagttactc gacgttcgag tatagtgata     59100
     tcaaggtcag caagacgaat gtgtcggcta gtgatacggt gactgttggt cttgaggtga     59160
     agaatctgga tgagagtagg gaggcgacgg aggtggtgca ggtttatgtg gttgatgaga     59220
     ttgcgtcggt ggtcgtgccg aatcggttgc tcaaggggtt cgagaaggtg gttattcccg     59280
     ctggggggag taagagcgtg agtattgata ttaaggtgga ggatttgggc ctttggaata     59340
     ataagatgga gtatgtggtt gagaagggcg agtttggggt gttggttggg agtagttcgg     59400
     tggatattag ggggagggtg gcgttttggg ttgtctaata gtattacaaa gtagtagcta     59460
     ggtgggtgtt aagaggatgc agggtggtgg tatatgtatc tagttgggat atatctgtgg     59520
     atgtttaggg tagtatatat atatttcagt tcagttcatc tcgtttcact tcgtgtgctt     59580
     gcttttatgg ctaataatga caggacatag tatataagtt tttcatatag agatatgaat     59640
     gcctcggaca aacccaagaa taaacatggt cgtaaagatg aagcagaagc ttaatcagac     59700
     ccctcccgct caccattcga agtgtctgca ttctccgttg tcgtcgtcgt ctctccgccc     59760
     cctgcttttg atgacccgtc ctctgtatct gccactcctt gctgtgtact cgatcgtctg     59820
     ctactgctac ctggccgagt agtagcgcca ggagcaccag cagaagtagt ggcaccagca     59880
     gcagcagtac cagtcgcacc cgcccgtctc gacttcgccc cctccttcaa cttctcccac     59940
     cgctctctat accggcccag cacatcgcgg agcttatcgt tctcgcggcc aactttacca     60000
     agttccttct cgccgcgacg gaccatttcc tctaaatcct tgatgcgctg gtcgtaatct     60060
     gttgctggga ctggaggtga ggagatgccg ccaccaccaa caccaccacc accagtagtt     60120
     gtgactggtg aagatccttg cgattggtta tgaggttggt ccagggacgg gacattctga     60180
     gtatggtgca tagctctcag ggattgttgc agcgccatgg agctggattg ggcattgact     60240
     tcccacatgt gtagccgctt ggatagagta tcggatagat ggcggagggc ttggttctcc     60300
     atttgtagtt cttccatggt tttagggttc tgggtgagtc gggagaattt ctcgctctgg     60360
     ctggtgttgt tgttccgggc tgcggccttg ctgcccatcg gtgctgctgc tgctccggag     60420
     agactttggc ggagttccgg ggatggaggg gtctcgcggg cgtcgacgaa gtcttcctcg     60480
     gcggcgtcct cgaagctgct tcttcgggct tctttttcgg cccgcgtcag gatccctgcg     60540
     taggagactg tgccgccagt ggtgggaacc acgtagaagg attcggcggc gctgccggtt     60600
     ccgccgcctg ctccgccggt gttgtctttg atggcttgga gagcggcgcg ggagaagagc     60660
     ttgttgatgt ctggttcggc ggtgcggtcg gggacggcgt tgtagcggtc ggttttggtg     60720
     tccggggcgg atttgcggct tgtagagggt tgtgtggagg atgggtcggt gcctaagggg     60780
     aggccggcga aggctagggg tgcggagatc ttggagatga ggccttcgaa ggtggagtag     60840
     aacttttgga agggttcctc ggtgagggag gctcgtgggc gggatggctc tgagggctcc     60900
     gctggcgcgt actgctgcga ggtgatgtcg gttgggctgg gcgttggcgg gatccaaggt     60960
     tgtcgggcgg atgctggggt gcggtggcgc tcgcgctcac gctcacgctc cctcatccct     61020
     tgcatctgtg cggtacctcg tagtcgggac tcgcttgttc ggatcttgct tggtccgtcg     61080
     gtcatcttgg ctccggcttg ctggggagcg attgttggcg atgccggaga ggcacggtgt     61140
     gcgggaatgc ctcgtgcgga tgctaggttg ctggcaatgg aggatgactc tctagatggc     61200
     agacgagggt gtccggatag ccgcgggaga tgttggggat cagtggtgga gggggatgct     61260
     ctcgcccccg attccgtgga gagctgggca ttcgcaccgg tgtctgcatt gcttggggga     61320
     ttctcatgtt gaatacggag gatctgggcc agctttttgt gatgttgttc gagcaagtgg     61380
     agagtccgta gagcctgtgc agtcgaggaa atgagccagc gtataagtgt ggctgtagat     61440
     gcagcaatgc gtcaagagac gtacctcttt atcagagcta ttctgggctg cagtggcaaa     61500
     ttctcctgca gcgaggtcat gttcctcgct ggctgctacg gggttcgact tgcgagtctc     61560
     gagaactgca ttgcgagcgt gggtatgagc cttgtccgaa ggggtttgtc aggcgggata     61620
     caacgcatga gatcgcgcaa gaagacttac caaagtcagg ggagcggtct ccatggctgt     61680
     ggaggtctca aaagagcaat agaatttccg gagcgaacta ccacaagcca cccccccaaa     61740
     gcgagtgaat gtgagttgaa tatgatcgga gaggaaagat taggacatta agataagggc     61800
     caaagaagtt actatcgctg gtgacgacat cccctcaccg cttcgggcag atcacgcggc     61860
     ggtaccaatg ggacggtaac attaccaccc atggaaccaa ctgctggagt accactaagt     61920
     accctcgact tttatccact accagcaact accagcaact accagcaact accagcaact     61980
     accggactgc taccgctgca accccctgat tccggatctt ggtattgttg tgacagtaat     62040
     acgctggcgc atacactgtg acagctccgg caccaccgca gttctataat tatcctgctg     62100
     cagcactggg gagtttcacc accgcgatca agattaatta attatcccag atctaaaaaa     62160
     gagaccaggg ggggaagtca cagtatataa tattacagtt acagaggaac ctctcaagtt     62220
     aaaattatcc ctgccgatcg cagatacacc ctgtagatat acatccccgg cggagaaata     62280
     cgagcgggag aaggtcaccg gcggtaatgc tccgttcacc gtggattgtc tggcagcttt     62340
     gcggagttgc acttcgaagc gccttcgttt cgctttcctt ctcctcatcg tcatcttccc     62400
     cccttcctcc cccccacccc ccatttcttt ttttctcaaa gacatcctct tcccttaaat     62460
     tcttcagcag aagggaagcg agaggaagga catgctgcgg gctctgcgac catctagacg     62520
     cagttagact aacttctctc ccctctacga ccctcctttt ctgctgacgt tactttactt     62580
     tctacataca atgcattgct agagacgtcg accggttctg acctctagca tgcgcactgc     62640
     cgttgctatc caatatcctc ctgaaatcta agtcaattgt ccattcactt tcattcctgt     62700
     ctttgcctgt tctcccctca ccaccccccg ctcttcgata cgctcatcca acatggaggc     62760
     caacccgatc cccgaacccc cgccggttcc agataccgat gtacccagca tcagcaaagt     62820
     gaatcgtacc aagaccactc cggttgatct ggagacaatg gggagttctt ctcgaagcaa     62880
     tgggcgctcc tcaatcgact caacctccga cagacccaag tcgcaagccg gcgaggctga     62940
     ttccgccaag gcaggatcca gcggattttc gaagcttctg gccgctcgac ggaagaagaa     63000
     gaaggataag aaccagaagc aatcggatga atcgtctacc cagcttgaca cagagagtag     63060
     caaggatgtc caggagagtc gttcgacaga gtcgcgcgac gggctttcga ccacctcatc     63120
     agtcggccac gagcatctga gccccccgga ccatgatact cctaacctgc tgacagacga     63180
     ttccgaacct gaaaggtgtg tcccaattcc gttgctacat catcggaaga ctgaacagat     63240
     gtctaatttg aatttacccc aagaacaccc cctcttactt ctcacaactc ccatgtcggc     63300
     ttttacacct catcctcccc ccttataagg accacatcgg tggacgagac tgaagaagac     63360
     ggtaatggcg acgcggaagc ggccgccccc gagtcgcaac aggagacgga gcggccgcct     63420
     agccaacatg gctcttcatt aagcgtgcca tcggaccgcg ggaagaaacg aggcatctcg     63480
     cccggacgtc gcttcaaaaa cgccttcggc tccaacccgg ataagaaagc ctctaaccgc     63540
     gatcgagcat catctacttc tagctccaaa ggcagtagaa gaggcagctt atcggcgaag     63600
     agagctcaga ctgttgttgc tgaaccgcca ccacctttgc cagctcccat tcgcaccgat     63660
     cttaaagaag acaagccact cccttctctt gactttcctg ctccgagaac acccccgcat     63720
     accgccattc cgcatcccca gaccactgta actcctccca ccccgaatac cgaatttccc     63780
     aagctcttca cctcgccaga tgtgactcga tcgccagatt ctatccactc gaaagattca     63840
     ccaggcggta tcgttgtcag cccttcgggg aatatgatct cccaccgacg tgtgcggtcc     63900
     gcctctgctg cgagccacaa gcccagcaag ctgtcgaact ccatatccgc gttgggcccg     63960
     acaattgaag agaccaaagc aagcgcaaaa tcaccgggcg ctatgcaaac cgggttcttc     64020
     tcctccgtct tctccgccgc acagaacgca gcctcgactc tgagcagtag tcttaactct     64080
     cagtcaaagg gtcgcaatgt tacacaagga gctttgagtg aatccgagaa ccagcctgct     64140
     agtgagggag cgcctggccc gagccagccc atcaacagca agacggaaga gaaaaagccg     64200
     ctggccgtcg acactctggg atctggcgac ctggacttta gccatctgga tatcgccata     64260
     ccccccggtg gttctgtctc aacgccggat ggcgttgtga tcaccaagcc agacttgccc     64320
     ttggagaagc gcaaagtgtc acaacgcgat gaagaagcag ccaggcttga agatagtcgt     64380
     gcagcccgag cagtcacaat ggcctacgaa aagccctctg agacatcgtt agttccctcg     64440
     acggatgacg gcctcgacct acaatctagt gcttctttca cgaaggaagg cgctggcgac     64500
     caaactccac caagtggcag tatactcgat ggggagatcg gtcatactcg gccctatcgg     64560
     agtggaagcg tgcgaagccg gcttgcccgg cggcggcacc gtgggtcctc agcagcaact     64620
     acatcgacac tcggcgcaat tggtgccagt gctattactc tgggcgctcc ggctgccaat     64680
     gccagcatgc cccgactgac tggctttgct gttgccagca aaaagcgaaa cagggacttc     64740
     catcaactgt tccgcagtgt gcccgaagac gattacctaa tcgaggacta cagctgtgcc     64800
     ttgcaacgag aaatcatcct agctggtcga atctacattt cagaaggtca catatgcttt     64860
     tccagtaata ttctgggctg ggtgactacc cttgtaatca gctttgacga agtggtggcg     64920
     atagaaaagg agtccactgc gatggtgttc ccgaatgcca tagctatcca aacgctacat     64980
     gctcggcata cgttccgcag tcttctcagt cgagagtcta cctatgatct catggtcaat     65040
     atttggaaga tcaaccaccc atccctcaag agctctgcca atggaaccag ggtcacggat     65100
     ggcaccggcg ataagactga aaaggctggt gaaagcgatg atgagagcga ggaagaagac     65160
     gagatctacg atgaggacga agaaggcgac aatgctgata gcctcttcga agctgccggc     65220
     gccagcgtca atgggagcga caagtccatg cctaccaagc ctgttagccg caaagcttca     65280
     ggtgctctcg ccaatgcgaa tggggctgga caggctggag ccaactccag cggtgacggg     65340
     aaaggcagca agtcgggctc acccgctgat ggtgacactg actttcctgg cccacctact     65400
     caccctccca ctgagtatac tgatcctgcg ggccaatacg ataaggtggt aaaggatgat     65460
     gtgatcccag cacctctcgg aaaagtctac tcttacgtct ttggagcgca gtccggtgct     65520
     ttcatgacaa aattccttgt cgagaatcaa aagtcgggag agctccaatt cgaaaccgga     65580
     aacaagggtc tcaccaacga cagccgcaca cgcaactatt cgtatatcaa gccgctgaac     65640
     ggttccattg gccctaagca gacaaagtgc attagtactg aaactttgga tttccttgac     65700
     ttggaaaagg ccgtgcttgt taccctgggc acccagacgc ctgacgtccc cagcggtaat     65760
     gtctttttga ccaagaccaa gtacctcttt acatgggcgc cgaacaatca aacacggttt     65820
     ctcatgacgt gtaccatcga gtggtcaggc aaaagttggc tcaagggtag gtccactata     65880
     tcgaacgacc cgcaagagct gtgctaacag aaagcaggtc ccattgaaaa aggtgcgatg     65940
     gatggccaaa ctgcatttgg taatgacttg gttgctgctc tgaaagccgc tgttgttcct     66000
     cgtggccgca cgggtggtgg caagggcaag ggcaagggac ggcgcaagaa gagcgaggtc     66060
     gctcaggagg cggcggctgc cgctgccaaa gcagcggagg aggaacgggc acaacaggcg     66120
     aattcttggg gagtcttgga gccgctccat ggactacttg ggcctgttgt ggacacagtc     66180
     aagcctcttt tgggtggaaa cgtcgcaatt gttttagtcg gcattctgct cttcttgctc     66240
     ttcttccgcc gcccgtctca gccatctgtg gtatcccacg atatcgggtg tcctggttac     66300
     tcattacccc agcgtctggc cgcctatgaa gaaatgtggc ggcgggaaga aagcgagctc     66360
     tggagctggc tggaagacag ggttggcatg gacggactag ccatacccac tgtcagtcgg     66420
     tcgacgggat ctcggacaca gcaatactct cgcaaagtcc agagtgaacg tgcactggcc     66480
     agcaaagtca atgaagagaa aatgtccgac ctcgagatgg atcatgctat ccgcactacg     66540
     cgtgaaaggc tcgacactct cgagaagatc ctcctcgacc ggcgatccca acctgcagcg     66600
     gaccagggag tcgtccacag cgagctgtaa ggccgcacca ataacaaata gtaacagtcc     66660
     atctccactt ggagaatcgg gttgaaaaaa ataactccat tttgtatgat gacctttccg     66720
     tcccatacgt ccctcgttac cacaattttc gttatttctc ttttcatttc ttgtcttgtc     66780
     agcgacttgc ggtgtttagg gcggttacat tcttcccttt cacgtgttcc ttctcatcat     66840
     acagtcggat tcaaatcgag catcaatctg ggatttgtat gcttagttta gtatcctgag     66900
     cgagacattt gttgttctat tccgtcactc actctttctc tttgttccac tttctccttt     66960
     cttccatgtc tctatataca ttcctccccg gtctgaactg tgtgtgtgat tactacttgg     67020
     ctctgtggaa aagagagcac tttgtacatg agcaccaact atttacatgt ctatatatat     67080
     actatttcga ctcatactgt cattaccttt ggtgctttga tggggttgat tggcttgtca     67140
     gtcagttgat ttgtagcgtg ataagtttca tagtatataa tagtaaccaa ggtctgcgtt     67200
     gatgaagtaa gaattgagtt actactagta aacaaaccgc tagtagttta ttagctttaa     67260
     ccagtgtgtc caagtactat gtatagatag caacagccac tctcgtcttt gttaataatg     67320
     caacgtgtat atgcacatca agtaggtagc taaaacgtcg ctgacggaca gaaacacgac     67380
     cagaggaaaa ataggcaaat gatctgctcg taatagtaga aacacgtgac agatatatag     67440
     aaccaatagt agtagtacag agatccaaac atccatttaa tcatctatga caattgcaga     67500
     tcgaacatcc gtgttttgtt cggtggaagc aaatatatag aaaagaggat aagaacagta     67560
     agggtgctgg ggatatcatt gttaatcaag ctaagaatgg ttgagttcat cgtaaaggtc     67620
     gtgaaacgtg caagcaaggg ggacataaaa ttgaacgcat gtgtactttt gaccaagtag     67680
     catcttatga ttcatactcg tcttctcttg gttgtgagag tgacagcttt cgctgggaag     67740
     agatcgaatg ggaacgtgac acgccaccat tctcggcgtt tcgcctctct tcttctttcc     67800
     gcttcttctt tcggatcttc ttcattgctt cctcggttaa ttgctggcgg aagaggcgct     67860
     ccacgacgtc tttcttgcga gtcatgcggt cgccaatcat gatcaggaca ccgccggtga     67920
     tgttgcagca gatagagcag cagaggatga cggttgtcaa ggcgaagggg cggacgtggt     67980
     agctgatggc ccacgtgcag gtgcctaggg cgatctggaa tagggagtgg cagtctagga     68040
     ggaccacgat ggcgatgagg agacgcatgg ggaatgcgta gtgggtgaat gtttcgtggg     68100
     gtttgtagaa ggtgtgggat ttagagagct tgttttggtg gtgaatgagc tttagttgtc     68160
     gcacggggtc gaggacggta aattcatatt cttcgccttt cggggtgtcg ccgagttcga     68220
     cgtcgacgtc tgtttctcgt cgtgatggga ggtcgttctt gttcttgaga tccgggagat     68280
     gtcgtttgcg tcggatcttc catgtcaaga acgtgtatcg agcgacgaag atcatgtggt     68340
     aggtgtcgat ggctcggaac ggggccagcc cgtcacccat gattgcgaac aaggctacaa     68400
     ggacgttgtc gatgacgtta atgatgtagg attgcctgcc cccgacattg atccagcctg     68460
     gtattaagtt agcattctgc tcggttattc gctgggtaaa tgacagtcac gtaccaatga     68520
     ggaaaagtac ccaggcaaga ccgaaaagcg tgatgagtgt ggcatataga gtaactagga     68580
     atccaagcgc tgcggaaggg gtggtcagtg gcagataccg gaatctgaaa gcgctataac     68640
     tcacgctttg atacatattt cctaaacccc ttcattgaac gcttaaactt tgatcgtcga     68700
     gaatgcagca tgtgccggac atggtcatta agctcttcga tttcttcggg gctccagccc     68760
     gcaagattgc tcccctcagg cagcacagca aaccgaggct cctccccctc gccgataaca     68820
     gatgtaagtg tgtgttctat agatggacga acttcgggct cctttatctc atccgctcgt     68880
     tcctcgtcac ttgtagattc tagttctctc atgggtgatg gcggcgagag cgtataagtc     68940
     tggttgcgat tcaaaagagg ccccagattc gggatgaaca aggaattctg aacattcgtg     69000
     agggtagata aggccgacac ttccggatct gaaagaattt aggctactat accacgaaaa     69060
     ccatgaaaca ggtaatgggt agcttaccaa tgacgtccaa aacatcaaca atatgagacc     69120
     gatattcgtc gtccacctca tggttttgag ccggagcact tccaccaacc gtcgacgccc     69180
     gattccgcgt gaatcggttc acccccattc cacttgccca tcgcatgggg gtccgactac     69240
     cccgtctcgg tatctccggt agcggaggga catcctccgg catttgttgg tttgatgccg     69300
     aggaaacgat ggggtgcgac gtctcctctt gcaccgggcg catctggccg cccgtcgtca     69360
     cccgtgccag agcagccggg ttgggcgtag accatcgccc aggtcggggc tcggagttgc     69420
     tgcgacgacg attgccctgc catgactcgt cttcggggga agctgctggg atggcaggaa     69480
     gaggggacag agtggtccca ggggtcctgc tggtatcgcc attttgttgc gattgctgtg     69540
     agcggagcgt ggatagattt gcctgctcca acgaaggcag gcgttggagg cgaatggacg     69600
     ggcggcggga acgcagcgag gccgcacgtt gtcgggggta tgacgtcggt ccgggggagg     69660
     gcgtggccga cggtggctgg ccttcgtggg gatcaggcga gccgttgacg ggctcgatgg     69720
     ggtccattga agacggcgtg cacgaagaat tctcacatgg acgacggggg tttctcgagg     69780
     gaagaggagg gaaaaggaag taaaaattca aagaggcgaa ggatgaaagt gaaaacgaaa     69840
     ggggccgcaa aggctaatct atttattgga ggatgggatt tgctgccagg aagctgccgt     69900
     ggttgcgccg tcgtgactaa gccagtcagc catcaccacc ttaacttgac tagtgaacaa     69960
     gtggatttgc cgatcctcca aggcttgtcg ttggactttc ttgttcctcc agtgatgaaa     70020
     cttgcaggtg tgcgctgttc tttcatcttg gttcatgcat cggtatatat attgacctgg     70080
     aacatatttt ttttttttca gctgcagtca tcactctctc agagagaata atcttatttt     70140
     tgcctgttct cacccactgc ggtctagccc cccgtggact gccttgggca acaaccgtgc     70200
     gtcccccatt gctggatcct caatcgtcca ctctttgggc cctctcgtaa tcaatcctac     70260
     accacagaaa cacaaaggac tgcaatttgg cctttttcca tgagtaccga cattatatac     70320
     acatagtttg ttcattcaaa tccttatccc tgcaatggcc ttcgattttc aaacatcaac     70380
     aaagagtgct tcgtctgact cgatgaaaac gataattccc cacttgaaag acccgactcc     70440
     gttcagtgcc caaccaaagc ctggtgacgc tcaccatatc tatttccctg tggcttggcg     70500
     gcatcaatga tcttgcgcat ctctgctttc tcctcatctg tcaagtcaat ctcccgagaa     70560
     gcccagtttt gctccaatcg gtgggccttg gttgtgccgg gaatggcaat catgccttga     70620
     gctgcaaccc acgcgagggc gacttggctg atagagcagc ccttcttgat tgcgatcttc     70680
     ttgatttcgt ccacaatctt cttgttggcg tagaagtttt caccctggaa tttgggggct     70740
     atcgacgttt agtaggcata acacgcaata ccaaatgggc aaggcaactt acaaccgcga     70800
     cggaaatcgt caggtgcaaa gtcatcgggc gtctggaagg ggaagtcgtc cacaagccag     70860
     ccgtgtccca gaggactgta ggccacatag gccactccca actccctggc ggtgtcgatc     70920
     agaccgtccg tctcgtggag agtttcaaag gccgagtatt cagcttggac agcgtcgatc     70980
     ttggcaactg ggggaaggtc agacattgga cagccatgaa ataccagcag aagcactcac     71040
     ttgagttggc cttacgcagc gtcgcagcag agcactcaga aagaccgatg tacttggtct     71100
     tgcctgcctt gcggatctca tccagagctg ggatggactc ctcaagaggg gtgtctgtct     71160
     tgggtcagcc agtctgaaag agtacatggg tgcacagcac gtactaggat cgatacggtg     71220
     gaggtagtat aggtcaggtg tgaagcctag tctttcaatg gttccttcaa tgtattcctt     71280
     gatgtgcgag gcagagttgg tgacggtaaa gtcttccact ttaaatccgc actttgaggc     71340
     aactgcattg tggtcagtat cttactgcat cagtgggcta ggtatgtaca tactgaagat     71400
     cttgtcgcga acattgtgct tgcgaatgaa gtctcccaga agtttctcgt tcacacccgc     71460
     ttggtagata acctgagttc atgggttaga cacccgcatc tcactgaagg aactggcggg     71520
     ctaaactcac ggcagtatcc cagaaagtgc atccaagctc gatagctttc aaaagaaccg     71580
     gctctgcttc ttcaagactg aggttgcttc ccaagccgaa gctgaggccc atggcaccaa     71640
     agccaggtga cgggacctga atgtcttgga agggaagtgt cttgaccatg ttgacggagg     71700
     atatttgata tttgatagtg ttgattgctt gagttgtgtt caaacctcga gaatttgaga     71760
     atgtttcgca aggaggggag gcggttctta taggaacagc tgtagggtca tgacatcgcc     71820
     catggctctg cttccgggtg gaccctgtcc tgtccagcac aggcctggca tggaaccctt     71880
     ctcttgccga ttagccatag tagcaatggg attcgcagga tggaggtcga gtttccactg     71940
     ttctgttgat tgtagcttct cgcctccagt atagtttcag actatggtac cacagatcgc     72000
     ctatgtgggc agcttacacg ctagtcgcgg ggagtatcaa gttgatgacc gcttaactcc     72060
     cccaaaatcc gttaaatccg acacaaccga ggatctgtcc atattctgct gataaagtga     72120
     agtacccacc ttgaagtcat gatggatatc atggaactgt atcatatctc aaaagcatgc     72180
     taaacctctt tctggttcag cgcatatgca agggtcagct tttagttcca actctagtgc     72240
     cgatgcgggg tccatatcca gccagtggca attctccttc ccgacggata ttccacggaa     72300
     gacctatatg ctgccggcaa tcctgcgact acataacgag ccaacagccc tatgtcgatt     72360
     gtggatgttt ctggatatcc tatgaggctt caaattaaca ggccgtgttt ctcgctgtac     72420
     gcatcgaggt ttagtttgtt caattaaagc tcccagaaag aaatatacct ccacgagatg     72480
     atgcgagatt tgaccaaaac tgctatattg ggattgtgta caacacgggt agtccatgat     72540
     tgctgggtat gtctgagcca gctctgaata gcaggggctg tgatgcgtat cgcgctcgat     72600
     ccaacagccg catacttaag cttattggtt ttgaataaag cagccacata acctaagctc     72660
     tgctatcagt aatacatatg atttaccaga gtctttaagg gctctagtat cttctgctcg     72720
     cactttgtca aacatagcac tcggaattga ggcggaagcg agatcgtcgc caattcaaag     72780
     gtggagccgt cggcatatca tcgctgttca taatgtgtgc cgttgatgct agttgcggcg     72840
     cgcttggctg gcaacctcat attgtggctg tgaggatagg tttgattcaa gaatccacac     72900
     agcgtgtacg cgctttatcc tatcaaggac tagatatagg ccactgtcac gcacatgtct     72960
     gcagtactat ttgatgtagg ctctagccga attgctgtca acacaaaatg cggccacttt     73020
     tcctcaaggg agacatatca tggaaccact agatatgggt agttcttgct gtatgccaat     73080
     aatgcgcaca gcgttgagca agtgatttcg tttggtgcag ggaatgagag ttcatgatcg     73140
     atcgacctga tagcaatgga gataccttgc cgtctcctga aagcgatgcc tttgttggta     73200
     cggaaaaaaa gaaggtgagt ctttcggatg ggctacttgc ttgaatattt ttcagagtgt     73260
     gccgcgactg gcccgtgact ttccttgggc acgtggtgaa gcactcagtc cccgcaagaa     73320
     tgctgacttg gcttgggtag tagaatgagt tatacactta cagttgaaga ttcatactcg     73380
     cttttctgtt tccggtgtgg atctcctggg tgttcctatc ggagattatg agagcgccga     73440
     ctccaaaggc gctatctccg ttcattggat ctattatact aggtacgatt tgtagacaaa     73500
     gtccgttgcg agaccagcat tgcatatcta ttgcctatgg agacattcta gcggacaatt     73560
     cacagcatcg atagttcgga gatatcctga aaaccagact ccaggctctg tcgcactgct     73620
     ccttgtcacc gggcgaagtg tccgacccgt tgtctttatc aacaataaac tgtcgcaatt     73680
     cattgctctt ctctattact actagatttt gacaatcctg tctctagagt catccactaa     73740
     aactcaaccg ttattgtcca gcaccgactt attccatgac ctgtctgctc acaaaattct     73800
     ctactagcat cgaaagtaac tcgttgaggt cttgacgatc aacaaggaaa atataaatat     73860
     caatgagcag aatcacgtga acatgatttt cattcattgc aagagcttat gttgtttggg     73920
     tactatagtg ccaaagatgg gaagattggg cagtagaccg aaagccacca gtgaaagtgt     73980
     atacagattg ttctattaat atatcaagat agacccacaa tttcgtaaag gacgaaaaga     74040
     aattatggac gccaacaaat gaaacaaccg cagaagcaaa tatgcgaata gctgccgata     74100
     agcacactat tctgaacgct aacctaacta cggagtacaa gtaagttcta tgttatcgga     74160
     taagaagttc ggatcttgat tctatcgtaa gtttgttttt actagctact gcatttccca     74220
     gcgatagttc tagagtgtcg atctgttgtc ctaattactc ttcactagta acctgaagag     74280
     gaaaggcggg tttgatgtcc gctgtaatgt ggtaatcatt agggaatcag aatattacaa     74340
     tgattcggat aactatggct gcagtgtgac taacgtgttt cgatataaga tgagatatta     74400
     ctaccgaatt tgttgaaagg atccgaaggg tgggaggggt aaagagggga aattgaaact     74460
     gaaggttgca tggtggcaga cagcaccaaa acctcgcccc aaagatagta ctgacaagaa     74520
     ggaaagttga taccaaaaat tactttggtg gtatgatgaa tcaaattgac catcaaaggc     74580
     acggatacct agcattgttg atgcggtgct cgcattgcac gcaaaaatat ataccccgcc     74640
     gtgtccagat tacacgtcgc taatcctgaa ggccaataat ggaacttccc gggcagttgc     74700
     aggtaggaac atcatgggga ttgtttggga ttgggcgggt gtcgggcgat ttcgtggaac     74760
     ggaaatagat tggttgaagg gtgattgacg gggtgcgtca tgtgcttgat gtctcggctg     74820
     caggggggga aatcgggttt gcaggatgca tagtacagga gtgacagacg acactctgca     74880
     gttgattgat cgagctttcc aacaccccat gtttagctat caaaaaacaa cattttatgt     74940
     tgtgagagtt aggaattaca gcctcattcg ggagaaatat tgccggtact actacgacca     75000
     tcatcaacaa gaaggggtgc aattgattgg gaagaacact gccgggtggg aatggatgga     75060
     gtggcgatga cgggagaggg cgatctggcc agatacaagt tggcaagtgg ggatggggct     75120
     cgcgggcagc ctgactaatg aggatgaact ggcgactgca ggtcagggag taagagtaag     75180
     tagtaatgat accattgtgc gtaaaattga ggagttgtat tccatgcgaa tcattgtctt     75240
     tgttttttta ctggtttgta ttttgtgcac gtgggatgga agttactcga aatggctgaa     75300
     tgtttctcag ctctgacttg ggaagcaacg atgcttctcc ccaacaacca ctagtgttag     75360
     tggaaagtga gttcatggga agagtgagtc aacaaccggt gatgtcagat cccctgcgaa     75420
     gggctccagc tgctccatcg cgtctaaact gctccaggga aggtgcctga gggccgccca     75480
     gaccgccgga cggaaagtcc acgtcgggca ccccagaata gtctagcgcc atacggaact     75540
     ggtacggctg gccagcttca aggcatcttc aggcagatct gggctgatcc aggcatcttc     75600
     aggcaggaac ctgccccctt cggcataggc ccgccaccgc cctcgctgcc tgcccttttt     75660
     ctctcacctt ctcctttccc cccccccccg tcgacttcat ccttcctctc aaggtaaatc     75720
     ttcatcaagt ttcaatccag atttcccccg tcaactctcg tatctagggc accaagctac     75780
     ccttttcctc ctatctcccc cccctcttca agctattccc attcccactt gctccaagga     75840
     atttcaagta caggcagcct ttagctctcc tgagtccttg tcttaaccgc acacacaaac     75900
     ccggtcaaga cttccccgcg cgcaacttca ccaccgttca attctctcca cgctcaactc     75960
     cgttgcgtcc tcagccatca agatgtctac tgccgtcgag aacactaccg acaacgtcgc     76020
     ctctgctccc gccactaccg cccccgaggc tactaccaac ggcactgctc ccgcccctgc     76080
     gcagtccacg gacgctgccg ctgccagtgc cgatgaagga cgtcggttgt acattgggaa     76140
     cctcgcttat gcgaccactg agggggagct gaaggagttt ttcaagaact acaagatgta     76200
     agttgcttga ccttgctttg ctttgttgtt gttccacctg gcctttcgcc tcccggttgg     76260
     tctaagctcc gttgggctgg tcctagcggt tcggggggcc ggcgagagcc acgtttccta     76320
     cacccccttg ctgccatcgg aggtagtacc gcgcagcggt ggtatgtggc caccactgca     76380
     gggacgccaa ttgttcagag ctccatttct gaaccccttc tttgtcaaac attcttatgc     76440
     gggaagttac accgatctaa caatggctct ttcacagtga gagcgtctcc atccccgtga     76500
     accctcgcac caaccgtccc gttggctacg ccttcgtgga cctcgccact gctcaggagg     76560
     ccaccgctgc tattgaggag ctgtctggaa aggagatcct ccagcgtaag gtctctgtgc     76620
     agcttgcccg caagcccgag cctgctgagg ccaaggccga gggtgctaca agtggcggtg     76680
     agggtgccag cggtaacgag ggccgcaaga gggctggtgg ccgtggccgt ggccgcggcc     76740
     gcggtcgtgg tcgtggaggc cgtctgcccc gtgctggtcg ctctgtaagt ggctcgtcat     76800
     tcatgctcca tccaatcgga tactaatcta ccatgtagca ggccccagtt cagaacggtc     76860
     aggaggctgc tgagcccacc aacgttcccg ctcaggctgc tcccctgact gaggtcacca     76920
     accagaacga gacggctgct gccaccgagt ccaagcaggc tggcaagccc cgtgctcctc     76980
     gtccccagaa gcagcgcggt cctcccgagg atggcattcc ttccaagacc aaggtcatgg     77040
     tcgctaacct tccttatgac ctgaccgaag acaaggtacg gatgatgatt tcagagttta     77100
     gagtaacata ctaattccct ctcagctcaa ggagatcttt gtcgactacc agcccgtctc     77160
     cgccaagatt gctctccgcc ccattccccg tttcatgatc aagaagctcc aggctcgcaa     77220
     cgagcgccgc aagggccgtg gtttcggttt cgtcaccctt ggctccgagg agctccagaa     77280
     caaggctgtt gtggagatga acggcaagga gatcgagggc cgtgaaatcg ccgtcaaggt     77340
     cgccatcgac agccccggca aggaggacga cgccatcgcc cctgctgaga ctgagaccac     77400
     cgagcaggcg actgaggctc cggcacagga gaacgctgct cccgccgctg cttaaatgac     77460
     aatctcgttc cccacctgaa cgaacacacc tccgtggaaa ctcgggggat caattggagg     77520
     aggtgaagtc gggacctgtc atctgcatgg tttttcatag tgggcgtcgg ctggaggcca     77580
     atttcttttc cggatgggga gaaaggcgca agagcagagg ggaaaggttt aaaagcctaa     77640
     aaaactttga ctattcttcc tgtttgatct ggtcctaggg ggttcttcta tatgttatat     77700
     acggataccc gaaagggatt cgttgttgga gatgaaaatg ccgtaatgtg attgtctgac     77760
     ggaacctgac ctttgctcac gaatcttgcc attctgccac actgtgtatc ttagcaatat     77820
     ttatttagct tatgattagc cgcaaggctg gccttgtaat attttgtgca tgtgtttatc     77880
     gtaggattaa attgcactcg ctgtatctgt tcaaggtctg ttctgtcgtg acactttata     77940
     gcttctcact acataacaat ggatattgta ttccgagtat atagtaacag tgtcaggagc     78000
     agaactggat agtagtacat agcggtactg tcatccccat cgaactaact tccccgcatt     78060
     gcatcatctc caatatgtaa tccaacgcct ggattcgtgc caatgtggcg agaagtgtaa     78120
     acaatccact acaatcaata cggcgattta acctcatcat tattactatt tgtacttgct     78180
     attgccatca tttacatgct ttcggtgttc tagattcaat ggttatagtg gaatcaatct     78240
     acgtactaat attcagattt tacgttcttt ctacatagaa catagctccg ataagagtat     78300
     tccagtttgt acagcaaccc atctccaact ttacccccga gggacagtat ctttatcaac     78360
     ttggtgtttt attagtggca gttatacatt atcgtctgtc ttagaatgtt gcttatcatg     78420
     caaatcctga acccgagcat aaatcgaaac agcctgatcg taggtctcat gcgaggtcca     78480
     gccatccctg ctgaggattc cggacagcgc gtcccagaaa tcttgcactt cgttccatcc     78540
     ttcgctgtct tcgtagtgtt tgtggatttc gttgggggtg aaggtgatgg ggcatttggt     78600
     ggtagggtct gtgtggtgga gggtggtcca gttccttcgg agatgtgttt tagtaaatgt     78660
     agggatatat cgagtacaac actcacttct gaatcctgat taatgattct cgtagaggta     78720
     agatatctca gttccatgtg tttcctacaa agtggattga atgagttaat atcttgccgt     78780
     tggggtatcg gagtactttg tccaggagtg ggtttttctt cgctgtgtat ttttcgtaga     78840
     ggtatagtag gattgatcgg gtgatctcct ctgaggtcct tttgggtatc gttatccctt     78900
     aggtggtttg agtagcaagt ctccggtgta gtcgaggaaa tgcggatggc ggccttcgag     78960
     gaacaatgga ccagcccatg tgctttgcca gtctattatg cttgtgatgt ggccgctgtt     79020
     gtcgacgaat atgttaggag tgcggaggtc ggtgtgccat aagaatgacc ctaggatgtc     79080
     tttatcctgt gggattaggt gaggagtgac ggttaggtat ttttggagaa gggagatgtg     79140
     ttcagcagga tcgttttggc tgtaggaact gaatagcgga tcatctggtg agcgtggcat     79200
     tgcgtgttcc ttgatccagg atattactcg atcggcgaga gcacgtatgt agtcgattgc     79260
     agaagtccct gttttgatta gtaggttaga ttagagatag gaaactggtg agagagacga     79320
     acatggtcca cgatcaatat tcatatttcc tcgctcattg ctccagaagg ctgtatcaac     79380
     aaccgggccg atggaaaacc tctcagcgat cttctgcctg acttctagtg ggtagttgtc     79440
     tccttcaact attgcaggtt gagatccagg aagtgtgtct ttctgattat aaagacagcc     79500
     atatctagtg aagttagaaa tcacaccaaa ttggtccttc attatgggta tacaaacaca     79560
     gaaaatctca ataatagcaa cttttgctgg aattttacta tatccttcat tgtctgaacc     79620
     ttatgctcaa gatccatgtc cgcccagacg tctgcaagat tgctacccgt agcattctcc     79680
     atgacaatat actcagctcc tacacgattt gtagaattga cagccgaatt ccacgcaagc     79740
     acctcgggaa ctggaatatg aagtatggtc cttaaccaga atccaagtaa gataagagca     79800
     tgaaaagggc cattagcacg accattggat ataaaatact cacaagatcc atcgtagcaa     79860
     cctcagaagc cgtcgtcaaa attgttggtc cagcattcgg atttggtatc cgagcgataa     79920
     ccgtcttcct attgtccatg atgagcttga ctgatttatt gtacgatcct ttccctattt     79980
     ttgccatact gagacagcgc tcagaagatg aggcttgaat ggcaattttc tgcagctcaa     80040
     gaatgttgaa ttctcggtat ctctcttgta gttgctgctt ttcgtcccag agccatcgtc     80100
     cactagtata tcggaaaaag tcttgggggt ttccgacgat gttagacaga ggaggttggg     80160
     aataatgtcg gcttaagaga ggttctggga ttatctttct ttgccgattt gataggctat     80220
     cccgcagtct tcttaacgta ggcgaggata tgtgcatgtt tatcccacga tagcatgaac     80280
     tatggaaatg gagtattgaa aggagcacaa cgtaaacatt gtatggtaag ggtttcgtag     80340
     tgaggcagat aggtggtatg tgtaagtgga aattgttttg gtcatgggca ctagtgtact     80400
     tcttgattta agggcgcatt gatttagact gattaccatt ctgacataat aactctgtca     80460
     agaactcaat agaatggtat atattgtaag cacaatgact atataccagc tctatatgct     80520
     atgaagctgg aaacatccct gtatatactc taccgccatg tattatccca cccagcctgc     80580
     tcgacaacaa atgcgatagc caactcggag aaccgagcca tgtgctggca aatcgttagc     80640
     aagaagatgg acaggttgag tgcggtcaac ttacttcgat agagaagacg cccgtttcat     80700
     cgtcaacgtc catcctatcc ttgatgccgt gtacgtaggg gtccatttca cccgggaaag     80760
     agcccccagc gagcgggttg ccttcggatg caaaggcagc ggggtagttg agcttagtgt     80820
     atgacatgta gtcggatcca gcgttgctaa gaaatcattc agcacttgac atgcctctgg     80880
     ggatattctg gggtcttacg ggccaagttc atagacttcc gccggaatgg agatgtattc     80940
     tcgactgagg ttgagggccc agtttgtgag cgctgcatcg gcttgggttg caacaaaccc     81000
     gatggtctcg gtggcgttac gggcaataaa agccgtcata tcctatgcag atgttaataa     81060
     ccgaaagtca aaagtgattc caagtccgtt ggatgatggg aacctacaaa ctccatcatg     81120
     gcatcaattt tagcgccctg ctccttcttg taccgcgcga tggcttggct gcccagtagc     81180
     ccggcctctt cagccgcata ccaatggaat tcaacaggcc cgtccttggg cgtgtagcca     81240
     ttctccgcca gaacgcggaa ggcctcgagg atactgacag tgccggaaca gtcatcgtca     81300
     gcgccagggg cgggcagcag gggaaaaaga taattggccg aatcttggtg cgcaccaatg     81360
     atggtcaaag gttgggagaa gctgcgaact ttaggctcga agcgtgcaat aattgaagat     81420
     tggcggaaag gatgggtgaa gtattcgaga gagatgtggg tgcggaaagg cgatttggag     81480
     atgatcttgg ttgagtaagt tcatgttcaa aaattgtggc tgtagggggt ggagataccg     81540
     cagcaatgta gtcgtgcagc cattcggagc tcatctcgcc gtgataatca ccgtagtatc     81600
     gattgtagta ggaggtcatg tgctgcagga tatcgtgcat tcgttccgtc tcgatttgag     81660
     agaacagcgg cttgacgaga cctttatggg acagcttggg aagatctaaa gggcgttaac     81720
     acagtattaa ttacctcgac aaaagggaga ttaactagga tccccagcaa acgaagccat     81780
     cgcctgctct gcgtagaagt cctgatgctc ggtaatgtcc atgaacttct ttccgcgttg     81840
     gcggaggcgc agcttgtcgc cttcggtcat ccattccgcc ttctcttcgc cccgaatgtg     81900
     caagagacga ggttcagcta gaaaagctgc agtttcggga cgtagagaca ccattgcagc     81960
     gactgggtca gaatgagcgt tcagcgccga gagtatggcc tcgtccacga cgtgtttgcc     82020
     ctgtgtattc gggacctcgt gatccgcggc gaagactact tgcgagtcgg gaagcgggta     82080
     cggagaagcc aaagctgctc ctgcagtgct ccagaggagc aaaagagtag atgttctcat     82140
     gatttacagc cgttttgcta aggatgatca agagcgggac tatggcgcgg tgaggccttg     82200
     agtgctgagt gagctttgtg ggggaagagg agagacaaga gttaaataag ctctccggcg     82260
     gcaagggaca agcagccaac ggttggccct gtcagccccc gccggagtcc ggaaccgcgc     82320
     catttgctgg cggcccagcc tgagatttgg ggaagttcga tgcctgtcaa taacatagta     82380
     cattgccagc caaaaagtgg ttccttatcg gtggatccaa tcaggagtca ataatgccac     82440
     catctggcga aatcacctta tcaaagtgac tcatgttgag tgtaaagagc ataagcacta     82500
     tgtcaacagt gtcatgtgaa agtgctttag tgtcttctat ctactccgta ccatcgattg     82560
     ttttgtcttg ccatcgcctt gctgcaagtt cttgagtgac tgacagctac tagctatact     82620
     ttggaattgc ggtaggttat aacttacatg gaaggagatc caaagtcgct ccaaaatcac     82680
     caaatgactt tacgtgtcag ccaagcgaaa gctgtacgta tatcctcagt tccttggtag     82740
     gctatccgat cgtatgtgaa atatgcttcg ctttttctga ttgatagcta tgatgtttgt     82800
     cagcgcgacg ccgttagatc aatttactca ctcagaaata tcagacagtt tcatgggttg     82860
     cgtaaagggg tcgactatct cagttcgctc tcgtgcaatg cgaaattcat cgcgacacac     82920
     cgcgtcgcct aagattaatc aacaagaaat cttctctcta aatgcactga ctgaaaggga     82980
     tattggaatg aggtcagctc caaagagatc ggctgcaatc aagcactaca cggccttcag     83040
     accagccaag ccgaatccca agtacccggc attgcataga acctccacct ttgccatctc     83100
     tccactacac tgcttctcat gtgatggttg tctactcctg taacagaacg tattcaaggc     83160
     ttgcaaattc acggcctatg gaagattgct ctaccttagt cactgtcatt gactttcctg     83220
     aattacctct ggcaacaact ctgggaatac agacttttca ggaaacagac aatgtcataa     83280
     caagcaccat aagtatggga gcagtggatc tcccatcttg ttggtgttga gatgccgttt     83340
     gaagcccaat gggtaccata gttggctgag ctggagccat gggacggcga gtggaactgc     83400
     tggccgcatc ctcggcagac aagtcccgcc ttcaattaat tgcacccttg gacaccacca     83460
     tcttctcgag tcccatagac atcctcattt tattccctgt ctgttgcgat atctactgct     83520
     aagtggaccc ggcaggcaga gtttcatctg gcgggtggag agactaacag aagctaaggg     83580
     tagtgcctct tctcccctcc gatcggcccc tctctttctc gccgctgaac tcaccgcatc     83640
     caggggctgg agaacattga gcaattgctg cccgtcttaa tcccgacctt catctgtgct     83700
     ccctgctctt ttcgtccttg actcatcatg tcgcgaatgt gggaggttga tccggagaca     83760
     agggccaagg tatgccatca tcacccctcc atcccctgtt tctgccacaa cctccgcgtc     83820
     gacgtcggag gccttggaca acacacgctg acttccccgg atctgctctc cccctctagc     83880
     tcctccagtt ctccaaaacc aatggcaacg ataaatgctg cgactgcggc gccccttcgc     83940
     ctcaatgggt atgacagtcc tttattccta gacatgcgca gcactgtcgc cacgattccg     84000
     cacaaccgta ccgaccgaca atacgccctc cttataacct ccactaacac gaattctaca     84060
     tccaggcgtc ccctaaattc ggtaccttca tctgcctgaa ctgtgccggc acccaccgcg     84120
     gcctgggcgt tcacatctcc ttcgtccgtt ccatcaccat ggacgccttc aagacttcag     84180
     agattctccg catggagcac ggtggcaacg agccgtggaa ggcattcttc gattcccacc     84240
     ccatcacgca atccgaaggt cgcacgttcg aagattccac cataaaagaa agatacgaag     84300
     gcgaagtcgg cgaggagtgg aaagagagac tcgctgcgaa ggccgaagga agagaatacg     84360
     ttccgggtca acccaaaccg caacaaccaa agaataagga accgacatcc cggtcaagca     84420
     cacccctggc tgcccggggc ggatccccgg catcgcacga cggtgtgcca gagatgagca     84480
     agaaggaacg caacgaggcg tattttgctc ggctgggaaa cgaaaactcc tcgcgctcgg     84540
     aatcggtacc tccatcacaa ggaggcaagt tcaccggatt cgggggtgga atgccggtca     84600
     cgaacacacc caaatcgtca ggtagcgggg cggcaattcc aggattcgat gatttccaga     84660
     aggatcctat gggtgcgttg acaaagggct tcggatggtt tgcgacgact gtggggaaga     84720
     gtgcgaagac agtcaatgat tcgtacatcc agcctacggc gaagacggta cattttccat     84780
     ccatcctcat ctctgttcgc tatgtaccag taagatactg atgacctctt tcaccatcta     84840
     gatagcagaa tccgaccttg cagctcaagc gcgcattcac gccgccaccc tcggccaaaa     84900
     catgcaacac ggcgtccgtg gcgcagcgga ccaattccat cgtttcgtgg aaggccccga     84960
     cgaagctgca gccgcagctg cagcacggag aggccgcgtt gaaccggaaa gaaaggactt     85020
     ctgggactcg ttctcctccg tcgcggcgca ggatagccac cggagaaccg catccaggtc     85080
     gagtgctatt ggcaccgcgg cgatgaagac ggggcctagt ggtgctggca cttcttcgac     85140
     ttcgtctgct gctgcgtcgt ctgcaacgac gggcacgggg gcgggctcgt ccgcgacggc     85200
     gaggaagagt acggatgacg gtggatggga cgataactgg tgatgagaat agaagggaca     85260
     gggttttaga cacacacttt gttattattg ttcgggagag cctagctgga taggttgcgt     85320
     tagattggtt gctgatattg tgcattacat gcctgtttct tttgttcatc tggctggagt     85380
     gttggtgttg tgctgtgctg tgtgatgtga cgagatattc ttgcatggca gtgtgcgtat     85440
     acaaatcatg attgatattg atttcctcca ttcggtggtc tctagactgg attatagatc     85500
     atcctacttc atacttatta ttccaaacct gacctgaccc ggccgttagc cactctagag     85560
     tagataatat ttatagtcaa ttaccaggca accagtggaa attcactctg tatgctaacc     85620
     acacactgtg tctgcagtta tcattatccc tgaacaacca ccaccaccac cactcagctt     85680
     atactattct tcccaatctg caatgtattt cagaccatcc aaaaggtccc aggcagcttc     85740
     atgaagcctc ctgaaataat tatttagttt aaattataac ggcccgatct cattgacttc     85800
     gtaatggaag acctattatt cgtatttatg agcggaattg ccagcgttgc atcgcaggac     85860
     acgcttttta aagagttctg actacatcca tagtaacctc ttacctagta taggtgacag     85920
     tatctttcag catgccagtc cctaacccaa gtgctaatca ttggaggtga ttcaggacct     85980
     atccaacaat tgcatcgcag cctcttccat ggccttaatc accatctctg cgcttgtatc     86040
     tgcccgagcg cgagtttcat cttcatcagt gtccgtataa ttataatatc ttagaatcct     86100
     ctctgatata ctgcgtagta atataattct gttagcaaaa cgggtttagc gttgccgctt     86160
     actactatat acaagaagta ggcagtggga gaaatgggtt gtagactgtc aagtgtactt     86220
     ggtagaagtg gtcttgtata ttatgatctc caaggcaaag agaatcaggg tattgaatta     86280
     tcactgtact aatcgttatc gacttgtagc gaacgctaag caagggtggc tatatcggcg     86340
     ggtttcctga agaggcagaa acagtagaca gaactatgta tctatgtata acattggtaa     86400
     taaagaaact gaacagccaa gcaaagcctg ccagattgtc ctcatattaa ccttgctttt     86460
     actgctaggt tggcggactt cctgacagat gatggggatg agaatgctct ctctgtctgt     86520
     atggaggcag tggctcgcca tgtcctattc ctagctccct ctcaagctct tggaggttct     86580
     gctggtatac gacatcatgg tgcatgactg tacatgggga catgtatatt ccgaacggaa     86640
     tggtccctgt gaactgtgtt tggagtttgc acggttagtt cttggttcgt ttaggctgac     86700
     accgcatcgc gactagtata ggtaggcaga taggcaagat tgaaaaaaag taggtagggc     86760
     tagctacctt gttctgttgc gaagactctg tttcgtcctc gcgttcgcgt ccgaattcaa     86820
     cgttgtaacg tagattatga tgcaccttga tcagctccga ctgaacgtct tgcgtgcagg     86880
     cgtggaaatc ctgtggaagg tgaacgggta ttgttgaaga gtagtcaaag tctaaagact     86940
     cgggcaagag ggctcttgca ggtggttgga ccgtgtagct ctggtgaagt atgacatgct     87000
     ctttccgaaa aataagaggt agggggttat tgtagtttat tgcatccgaa gctgtgggcg     87060
     tgactttgag ggcatgggtc tcggtgatgt ggatggtgat gctgcggggg tggatatcag     87120
     atcgcgattg acctttctgc ggctggtccg atagcgagga atattcgact tgtaggggaa     87180
     agcttgctcc gaaagggatg tgcatgggga tcgagattcg gtatcggaga ttaagtctct     87240
     cgttcagatg ctcttcgact gactaggggt aggggctatg gttttaatcc tgactcactc     87300
     actcactcac tcacttatcc tgggaggtaa gcgaaagggg gtagtgggag aaacactcac     87360
     cggcacgact tgatcgagca ggttcgcata aaagacgttg ggggtccgat gaatcctaag     87420
     cggagaggac gactcgatat ctgaatagaa gtgccgatga acaacacccc ggacttcgta     87480
     ggaatgatac tcgtgcccca caccagtgac ggtatccatc atttctcggg caagaggcaa     87540
     ctcgaacgga aactcatacc ttccccttgg tagtcggaat gagttgtctc tcgacgaggc     87600
     caaagtttgg ctgcgttcta cggtagtgcc accctggcag ggtcccgcga tgatctcagg     87660
     gcgtggtcta gggagggatg agttagaatt tttatttctc tatttatctg ttcatgtttc     87720
     tttcgttttc acctacattt tcaagcttcc tactattttc acctcgatag ctttgacaga     87780
     aatatccagg ggaatgtata gaaagagttt cccagagata gacggcatgt tcgttgcttg     87840
     gtcttccgga aagactggaa taaaaataca ggatcggtca agcctagcag tgaaaagagt     87900
     caattagtct atctccattt ggacctggag tatatcaaac acaggggcgg cataccgcag     87960
     ctcgaaccga attggttttc tgttgttgaa cattcgacta tgcctccaga aacgtcggga     88020
     tacatctgtt gcagagacca gaaactgaag acgacttttg gtcctgaact agtagaaaca     88080
     ttgtccgtta aatactagct gccatacaca acttactata tgaatgtacg tgacccatgt     88140
     ggcttttgga gttggcagtg gagacgcccg agaagttcta atttcgggac agcaggaaag     88200
     ataagagaat gggatgcctc ctagtattat cgtgtagtga gtgctactca tgattgtgaa     88260
     tggtgtgcag gatttgtttt ctcataatcg gcctggctat agatagatag ctccgtgcct     88320
     gctcggtaaa tcttcctctt tcgcgcgctc tctctctctc tgagctcggg aacattgccc     88380
     tgaagattct tggtaaccaa ccaaatacat tcacaggatt ctatcggatt cttgcctaac     88440
     tgatcaatgt taaggaatcc cccacaagaa gcaacttatt taagcggcag tctgaagcca     88500
     atgtctcatc tagtggtatt cgtctccacg ccagcgaatt ttccaaggcg ttcttgaggg     88560
     gatagcagac tcgagtctca tcgacccatc catcactgcg gcagaacctc accttcaaac     88620
     tatttactac caatgcatat tctagtaagt aacagccatc aatcctacta ctacatccag     88680
     acctcataga tgaagacgat gtgagccatc tatatgtaac agaatacgag aatctaccaa     88740
     atcaagcaag aaggtgacta aggctctcat tctgtcaggt tgtcaacgat gacgggccgc     88800
     cgtcgcggga tggatccccg tttgtccact ccttggtcaa tgaactcaaa gcccagggac     88860
     actttgtcac tgttgtcttg ccaaaccggc aacgctcttg gatcgggaaa gcacattttg     88920
     taggggagat cgtccgcccg acgtattact accctgacag gctgttccaa tccaatgatc     88980
     ccctcccgct ggatcacagt agcaacgagg gaaaccatca tgaacacccc tgggtgttag     89040
     tcaattcaac acccgctggt tgtgtgcaga tcggcttgta tcacagccat gctcttcaca     89100
     gacatgatca gggggaggag agacctaatc cagtggatct ggtaatatcg ggcccaaacc     89160
     tcggagcgaa tacaacgact cttttctcgc tctcgagcgg tacaatcggc ggggctctgg     89220
     aggctgcgtt atgcgggaag aggtctatcg ccttatcctt cgagccaccg agcaagctcc     89280
     cctcttacga ttcggatatg attacagagg cgtcgaggca ttcggttcgc cttatcaatt     89340
     atctatatca caactgggac gaaggtgtgg agctgtactc catcaatgtc cctctgcagc     89400
     ctgccacaac tgctgcggga gagaggaaag tcatgtattc tcggatccgg cccaatcggt     89460
     ggctatcgga gagcccgttc cgggaggttt catccgggga tacaactact gcgctggatg     89520
     acaatgacaa gatccaatct cctccgctgc tgcgatggga gccggatttg gctgatattc     89580
     atggaagcac ggaccgcaca tcggatatgg atgatgactg gatggtgcgt ggtgggaaaa     89640
     ccaggtaggt ggccagtgag accctgcaga gaagacctag aagtgcagat ggactaatca     89700
     tggccgtcgc tagtgtgact ccgctcaagg cgaattttat gcacgctgtc caggctgagg     89760
     gcgaaattga gctagatgct tagctctctt ttgagggcgg tgggcggaat aatagtcttc     89820
     aatcgcgatg gagacggact tgcttctctg caagctaacc tgctcttccc atcgtattag     89880
     aatttgtatt agactgtgag ataatattga aatcgtagag accgacttac tcagatgacc     89940
     aatgtcctac cagtacagcc agcccactag ctcatccact ccctcacccg gtactctgtc     90000
     gcccaaccaa tggagtcctc aatctctctc agcttccggt cgcatgtacc ttaccagcca     90060
     gaatgacgcg gcatgacagt ctagagacag gcgtaacccc aacatcactg ccggatggat     90120
     tgttcgagag ggaggcaaag gaaagcgagg agatcccttt tcgggacatc gggactttaa     90180
     catttgccga ttcccgagtg cgttgtccag agaaattgct ttatttcatt tcatcctaat     90240
     ttattcttct tttcccctac gacatgccga ttgaggctat ctagattaga aaatagtcta     90300
     gatggcccat caccattctg cggtgttatc gatgtggagt tgtaacacgg tccgctgtgg     90360
     ttcgtctgcg taacctggca atttttgcga gagtcgagat ccccatccca actcactact     90420
     ggcaatattg ccgagggcaa agggtctcag aaccgattgg aaattcccac ttcgatggaa     90480
     atgcatgata tcatccccat gcgctaggta ttttgtttag tttaaaactg gaggtactcc     90540
     ggacattcct tgatgggctc gggactttta cctaccttgg aagcatctcg ttcgaccaca     90600
     atttccaaca tctgttgctg atcgagctta gcatgttctt cgctgcaata cttcagccat     90660
     acagaatgcc cctgcagctt acgaatgact gatgctacat gtttaaatcc tgtccactga     90720
     tttactttgc tgtcttctct tacaccattt catctctcca gaccttccta cttttcccaa     90780
     gttcctgaag tttatgtaca cttcgaggtc cgtcggattt gggcatggcc gtccagctca     90840
     tccgcaactt cggcacacga aggctcgaaa tcatcgagaa gacgtctaat acttaataag     90900
     aaacgaagaa gaatattgaa ctcaactata aagtatgggg tcccaaacac caaaaacaac     90960
     ctggatatcg atggtctatt ctatcatttg ccttgccctt ctcatctcct cctcactcgg     91020
     catattcaca atcatcatat atataacttt ctagaccaga cgttagcaat caagggaaag     91080
     aaaaatagta ccaaggtgat ttgcaacata cccgcttcaa caacttattc aacccaccgc     91140
     ccacaaaccc cttcgtactc tgatgaggaa caggctttcc ctccgcacga gccttctcaa     91200
     gctctttatc acctttcgcc tttcttaacg cagcatccgc aagaccacca aagaacgacg     91260
     gtttcgctcc acgagcagat cttccctcga tacccatcca gcctaggatc gtatcatcag     91320
     tgaatttccc gccggtggcc atggcaagta gggacccgct ggcggctttg ttggtggggt     91380
     ctgcgtatcg agaagtgaat tccggtttgc ggcccatggc gaggttgctt tcgggatttt     91440
     tggcgatcta ggaattaagt tagatgggtg gttgcaggag tgaaagggta tggggactca     91500
     cgaatttagc ttgatctctc ttatcatagt attcttcgac tccttccatc gcgcgatgta     91560
     ctttactcaa caatacttgg tgctttttct tcgttgcctc gtcgacatcc ggatggttca     91620
     gatcggggaa gatgagaggg gagaattggt cgaaggtaga gttggctgtt gcgttagccg     91680
     tctggtattt ttgtttgatc cggtggaatc ctttctctgg ggttcgggcg gagatgatgg     91740
     tgttgttcac gtcgaggtcg agaattgctt ccttcgattc gggggcgtag gtcatgagga     91800
     gacagaatag gccgcgcggc atgaagaaat ccttgttgat tttgtcgaag aagttcccag     91860
     atctatattt attcgtctat tagtatccgt gtgtgtgtat gtgtgtgtgt gtgtgtgtgt     91920
     gtgtgtcaat agggatatgc aaacaaacct tcgtctccca tcaacagcca taccaattct     91980
     cacagccgca tcggccacaa tacccatcac aaacccaatc gtaggattaa caaagtatcc     92040
     ccccacatta ttggccaaat taataacctg aaaccactga gacccaacac aggatttatt     92100
     agcctggtcg acataatcga gaaacatttt ctgatcgata ccaaacttct caagttcggg     92160
     tgcataggcg cgcacgaatc ctctctgccg atccttcggc cgacgctgag gcagaacgac     92220
     tggataatca agcttcggag ggccaaagtc tatagatgta tcgtagtagc tccagttggc     92280
     agggactgga taatcccgga caaaggattc cgctagcttc gtactatagt cggcgtcgtc     92340
     ttcatagttg ggggttgtag ttgggtatgt taccccgcgg agatgttctt gtgcttcgtc     92400
     cagttcccat tggcgctcga tgtctttgtc gacttcgtcg tattctcgtg aatatgtgga     92460
     ctctgtgtcg tattcgtgga ctttggttgt tgatttttcg tctttggggg agggagactt     92520
     ttcggtggga ggtagtgggt cgctcacttc tcttgatgct tgcggaggag ggtacacgtt     92580
     gtgtgctgga ggataactgt tctccattgg aggatgacta tcagggggtg ggtagccata     92640
     ttctgaagga gggtaggtgt tttgcatggg aggttgacca tgtttccagg ggtggtaggc     92700
     agcgtagttt gggggattgt tgttctccat gggagggtag ctactttgta cgggtagttg     92760
     accgttttgc actggaggtt ggttgtttcc catcggatgg gggtacccat tttgcatagg     92820
     aggatagttg ttctccatgg gaggatgaat attatgcata ggagattgac tgttgtggat     92880
     aggttggcca ttgtatacgg gaggttggcc gttctgagca ggagggtagg tattgtaagt     92940
     tggggggtgg ttattctcca tcagaggagg gtagttgttt tgcataggtg gatggccgtt     93000
     ctgcactgga ggataactat tccctatcgg aggagaatag cggttatcca tgggaggagg     93060
     atagttgttt tgcaggggag attgaccgtt ttgcgtagga ggataggcat tatgagttgg     93120
     gggatagttc tccataggag gagggctgat gttctgcatg gaaggacgac cattctgcat     93180
     ggacggacga ctatgtcccc catcctcggt atggtatgaa ggtgccacgc tttcagtctc     93240
     ttcaagggga ggcagagatt ccgctcccgc ttccgcatgt tgctgttgct ctttgtgctt     93300
     cttttcctga tacttcgctt tctgggcttt gacggtttcc gagacgaggc cgatcccggc     93360
     actggcttgt cggatgaagt aacccatgat gaatacacaa aacaaagtac aatgaaaggg     93420
     gtatatttcg cagaaagtca agtaaaaatt aatggaacga ttctgagtca aacattcaga     93480
     tcagaccaga cagaaggaaa tatttataca aaccctcccc ttcccccctc ctcggcgata     93540
     agaaatggcc cccaactata ctccgtacta gggacttcac ccgcccaccc ccatcaaaca     93600
     agggccgcgt cagcgctagg atactgaata cccccacata attggctgta ctatggcgag     93660
     aaagcttttc tttgctacgc cttactccgc tgtcacatct taacctaaaa aagtatccct     93720
     ggtgttccac ctattatggg tcagtttggg ggcgggacaa gtctgcctta gtatgtgata     93780
     ggctgattct caggcaagct ttgacaagat aattcaataa tcttggtacg gagtaataac     93840
     tggttaagta ctgcttaggt atctacccaa ctatattggc atggagaaat ttggatgtga     93900
     agactatgtc ggattcatga gtgtcataac tacatacaat agagagtcat cggcctcaat     93960
     aaaaaaacca cctcttagat tgctatagat caatcaatgt caaaattctg ccatgtaagt     94020
     gtgttgaccc tggctgattt ctgcccgaac aaagccttgc gacaactatc atctcataga     94080
     cgaaccaaac ctaatgaggc aatcgagatg ttcgggtgtg aattgcgggg gcggccattc     94140
     ctgttacagc aatgctcatc gatgcactag cttgttatgg ttagtatgct gagttggatg     94200
     ccgatctccg tctgagcccc tgcctcagcc gcagagcttt ggtggaacac atcggaaatt     94260
     gttaccagga tgtcagcctc gagcaaaact agagatgtac agccgaacat tgataaggct     94320
     agtatgatta ggggtgatca gactgtgtga aattcctcta ggagaagatc acgtggtgct     94380
     atcaagtgta gtattgtgaa cataagttct aactcaatgc ggaactaaat atgtatatgg     94440
     agtatataca taagtgtata tcatccaatt ttatagggtc gcaataacac aactattgga     94500
     acttgacaat gatactataa ctactgtcat tctattcttg ttaatatcta aagaacaacc     94560
     tacataagat gccccgcggc cggcagccga accgggccgc agaaaggaag acagagcaac     94620
     cgggaccctc gttatgacgt gttcagagga atcttgatac tgattgatct acttcatgtg     94680
     agaagatgat atagcatcag actaacctta aaactagaac taatcatccc tgtcttaaat     94740
     cagaattagc tattcttgtc gtacactacc cagtatgtca gcattaaaga tacttggagg     94800
     tgtgcagggt aatgacaact tttttcttct tttctacttt ttcttcagaa taagatacga     94860
     agtttattag aggttagaga cattcaaccc ttagagctca atcagtatta gcacgagaaa     94920
     tatcacgtgc gtgagcttat tcagaaccac catctctctc atccagccga gctgcttctc     94980
     cagttccagt ctaaaccgtt tcactattcc gaacctgttg caactctagg ccttgaccgg     95040
     cttcagactc acattcaaag gtggattatg ccaaacgatc caggcccttt ggttcgaaag     95100
     ccaagtcttg ggatccgtag cgattttgaa atcgaaatgt agaagcaagt tgcaaatgaa     95160
     cagtgacacg atgtaatgcg ccatgcttgt aaaagttagt gttgctctga tcttaggagg     95220
     aaataaatga ctagatcaaa tccaataaaa cctctacaaa caagaggggg cagggggtaa     95280
     cttactattg gccgatgcag ttatacggcc cgacagaaaa aggcttgtac gcatccttaa     95340
     catccttagt cgtaaagctg ctctcctcct ttgtattgta ccatcgctga ggggcaaaag     95400
     tctccggatc atgaaagtta tcagtagaat ggaaagccgc aagaggagta acatagacac     95460
     gtgttccacc cgccacccat ttcccagcta tagtgactcc gggagacgga accaagcgcc     95520
     caggagtaac aggcacagcc gggaacacac gaaggacttc cttgatgcag gcgtccagga     95580
     ggggcatgtc gaccatgttc ttcatagtaa tatcggaact ggtatggaat tttgaccgaa     95640
     tctcattctg cagttctttg agaatgtgtg gggcaaggag aagattggcg atcaggccgc     95700
     tcaaagccac cgcagatgtt ccggatcctg caatattcat gagtggtgca ttggcctgga     95760
     tctcttgtaa ggatatgtta tctgacttgg catctgtgag gaactgcacg atatctgcgc     95820
     gatatgagtt cgatgccagt cgtttttcga gtctctcatc tgttgtcgaa aagtagagtc     95880
     gtcgcattct gaatacttcg cggagaattg gcttaagaat gattctggcc aggggaaagt     95940
     ctgccagtgc ttgaattacg gcggcactgg gaactatgat tagtgaggcg cgcgcaaagg     96000
     cccggtgcgt cgtatcatcc aataagttaa gtggttctcc gaattgaagg tcattgatca     96060
     tatcaaaaag gaccagattc aagaacaagt ttatgtcaac cggcttggct gtgtgatcaa     96120
     tctcggcata aagcttcttg attagcttgt cgatatgctg gattatcaga ggctcctggg     96180
     cagccagtgc ttgctttgag aaggcccggg aatacaaacg tcgcagtctg gcatgatctt     96240
     ggttgttggc ggtgaccaaa gaatggaaac catattcccc tgccatagcc ctgaagaata     96300
     ccatattccg gggtatagcg aggggccaag ctgcgctact tgagtagatg tccttccagg     96360
     cgcttgcggc ggtgtagctg agctcatcgg gagccacgcg taccactggc ccgtactttg     96420
     catgcagctt ttccagtgta ttgactgatc tgccaatcaa gactagaaag aatatgggga     96480
     ggcggctgga agccatgata cgaggcccag gatagtgttt gagaggatga aagaagatat     96540
     tgtagatgat gcataagatg gagtactgtt gttcttgtta gtggatggca caagcaaatc     96600
     gctgggagga acgagagtgc tcacagggac aaaggcccaa gcaaaggctt tgagaaggaa     96660
     tagaacagat agttcgtcca tgacgatggc catcttgctc ggtagttgct tagaaaagtt     96720
     actgaggttc agagatgagg ggtatgtctg aggaaacggg tagcctgtag tagaaggacc     96780
     gggttaacgt ctttatagat acgagctacc gcttaagatt ggaaccgagg aaagcaagaa     96840
     agcagtcact caccatcatg tggtgagaag gaaattcaac atggtctcat gatctccacc     96900
     gtatgtggca gtggagaaca gaagatttga aaaagacgaa aacaaagtga agtgagtctg     96960
     gaaacagcaa gaatgacaaa ttgtgtattt gctaagtaag cgatgagctc gatatcataa     97020
     tgatcacacc gaaaccctga ggtgttcgat tataaggttc atgatatttg tgtgatagct     97080
     ttggcctgac acatatccca tagagggata gaacaagcac tcggactgac ttccccacat     97140
     tttttagtgg ttatatgcct actggaagtt taaggatcaa gcacatgcaa tggttatcac     97200
     ttagatatgt ttaggagaca tcatgcctgt gacatgtgct tgagattgct gattcgtatg     97260
     cattggccat cctttcgatg tacacttggg cactactcgg acgcacctcg ctgagtttgg     97320
     ccatatgtag atcctggtta ccaggatact tccatgagtg ttctttgttg tgttgcatct     97380
     tgtagagttt gagatgagct cgaagttggg atgccatgaa agtaaacttc cgcttatctg     97440
     atattccggg atcatccctg ttcttattag agttgcttga gattccaggt cacacatgtg     97500
     gcacatgcac gcagatctag ccaacaaaaa ccaacaatca ctgtagtatg gcattggcga     97560
     acactttata gagactaatg cagtgtgaga tgtgacatgc cactcagggc atagcgtgag     97620
     accccatctc ccgctgtctc acagatttca catcagtggg ccgaagccgg tgtgctcaag     97680
     ccaccgtgct cgcatgttcg atcttcttct gtatttgtgt aaattcatga gtttaagtgc     97740
     acgaaatgtc tcaatcagct ttatctgttc agatggatag cattcaccac gtggaattca     97800
     ttgtgaatca cgactacctg aaccaggtag cgatggatgt ctataaatac gagacttgta     97860
     aagcctatgg accaactcat aatcataaca ttattattac acccctccct caaaaacgcc     97920
     tattgacagt acgccctaac aatgggtcaa atcttctcca gtgaccaagc tcctaccgag     97980
     gctgccacca gcgacccatc tagggaattc tttactgtgg tatcggcttt tctcaaagaa     98040
     gtctttctca ctatcccaga agtcccaagc aatgaccttt tcgatgatga agtctttaac     98100
     cggttcaaac attgtggact gccctctgag gtcgtctaca ggtattccaa aggagcggcc     98160
     ttcatggccc gatgcttcta tccacaccta gaccgcgaca cccagttgtc catcggagtg     98220
     tggacatcat acatcttctc aattgacgat ctctgtgagg ggcccgagtt cagagaacag     98280
     ctcaaggaat accgcgcaca cttgcttgga gccaaccagc caaagtgggc ctaccttcgt     98340
     ggcctattct catccttgca agacctctgc gaccgctatg acccctttgt cggagacatg     98400
     atcctcaagt cctcactaga ttacatcagc gtgaacgtct tcgaagtgga gcaaaaggga     98460
     cgtctcaatg tagattccaa cacccgtctg tttcccgaat ttttgcggca gaagagcggt     98520
     atcggagagg cctatgcatt tgccaatttt cccaaaggta gtctcgacat cgcgtcttac     98580
     attaccctaa ttccggattt ggcggctgtt gtgccacagc tcaatgacgt ggtatccttt     98640
     tataaagagt cgattatcgg cgatgagcag gataccaacc tgatgcttgt atctgcagtt     98700
     gagggctgct ccgctactga ggcgttgaag atgacggttg accggtgtct tgacagtgtt     98760
     cggaggatgc gtgctgcctg tttgaagaat gagggccttc gaaatgtggt gaatgctttt     98820
     gtgcaaggtt ttgctttgta tcatttgaaa tggtcgcgtt atcatatgga ggactttggg     98880
     gattatcggg attggctata gcaagccact gaatttggcg ggtgtatgta aagtcgatgt     98940
     acgaagttgg ttttactata catgacttgc gttgaactgg ggagatcaaa cctgggtatt     99000
     tggtggccat ttttactgag aatatgcagt atcttgaaca atttttgtca cttggataga     99060
     tagttggact gtttcaagct tcagctcata tgtctagagc aatgaaaaag actattgtgt     99120
     tctcctaaag catagacacg tacatatgag cttgatctgc aaagataaca ctatccgtcg     99180
     cataattata tgcttgcaca gtctacactt gcgatagaga gatagggtcc ctggcctctt     99240
     gcgtaaataa ccgcgtttag gagttaattc cagaactggc tattctggtt gatgcgatat     99300
     agcttgtagg aactatggtc tagacatgtg cgggatggat tgaaaagacc cgggcgatgg     99360
     ctgaagatgt cgactataga gtggggcaaa cttaacaata cataattggc tcagataaga     99420
     tgagccgggc aactgaactt tgccctgatt agagacctat agatagctag gcgtcacgca     99480
     agaatgctaa agatgacgtg tctgagggac caactagtgt aagtcaaccg ctcgcttctt     99540
     attcgacaga tcggaatcca tcgacgcccg gtctccatac aggagcttct gtcactcttc     99600
     tagagcgaaa cctggacttc ggcgcaattg ccaagttaag taagtgtgtt ggtatagacc     99660
     gcattacggt caaggccagt cgatcactca gcggggcatt gaggggggga ggggattatt     99720
     gtgggtcagg gcgttggata tgttggaggc attggcaaaa gacacaagac accagggggg     99780
     tctagtggat acttgacaat tggtgagaag tgaacccatt gccatgtctg cagtgctaat     99840
     tgattgacac tgttgctgtt aatcattcga attcagtcca cagcaaggat atgcaagcta     99900
     tggtctgtag cgagcctact atcagcggca gatcaatacc tgtagacagt gaacagagtt     99960
     tcaagacaga taaagtatat gaacaggatg caaatcactc tcagcttcca aagaggggta    100020
     acatgccttc ttcgagagtt ctttgcagcc gatactagac tagaggctag ataagtcgtg    100080
     atcgcttaga tagcgacctg gggcggatcc acagattagt agttggggag gtcttcaagt    100140
     aaaacattag ctgcctaact gtacggtcaa ccctcgagga ttagtacgct aaatgaaatg    100200
     ataggtagaa atatctagta tgctgtgaaa tataatggtc tgaagacgca aattgtatat    100260
     tgttatatgg gtcaaaaatt ctaatagaaa atcatggatc agggcatgat gaagtgtgta    100320
     cacccaccaa gttgagcact ccaccttaat gtccaatata ctgggtatta tgaagtggga    100380
     gtatcaattg agaagcctgc tttcaatcta taaatacaag ttcgttacgt aggattcatt    100440
     gtgtagttca aaaaccctgc tttgacacag agtccgccgg agaaagagaa gctataccga    100500
     gcatgtgtag tatgcagtca ccaatcaagc atctggcatg gggctgctta tcaacactca    100560
     gctatagact ccacttcacg ccacaattca caatgtttcg tgatgattat tccagaagac    100620
     gaataaagtg tgcgtccctc ccactttgtc tcctgccatg agcccactca ttcatgactt    100680
     tcggcactgc cacctcaagt tcccagctgt atattctaac tattttctga atttatcaca    100740
     aactcacgcg atatcatagt catgcctgga cggattgaag cagagcattg cagccatgtc    100800
     agcggttctc cgacattagc accagaggga cacccagagg tatccgtgcc tctctcattc    100860
     caggacccat ttaccctctg tccccgggcg agcacattgc caggttccgg tgatgacatg    100920
     cccccgtcga ctgatacatc ccattatccc ttgcctcgac gcaattctgt gtccgcggaa    100980
     tccttcgtgc ccggccagca gagcttgcca agcaccagct ttgatatgac cgaggaacaa    101040
     gcccatcgtc tcgtgcgcgc ggtgaaagaa gtctttctct tctccgccct ggacaaggag    101100
     caatatgcac aattattgag cgcctttgtc ggaaaggccg ttcctatcaa gggcaccaat    101160
     gtatgaataa ccacaggccc tcacccttag catggagcaa cacagctcac gacacgctaa    101220
     cctacattac caggtaatca cacaaggcga cataggtgac aacttctaca tcgtcgagaa    101280
     aggcagcttc gacatctaca tcaccctcgc ctccacccca cagccaacca cccccagcat    101340
     cggcaccaaa catggatccg cccaccccgg cgacttcttc ggcgagctcg cactgctata    101400
     caatgcccct cgcgccgcaa ccatcatctc caccgagccg gactgtcacc tctgggccat    101460
     cgacggcgta tccttccgcc gcatcatggc ggaatccgca ttcgcccgtc gacgagtgca    101520
     cacctctttt ctagaacgtg tcccgctcct ggccgggctg tctgggcggc agcgttcaag    101580
     gatcgcagag gcgctgcaga ctcggcggta ttgcgctgga gataccatca tcctacaggg    101640
     ggacctgggt agtgatttct tccttctcgt gtcgggagag gctcgcgcct ataaagtggg    101700
     gttcgtgggg agcgtgaaga cgtacacgtc gggcgggtgg tttggggagc gtgctttccg    101760
     gaagaatgcg ccacgagctg cgagtatcat ggccatcacg gatgtggttg tcgcggtgct    101820
     ggatcgggat gcgtttgcgc ggttgctggg tccggtggag gagattatgg ggaacacgca    101880
     gtatgagggc gttgttgatg aggaggaggt ggtgcggatt gggtgagata gaaggggtat    101940
     gtaatgattt atagatcgat ttgttatact gaaaatttac cagtagagat attaaccaac    102000
     tagctgttgt ctgatggtca atcgtcagag aatatccccc ctccatttca tgacgagtct    102060
     aaaaagatga ctggaagtca aaaatcatgc ccgagttcct ccgatgcttc aaaatggctt    102120
     actttggctc gtggctgtta ggtttaatat ttgaatatag cggtctttgc ggggccatat    102180
     ttcgtaagtt gtcaagacga agggtcaaag atatatagat ttgatctatc tgatctcaag    102240
     agaatgattg gtgtgtgttg gaagaggtgg tggtcagaga ccacgcagga agaaaggcga    102300
     aggatcagct gacagctgcc tggctgcagt gaatgtctca acataagtca cccgcaggct    102360
     ctgaatgttc aaatgcctgc tttcaacgac ataaagtggg catgaagctt tctgtccaga    102420
     atatacttta aatgtatagg aaagagtcca tatcagttat aaataaagct gtgaatgatg    102480
     ctggaaatac ttctatgata tctaaatgtc ctgtctagtt gtctcgggtt gctcagaata    102540
     cgatcagcaa tggtttcaag aatagtgagt ctatttagaa ttgatgaagt ttgcacttat    102600
     atattcatat tgggaagagg tcctgggagg tgactatcct agcctggagg ctgatatccc    102660
     gcccatcggt ctcacaagca tgaagacagg gccttgctcg tatacaggta ctagttgcag    102720
     atcgacgggg tcagtaatcc ataaatccag tggattgggt aatctgagtc cgttgaccca    102780
     gcttcagctt ttctaaattt ctcgagagag gtcaagtgac ctgtatacac catctaataa    102840
     ttacaattca aggtttcact cgctgtgacc aagcaaatca gatgataaaa catgatcctg    102900
     tcaagtaaaa taatttattg ctccgggatt ttccactaaa tagtgcgagt gtgaaataat    102960
     acagctgctt gacagctcgc atcgctaggg aatccatctc cataccccga cagcaaaaat    103020
     tccaccagta caattgagtg ttctacctgg aacctggaga gcactgcatt gagtattcag    103080
     tccttgtagc gatacctttc ctttgtcact gtctccagag tcggtaccgc acccttatct    103140
     atacgtttca cgacgccgtt gagtagatga gcgccgagtg tgggacagat cttatggcaa    103200
     gtgttcccaa aagatgcact tccggtctgg gttgctttag taaggattca tccagttgct    103260
     tgcacagagc tgcggtatca aaccggggct ggtccacgtg catgtctaac gggatcggcg    103320
     actgtaactc ccggccgcac cggccacccc tagcacatcg ccctagaacc actgtactac    103380
     ttattgctaa ttcacagcct ttaatgaaaa gagtggctgt atgtagaaac gcgttgggcg    103440
     gtgtactggg tggccggtgc ggccgggagt tacgttagta ggtactaaac agagcagagt    103500
     atttaacgaa ggatcattaa cctgtattgg aattactcag tcgaacaaaa attatcatac    103560
     acaagaaaga atacctctct gggatttagt ttggtggctc cgggcggcta ggtagccaca    103620
     tggtcaccat ccactacaca aaagtattac ttccacaaaa ttctgtctcg accatcaggg    103680
     tcttgggatg ggtgctaccc cggctgtatc atatccaaga tatgacgtaa atcgatcaat    103740
     caatcagcac tagtctacta caggctagcc gtacttcttg tattgctata cgcagtgtct    103800
     aagtaacggt cctcacttca tatcgccgct ggcacataca cacagccaag ccaccgccac    103860
     cactagcgga agtcgtaatg tagatcctta aaccgcacat ctccaatccc ctgtcgaggc    103920
     ggagaattag tcggattgcc cctcccccac tccctgtccc ccttaatcac caagacaatc    103980
     gctcgactcc tcttccacca caatagtggt aatatagtac gccatccctg ctattatcat    104040
     aatgaatagc caggccatat tcctgaggta tatacatgga gcacgctcag agaaatctaa    104100
     gactgaatag taaccctgta cagaacttaa caatattaat aatgagaata agtagtaaat    104160
     ccataaagac tcataccatt ctaatcacgc tattattctc tagaatcaac ccaaaaatca    104220
     atcatgcctt tttgttagga tttctctaaa cctgtcgtgt gtgtatagtg tatacttcag    104280
     gaaaatagcc cagctattct tgatatcaag tttattgtac tacaaaacac agagattaaa    104340
     catcattacc cagagaggta agggattgga aggaaaagcc taagtgtgga tggggggatt    104400
     cgactaaatc tgtcatgaag acgccacgat gcagctagtc tccagggatt ctgaatccta    104460
     cgcctggggt cctctctgac gactatcctc actgccccgc ccccgttgat tgactatacg    104520
     tgtgacactt cgaagagcct catcccccac cggccgttac tgtgtgataa ggttacggtg    104580
     gtactttaga tcaccatgac tgtaggagca gcttcccaac ccatacctaa accccgtgac    104640
     atgacatgct caactactac ttagtgtagt ctgaggactc tttaggacta gtgtgataca    104700
     accaactatc acggtacact tttccgacga aaggcctgaa tagtactagt aggttcttta    104760
     aggtccagca tgtacgttga cccaggcaca cagtcagaca cacggggtcg gaagagaaga    104820
     aggaagggag gactggcatt cggtcggaaa tgcagagatc cctgcgagta ctccgtgcca    104880
     ctggtactgt gcgtgctcgg tgtcatttgt ttcttaccga gtcgatacat ttcatttctt    104940
     tctctctatt cctttttgtt tcctcttttc cccctcttgc ctctcagcat ttcgcctgtc    105000
     agatgaatcc gtcactgcaa ggcgccaggc ctaaagtgga ctagtggtaa agtctatatc    105060
     tctaaccctg gaagagcagt ggtgctggac aagcaggttt cttcaccgag cgactcattc    105120
     agtttctttc gtctctgtgt gttttcaggc cacgttgggc tgcagcctgg atgcgggcgc    105180
     ctgtaatgaa gaggtgtaat catcataccg gacatgtatg atcgtatggt aaccgaatcc    105240
     ggtcgaatgc gaagataatg ggatgcttga tctggaataa aataaaacag aacatattaa    105300
     agatgaagag aaaagagata gtaaaaaaat cagaaacaat gctcaataaa ctcttcggtt    105360
     ctgctgccaa gaaaagaact acgtcatctt cacattttga cagtcctcac ttgcagcttt    105420
     tatgctacct ggcttagaat ctagactttt accagatggc tgaccggtta gctcgaatgc    105480
     actactgagg aatcacactt gaagcgcaca gaactgggtt ctgacttcga ctagtatgtg    105540
     ccagacaaat gggctgatta ccgctttcgc tactccgtac actttacaaa gatccccttg    105600
     cggccgatgc cccgagagtg gatcatactt agctcgggta gcccagtgat ccgcggaacc    105660
     gcaccccaga agatgtgcgg aaattaaatt ggttggtggg gcagtgccct cggacagtag    105720
     gttaaaataa tgtcgcagct tagcatccgg aattctaggt gcaaatattg ccaaaccaga    105780
     cagctataag ctcgttgatc ggtatagagg ttttttttta tgaggactct agatacgcta    105840
     ggtggtattt tccactacta tatctattca ccttcagtat tatggctgga gataccgcac    105900
     cctgtctaca gttttcgcaa cggtatcaac cgaggtaaaa gcaatcttat cgtttaagcc    105960
     ttccagatag gggatcaagc atagccacag acaagctctt gggaagcctt caaggatcgg    106020
     ttacctaacc gaaattcgac catcagatgc atggctgact cgcttggctg tccaattgag    106080
     accctaggta aggtattata gataacatgg tcgctgactt ctgtgtatcc ctcaacggac    106140
     gggagtgtaa cgcttgcatc tcgccagaaa actgtttttg tttccccttt tattatatcc    106200
     tttcctgttc ggggtttcct tcttttctta ttttggtgct tccatttttc ccctctcatg    106260
     gatttattgt gaatttgcaa atgtggaaat agactttggg ctccggacgt ctggacggga    106320
     acccctaccg tggaccgctt agagacctgc cgtaaactct ggttacccaa tggtttaaat    106380
     tttacgctgc agtaggagtt ttccagtttc attttgattc actcattcga atatttattt    106440
     ttctacatcc tctccatccg gttattcccc cctttcattc cttttaatca tgatcaccgc    106500
     tatgatttct ggcctgtaat tcctatttaa acccccgcct taccccaaat gaaagcaacc    106560
     agtcgaggta ccttcaacat gtgtctgcct tcctttatat agttcttttc cctctcgccg    106620
     ttgaggttct gcgtggctgt ggccgtgatg cctgtagtgg ctgtctatag tatgcgccag    106680
     gggaatacca ctctcgaata atatttgtca cgttgacaag ccacaaaccg aagattaagt    106740
     tctcgtcttg ctgggatctg tgtccaagtc ccgcctctct ggacttcgtc agtcttttcc    106800
     atcatgcgtt acacatgaga acatggctta cctgagggca cgatactatg ctacctgcta    106860
     cggggatcat gtgtcttcct aatgagtcaa tcgggcctcc atttgctact ctcgacgcag    106920
     gcacacgaag agagcagcca ttttctgctg cagctcccgt gtaacccctg ccatgattga    106980
     cggctctgat aggctgacta ttattctgag aaacttaatg ttgcctccaa cacgtataaa    107040
     gagggaaaac aaaattactt acgtctagaa gtaggtattg acaggccgaa tctgggattc    107100
     agagacctgt gactgacaat tactgaggag tactctgctt caggcaccca ccctccgcct    107160
     gtgtgacacc gggtctatca tgacccagaa tatccacata ggccttcatc cattctggcc    107220
     aatcttgaag cttgaagcgt cccgtgtctg aatgccctgt tcattctcat tatataatgc    107280
     tttctatatt cagagctcca tgaggacaca tgacatctgc agtatgtgtg cccggtcggc    107340
     tctctcgccc ctcttcttat ataaatcgtc accattcccg actctttcga tcagtcaccc    107400
     acagtccaca agttcttatt ctgctataat tccacacgcg agctgttctt ttcgtgactt    107460
     ccgtacaacc gagctatcct tttcgtgata tcttcacacg cgagctatca tggcctttgc    107520
     tggatcatcc gtgggcagaa caaagggcta cctggatttc ctcggaaagg aacaggacta    107580
     ccacacaatg gtgttgtacc gctcctatga cggactcgct tccagcaatt tcagttcgtt    107640
     cccgcaggaa gtatctttcg aagatatcag aggaaaggag accgaattct cgatacagga    107700
     acaaggattc tgtctatact ctctcagcac caaaatgtcg tatatagatt tcgacgatga    107760
     ctttgagatc cgcgcaacac tctaccctga agttaaacgg atattgcaga ggcttacagg    107820
     agcatcgatc gtcaagatat atttccactg ggtaacttgg cgttcatttc cgatccaaga    107880
     aaagctatca tatgtctgac atctccaagg tgcgcggaaa acatccatca ggtagtggac    107940
     cggttgggta cgcccacatc ggtaaggata tctacctcat cagtatttcg cgtgctgacc    108000
     tctgcctcag acacgacggg gccctcggga gcatatatgt tcgagactta ccgtgcgaac    108060
     tccggtgtag acattgcgcc atcgcggaaa tatgaatttt atacgtatgc gatacatata    108120
     cttatcattc ttggaacacc tggctgatga taatctgtag cttttgggtg ccgttgcttc    108180
     cggtacaaga ctacccatta gccctttgcg atcagcgcac ggtgaagcca gagcatctac    108240
     ttcctgtgac gcattacgat tctagcgcga cctcccagaa ctgctttcta cagcatgacc    108300
     ctgagcagag atggtacttt ataaacaacc aacagccgtc cgaggcttgg attttctatc    108360
     agggaggtaa cagggttgag aacaagcctg gtatgtcagc tatagtgttt cgattacttc    108420
     ttcactggct gtcactaatt tagtcatgct tttatcaaag gcgtgccgca cggctcgttt    108480
     aggtcgtggg atatgggctt tgatcgacgg cagagtattg aaattaaaac catggtcata    108540
     ttttgagaag tccgatacta tcatcaaacc aatatgaaag cgagggaaat tggcacttgg    108600
     gataatggag gagtttattg gacattatgt ttcttgtcta cacacggtgc aactgaaaag    108660
     aatgatttta ctattgatgg actaaacgaa ggataaatga ggtagaatgc aaataccatt    108720
     ttcaatcatc aatgcgatcg gatcttcaca aacggttaga tcccattttc aaggagggac    108780
     aatccttgtt ccaagtagct agagaaagcc ggaccgcgac tgatttcaat ggcgattccg    108840
     cgggtggccg acacgcgtag cactggaaca tatcctcttc aaaaaggagc aacgagttca    108900
     aagtatggaa aacacgatag gattgattcc aatgtctgca ttggcattca gctcctcctc    108960
     tgatgagagt ttggccataa gttcgcgacc cgagggcgtc agtgttattc cacatcctcg    109020
     ttctatcaac gtatatatct cctcatggaa ctctcgcttc tggcgctgta gctcttcatc    109080
     ttcatcttca ccagtctcct tgggattcag atggccaaag caatcctcgt ccggtatcac    109140
     gcaacaactt tcagcatgca tgttttcccc atacacccta ttgtgctctc gtttctggag    109200
     ccgcagccct tcggcttcgc ttgtatctgg ttcgggggta ttcgactggt cttccgatgg    109260
     ctggggcagc tgatcgtcgg gcttggttgc ttcctttgct ggggttgtcg tttcgtctgc    109320
     gtcttcgtcc gcttctttgt ccgtcttgtt gtcatcgttg gggcttggag acgggtcgtt    109380
     gttggaccca gttgcttcct ttgcttcggt cctcggcttg tctccttctt tgtccgtttg    109440
     gttgtcgttg tcggggtttg gagacgagtt ggtgggagaa acgtcaagag gaggagagga    109500
     acctaactga tgtgcctgct tctcagcttc agtggaaccg tttgctgtag tatgcagact    109560
     gtctttcata agctggcata gcttctcttt aacttccctt gggtcgttgg tcgattgctc    109620
     atgctgatgc tcatggttct tgatgaagtc cattgttttt gctgggaggg agggaggctg    109680
     ttcttggtga gatgggaggc agatctgtga gatggtctct ttgtagggag atgagaaact    109740
     gaaagtagaa ccaggtatgt ttgagatacc gctaattctg tatccccaac tcaatgtcaa    109800
     gatgatgagg gggtatttat atctgatgaa cgacttcatc tgctcctgtt caaccggact    109860
     gtatccgagc gcgcaaaggc atctttcttg ttattggcca tatggacgat atcacaagca    109920
     cttcgaatag cataactctt ctactagaga gtgatactat gggaaatacc aacgcagagg    109980
     tgaatctgac tgtcaaaatg agagtgtttg tgttggttga ccagggaaga gcccagcaaa    110040
     atacttcggt cgggattgga acaacagcag cagcagcaat aatgttgaga atacggtata    110100
     tacagttggg ttgcacctga agcaaacgaa aatcataaca tagtctagat ctgaatctta    110160
     tgctactgcc agtctctcag cggaaaattg gtatactccg tgcgactgta gtcgtttgct    110220
     cccgcgagtc gtgtttggaa cggtgctcaa agccattgca gaattagttg gactcgtggg    110280
     cacatctatc ccagagatag aacttgacgg ccaatttaat gcgaccgtca cagtaaggca    110340
     ttcttccttc tttctatggc tataaagata taactatgga tgctctggac tgtctggttc    110400
     taggttatct ccataaacac ttctcttgac cgattcagaa gccatcgaaa cacccataca    110460
     aaattagatg cagttgtgtt gcacccggag caaacgaagc atgagacatg cttatcatgt    110520
     gatcgtcaga ctggtcttgc gagagattgg tattcttcat gttcattcag ccatttacta    110580
     gtgtctacgc gcagcaactc gcgtttggca tggcatccta tctcgtcaat tacagtgagc    110640
     gcagctgagt ctgttgctgc tcgtctccta tgctatcact ggctaattag cttcttcctt    110700
     ctatgccccg cgctctattg acctgacttc cttcctgact tgtttgcatc gctcgccact    110760
     agtttggcac atctttaatc acggacaacg cttatcccac atcatagagc tgagccagcg    110820
     aacaggacaa ggcaacagac acttccaacg tcgagaaagc ttccaacaag acgaagcact    110880
     tcaaacgcgg tcagacgtcg acgcaaataa cagcacagtg catagcgaca ccgttacttc    110940
     aagatccaag gaaccaagca gcgccgtaat cgggcgcatg tccacttaaa gtacctggta    111000
     tcgtcgcgaa gaaacaagtg cggagctttt tatagaagta gaccatccta cacttgggga    111060
     tttgagagca ctgatgcata cattcggcaa tatcgagtaa gggagaatcg ctgccgaggt    111120
     cattgttggc accggttcta taaacgggta tctaagaaag gttagtggac attgtggcag    111180
     gagtggaaaa tgcttaaaaa gtatataggg aatattcata catcgatcac agtgtagatc    111240
     ccatcttttg ttcagttctc gtagctaacg acgattttag cattacgagg acctgatgga    111300
     ggggaagatt gtcagcatac caaggtatct cttcctgtct tggatgtttc agatgagggt    111360
     agtcactcac aagcagcatc ttttggacca gtgtcctgaa ccacaatcac aatcaccgtc    111420
     ttcccctccc tcgttgtcgc ctccattccc ttcttcacca ccatgggagg agacctaaca    111480
     gacctccaat tcccctttca atttctcaca tcttcctctg caaatcacca accttatccg    111540
     ccgactcccc caccaactcg agctcctcct tacaattaac gggatccaag ggtgaaaccc    111600
     tgcgatacga catccacaat gatatgtgac aaatagtctg tcctctactt agccatcttg    111660
     ttcattcttg gagggactgt catgatgtac tcggactgtt tcggcggaaa tgaaactggc    111720
     gaggagggcg aggagggcga ggaggtttgt gccgaacttg tatatcaatc catgtctggt    111780
     ttatctgtct tatatattta ctcgtcggta aatagaaaca tccaattcaa ttcacgacaa    111840
     tcacatcatc atcaatcata agccatgtat atccaactca tcaacaaaac caatatctct    111900
     aaatacggca tatatggtat gcctacaacc caacccaata cctcgtcctc tcaaccccaa    111960
     actcccccga caactcttcc tcaccagttc ctgtgacaga caccccatat gtgcccttct    112020
     ccgacgccca tttaccgcgc tgctcgtccc accagctcgt cgccagtttc ttctccacca    112080
     caatctccac ctgtttctcc tccccaggct ggaggaacac ctttgtgaac cccttcagtt    112140
     cgcggacggg gcggttcacc tccgttttcg ggggaaggac ccacagctgt acgatctctg    112200
     cgccggctac ggtacctgtg ttctttactt ggactgtggc agtgatgggt tcgccgtcgg    112260
     tgagggtgct cttctccggg gaggtagtaa tcttcagatc actccgggag aaagtggtgt    112320
     aggataaacc gtgaccgaaa gggtagaggg gcttcacgtt cgtcttttcg tagtacctgt    112380
     atccgacgta gacatcttca ccgtagagga cacggccccg ctcggagcgg aagttaagat    112440
     aactagggtt atcctgtaag cggacgggga aagtcacggg gagtttagcg gacgggttga    112500
     cgtctccaaa gaggacgtct gcgatgccgt taccgcattc gttgccgccg aaccaggcgt    112560
     ggacgagggc tttggctttg tggacccatg gcatggtgac aggggtaccg gactggagac    112620
     acacgactgt gttatccgga ttagcgtcga ggacacggga aatcatctcg tcagtcccag    112680
     gaggcagatc catgtgttcg cggtcgttgc cttcggtttc ccattcactg gtgaggccgg    112740
     caaagatgat tacttgggag gcttggctgg cttgggagac ggcgttggag atcagctctt    112800
     cttggctgac ttggcgggca gcgccgaagc ggaatccgcc gggcccgaag acgacgatgc    112860
     ctcgggtgtc gaggtcggag gtgggggcgc tgccgaattc gaggactact ttgtaggttt    112920
     ggcctgcgtt gaggtgtttg gagccgcgct cttcgacggt ggcgttgccg aagaaggcgg    112980
     tgccctggcg ttggttcttt gtgttgtcga cgacggtttc gttgtcgatg aggagacggc    113040
     ccgtgccgac tacggtgacg ccgaagtcgt agacgccgga ttcggtgggg gtgaagtagc    113100
     cttccatgtc gacgaagaag gtgaaagagt ggatcttggg gttgatgtag tccatgagga    113160
     agccgctgga gcggagaaga tgcagttcgt cgacaagggt gcggtccttg tgggagggtg    113220
     gttcgttgta gacgcggaac gtgaatccgg gtttgccatc ctgagttttg agcaggggac    113280
     cgaggagagg gagttctttg tgggagtaga cgccttggga gaattgaact tcggaggtgg    113340
     ctttggcggt gacgccttca aagggcgaga cggtgtagta ggggtctagg gaggcagagc    113400
     cgccgccaca gtaggcggcg atttgagcgt tgggtccgat gacaaggatg ggtttgtctt    113460
     tgcggagggg aagaatatta tcttcgttct tcatgagcac gacggactcg gcggcggcgc    113520
     ggcggagaag atcccggtct tggggccggt tgagggcttt ttccggggcg tgctcgggga    113580
     tgcctagagg ctcgacccag ttgacgaggt tgaggatatt gcggacgcgg tcgtccaaaa    113640
     cgaactcggc taccttattg gaggacacag cgtgagccag ggcagagcca cgccagcgtg    113700
     tcttgcccgg catttcgagg tccagaccag cattgatggc gtcggaagtg gtgtaggttc    113760
     cgaacctagg atattctgtc aatacatgtg tagcaccatt ttacggtaca gatcttacca    113820
     atcactcata accagaccat cccaattcca ctccttgcgg aggatatcag tgataagctc    113880
     cttattctca ctgacatgcg tgccattgac cttattatag gccgtcataa cacaagcagt    113940
     aggacatatc ctcatcgcca actgaaaagg caacaggtat atctcgcgca gggcacgcat    114000
     ggtgacgatg ctgctcaccg ccaaacgctc atgctcctga tcattgcaca caaagtgctt    114060
     aagcgtggca gcgacgccct tctcctgcaa ccccttgcag taattcccgg ccagaattcc    114120
     ggaaagcacg ccatcctctg cgaaagactc gaagcctcga ccgccgagcg gagagcgctg    114180
     gatgttgatg gtgggaccca gaacgatatg cgagccctta gcgatggact cgtcacccat    114240
     gagctggccc acctcgtgca gcaaatgggc gtcccaggtt gctccgaggg cggtggcaca    114300
     gggaaaacag gcggccggga ttccgttgaa gaagcgggtg cctcgcacgc cattgggacc    114360
     atcggacatg cgcagagcgg ggatgttgag tcgggggatt gaggcagtgt gccaaaagtc    114420
     cacgcctgtt caatagttag ttatgctttt tgtttttggt aattggtgtt gggcgttact    114480
     tgccagccgt gagagctacc ttttcgccca gcgtgagctc ttcaatggtc ttttccacgt    114540
     ccagacgtgc catggtgacg gtgacgggag gggggacgat ttattgcaaa cttaaaatac    114600
     aatggagtgg cattcgagtc aatgcaggct acgatgatga gtagcaggac ttaagagaca    114660
     attgctggtt aaggaacggg gagggaggga agtataaatt gatcacggac caaacggact    114720
     gactcgagtc gaggactact gaaaccaatg gttggagcgg gggcagatgg aggagttcat    114780
     atatccggaa cccacggtgc ctggcacccc gcctgaatca tccgtgcata aggtggctac    114840
     cgagtgggat ggaatgcatc atggatcaac atcatgaatg ggcggatcga cggcaggagc    114900
     tgccgaagga gcagccacga aatgccccga agattacccg accggtttgg tcggagtgtc    114960
     ggcccgcttg ccctgtcgcc agttggcctg atggtcttgc agatgcacag ggtatcctgg    115020
     cagccaccat cactacttgc agatgcagat gcagatgcag ggtctaagag ttcaccacgt    115080
     cggacattgt cctacccaaa aaggtaaaac atcccaccgg agtccgttgt ccccacggct    115140
     actactcatg caggcagact acggaccgga acctaacttt cgtaacgggc agccagctga    115200
     ctgactgcga gtaggtagct gctatgcgtc cgggtatcca atcaagaaca caaatggggg    115260
     aaatggaaga gaaaaattgt atggtacagg ccatgcgtgc acatagatca gagagtccca    115320
     ggtaaacaga cggaacgcaa aaaaaacacc gtccaacaat gctagtaata gagtcgtgta    115380
     gtaggtcaaa aggaaatggt agattcaatg agagacaaaa agaaacagca acatgcaacc    115440
     acgcatcatt ccgccggtat caagatccct aaattctctt ctccctcacg caccacgtcg    115500
     gggccgttta gactcgcttc ccatccgcat tcctccccgt ccgccgccat ctccatgtcc    115560
     tccttcgtcc ccaggtcgat tacgcttgcg gtgaggccca ctaggcgccc cctcgcgatg    115620
     gtagtcccgt tcacgcggac gatcccgatt acggtcacgc tcacgatcgc gcagctcgcg    115680
     cccacctccc catcgtcggt catcctcacc agcagcaagc gggggcggcg gaggtggtgg    115740
     aggaccctgt ccgccaagag aagacggagg tcggagacgg ccttcatgct cctgactgct    115800
     tggggcaatg tccgagccct cctcccggtc acgtcgacgc cggttgtctt cacgtgcgcc    115860
     aggcccacgt cgagacgcct cgcgagactc ataccgttct tcccgaggcc ctcccggggc    115920
     accacccgcg tcgcttcggc gactccgttc acgctcgtaa tcccggtttc gatctcgatg    115980
     ctcttcccgt cgactgctac tgcgtgagcc ctcttcatcg ccaccacgcc gttcccgatc    116040
     tcgctcccgc tcccgttcac gctcagggta tgtgcccgaa gagaaccgct ggcttcgccg    116100
     gctttccgcg ctggactcct ccgcaggctc tcctcggctg cctcctggtc ggctacgtgg    116160
     atgaccgtcc tcttccccgt agggagcgcc agaagaccgg ccggccatga gatcagggcg    116220
     accttgagac gccgggccac cgcgaccacc ctcctcctgc gcaacgggcg tcggaggccg    116280
     agccgattgc ggtgatgggg cattcatggc gcccgattgc cgattggcac cccgtcctcg    116340
     aatcgtagga ccagggccac ggtccggcag cccaccggat tgctggagca tgttgttgat    116400
     accagcaaaa cgcttgtctc cccggccgcg ttcaccacca aacccaggac ctgaaggcgg    116460
     gccacgtggc atagctgcgg gtccagaggg tggccccagt ccactgcgtg gaccagatgg    116520
     gggaacaatc gatgcaggag atgacccatg atgcgggcgc tgaccgcccc catatgtgtt    116580
     ttcctggggt tgctgttgca ggaccttcag tctatccggg tggattccgc tagtgtcgag    116640
     tttctctggg cccggtgacg agggccctgt tggggcaggc tgatccggtg cgtttcgtag    116700
     cccctgtcga ccagggccag taggaggctg gcgttcagtc ggagccatcg caccagccgc    116760
     aggctgtcct tgggaatgtt gtgacccggg gacattgcgg ccaccacgcc cagcattgtt    116820
     tcttcctctc gggccagacg gaacatccgt aggcggctcc ggttgacgca gccgtccatg    116880
     attcatgtca atgccggtca ctgtatctcg actgtcagcg ccatccatgg aaggacgccc    116940
     atatcgctca cttcgtggcc ctgtgggcat atcctcgttg cgcgcatgag ggtgggcaaa    117000
     gttcgcaccc cggcgatcat cagctgggaa ccgttctgga cgccccagtg gttccattct    117060
     cggaggagac aatgctcgtt gttgcaaatt ccgtcggtcg tcccgatctt gtcgtccggt    117120
     ttcgccacgc cgaaagcctt ctggatggtc gtctatcata ccagcgcgat cagggtgcgt    117180
     aggaggaaca gatcgtacat ttggtggtcc ctcccgagca tccggccgta gacggcctga    117240
     ccgatccggc cagtccgcat cacgcgctgg gcgtccatcc cggtgaggaa atccacggaa    117300
     tggttcgtcc ataggttgcc ttgggtaatc cctgtcacca cgggggtagg gcctcccatc    117360
     acccatggcc ggatcgaatg gccgagaata gtcgtggtct ccaccgaagc gaccaccacg    117420
     aggatagtcc tgatgtctgt cacggcgatc ctctaagaga tcaggccgag gaggtaactt    117480
     gtcttcacgg ttgaatcggt gtgggccctg cgcttgtgct cgggcgttct gtgcaccgga    117540
     tggtgctcgc tccggttcag ggcgcttcgg tacatttgcc ggtctaccag agtctgaaat    117600
     ttttgatgca gcctgcgatg cagcgggcga tgctggcgcc tggggtcgag caggcaagtc    117660
     tgcctctaga tgagctccac gggcagaagc gacatccttc tcgtttgaat tttgctcgcg    117720
     attagcggat gcttgtattt cggtaccttg agccgaagtt gcaggcgaat cacgttgaga    117780
     cgtcgacgaa acctttgttt cagccggctt ttgagctgtt cgatcagcca gcgggacatc    117840
     agccatcttt gcatcctcta tctctccatc ttcaacctca gccttcgtgg cgcccgactc    117900
     gggcttcgcc tcgccttgcg acctgtagtt gtgtaaaata tcagtattca tgatcaacac    117960
     agtacaatga tctaggttct atctgaggac ttacccgttg gtggatgtag gcttgaactc    118020
     gacagcagta gcattcaagg gggtgggtgt agtagacgag ggacgtggtg tggttggttt    118080
     cgctgctgca cctggtctgc caggcactgg cgggctggca ctcataaacg cttgagggag    118140
     caaccatttc ttttcacgcc ggttaagatc gccgattaga gaagcggccg ggatcttgac    118200
     atcatctcgt tcgtcgttct gactcaagct attcatgcta gtcaacatgt cccggcctat    118260
     ccagttcact gcagggaaat tctgcacaac agccttcaac acactgatag cgttacgaat    118320
     gtgcatgtat tcgccaccgt tcaagcacgt cttcagagcg gaggagaata ggcggtgcca    118380
     cttgtacaga agccgacgga aatcttcgta ctccagataa atggctggct tcccatccga    118440
     gtcaacattc ttggcgaacc caggaaggtc tttcttggta ccaaacgctt ccttctcgta    118500
     aacagccttg tcggcgtgcc aacgaccgag gtcgcgtaag acctcattca aaaatcgacc    118560
     caagttatcg gcctctcttg atgtgcactg gaatatcaac gcggtaagtc tttgctccct    118620
     gaatagctga tccaggaggc cgacggttcg gaaattcggc gttccagttg tgtgcaagaa    118680
     tttgagcatc ttgaagcagt agaatgcatc gataggagac aacaagagac gcggtaggaa    118740
     acattgctcc agaagggcaa cattcaacga atcgtgcttc ccacgcatac ctgcaaacca    118800
     gcgatctttc tccttctgta gtttggtcct tgtttggccg taggccttca agtgggcctt    118860
     gttctcttcc aatatccggt cttggagttg cgtgatttgc tttttctctc gctcttttct    118920
     ttgcgttcct gccatgctga tgtcggaccg atcgttgctg atggccataa ccttcctctt    118980
     ttgccgatca atttcgtctt catacgattt ctgaggtata tgcacgtcgt acaaagacag    119040
     ctgccagaat gtcacgtaga actgtaagcc aacaacgccc cacgtttcgg gactcaggac    119100
     agccttgact tggtcttgga gatcttgcat gacgggattc agagcaggca cctcggcagt    119160
     gacagaacca gccggtactg tagcagcgtt gctgtcggtg ttgttcgcgg tctctgcctt    119220
     ttcggtatcg acatccatgg cattctccga cggctgttcc ccttcagtca cgtttgcctc    119280
     cccatcttcc gtcgtttcca tctcgtcagc ctcgggcttg gatggggatg tctcttcgct    119340
     ctcgcgactg gataccaatg ccgccggagt ctttgcggac tcttcatcct gcattgtctt    119400
     ttctatatcc gcaaccttct ttgcaacact cggacgccga atccaaaacg ccacttcggg    119460
     ctggatgccg aaatcgctaa tgagagaagc caaatccggg acgaatgaat cgaattcctc    119520
     gaccgacagg ttgctgcgaa gcagatccag gtactgaacc agaatacggt gaatctcatc    119580
     aaaaatgttt cctaggagct tgagctcgga agcgccttcc gtttctctga aaacgcaaat    119640
     caatcgttct tgagcaatgg caatgagcaa ttgtccggca agctttgaaa cagtgagaga    119700
     cttcataagt cttctggagg tagtttttga ctcgtgtcgc ttatctagca actgcaagat    119760
     cgtctgagat tgtaggattt cgccacccgc catggcctga atttgtgcat cgttgaaatt    119820
     gttgtcggtg atgattcccg ccatagaact gattatctgc tcgaggatga tcaaatctgt    119880
     cgaattgttc tggcgaagct gctccacaac gtattgtaag accggagtgg gatccatcac    119940
     cgaatacctc ttgaaagtcc gtcctgcaaa tgtcgccaag gcgttcaacc aacgactagt    120000
     caacaagcca ccttcttgaa cgcggcttcg tcccttctgg ccgagcgagc taatcatgac    120060
     ccatgtcagg atatcatacc caagatatgt gaagtagcgc gcacactcca caacgacttc    120120
     gataagattc tcataagact caatctggtt gatggccaca ctgatgacga tgcccggatt    120180
     ggcataggcg atcttggcca aggcacgagc cataggtcga atattcgttt tgctgagcct    120240
     cttaagaaca tccttcgttt ctgctttcgc ctgatcaaac gccgacttga tgtcaggaag    120300
     tctggaagtt tggccagaag tccactcggc atacatattg taccgtacct ccctagggaa    120360
     aaaactgata aggtcaaaga tctcatttac cacaccggga tttgccttgg tgagactgat    120420
     cgacgggacc aggagtcttt tgcaaagatc ctgccaacga gctcggttct ctggcgaatg    120480
     atnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    120540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngcttgggt cctggccgat    120600
     tttgtgaccc gatagattaa ggaaggatga acacagtgcg aagacgtcgt caacagtctg    120660
     gcatatggga acgttatccg cccaatcatc ccagtagaac ctgtagtcgg ttccatcgtt    120720
     tgtatcttct ttatcgagtt gagcccaccg gagaactcgg cgcggtggcg cctgtgccag    120780
     tcgaatttgc cccttcggca caccggactg atcatggttg agtatctgct tctgctcttt    120840
     aagcacttct accgagggta atgggcgtaa tgaagaatag accttgccaa gacagtggtg    120900
     cagaatgcgg tggatgaatt cagggagttc ggggtagaca tccataagcc aggggaattt    120960
     gctcaggatg aaaagagact cggggagggc accaattgca agaaggctct ttagaagcat    121020
     cactttctgg tcagaaggct caggaagctc gtcctcctcc gtcttcgcgc ctgtggattt    121080
     gtccgtttcc tggtcttttc caggagtcgc agatcgggtt tcggattcgc ggatgcgtgg    121140
     aataggtagg gtgtcgtcgg ataaagcacc agccatcatc aaggcattga tgccacctcc    121200
     aggccgtgct gcccgctcac gatcggcctt ctccttgagc ttctcctcct tgagcgcatc    121260
     cattgaatca tctggcctcc agaggtgcgg atacagatca cgtagtgaaa tgaaaccgac    121320
     tttaatcagt agagccgcaa ggtagatgag gttgtccgga aggacatcgg atttagcgcg    121380
     agcgcgggag gaatagaaac gaagcttgaa accaagcaac tgtgctgcta ctcgacttcc    121440
     cttgggaggc agtgtgccgg tttcctcaat ccatttacgc atctcctttt cctcttccga    121500
     aagactgttg ctttccggaa gaattcgctg tagctcttcc ttggacacag gccggcggcc    121560
     aatttcaaag aaagcacgaa ttccgatttc tctgactctg ttccaaaatt cgtgatctcg    121620
     ttgctcgttc gctttcattg cttcaagtcg ttcctcatcg gtagtcaccc atccggaaga    121680
     tccaggtaag gcccagttgg gaaggccaga atcacggtta cctgcatcaa ctgtgcggaa    121740
     ggcatcctct ttcggccacc aggagctagc ccgcaggagc ttcacaaaga agcggtactg    121800
     cttaacaaga acagcagcaa atacgtcgag agtaacatca agaacacggc ccacatccat    121860
     atcaaacgcg ccaatcatcg ccttcaccct ctcaaaagtg tcctcgacaa cttcgctgga    121920
     ggggggctca ttattactcg tcgtgaacag ctccgtaagc agtttggagt acccttcaga    121980
     ctcttcccgc agaaggttgt aattcgattg ccgataaaga aggttcgtct gcttgcggat    122040
     gcccatgcgg gtgaatgttt cgcggacaag tcccagggac tgaaggagtt gggtgtcgag    122100
     ttggaggcgc ataagagcgg agttaatccc cgtagagaac acgagcggtc tcagggcact    122160
     attagaagtg tcggaatcgg tgagaattga tagggtgtcc aggaacaagg agcgagtgtc    122220
     gaggagggct tgcgcttgtc cttcattctg catatcaaca tcctctgcag caacctcttc    122280
     gccaatgatg tccctaactg cagctccagc ttcctccggt gatagacgac cgtatagggc    122340
     ggaccgtatg agttcctggt atatcgaagc gagtgcggcg gcatcttgcg catctttcac    122400
     ttgaataccc ctctcgacga gatgcttctt tccagtcgtg gcccactcgt cgatggcgtt    122460
     ttgtgtaaca tactcgtagt cgtagggtgg gggaggcccg ggaggaggct ggggagccga    122520
     tgcctgagct tgcggggcag gtgccggcat gggagtaggc gcgggcgacg gattgatgtg    122580
     tgtttgtggt tgagatgagg agggagaggg tgatggaggg ggcttttggt gatctgttgt    122640
     cggagggacg ccgtttgcct ggctttggtc tgagacatct ttcgccggag ttgtgctggg    122700
     cggggacatg gcattatccc tccgaccacc aggagggttc tgaccgtcgg tgctgggcct    122760
     gcgacccatg ctattccttc caccccgact ggattgcctt cgtaatcgac cgcgcgcgtc    122820
     agagtaatcg cgagactgcg gaccgtagtt gtgttgcgcc atgttgagat tgcccggccg    122880
     atggggcgat ggtcgttgac cgtcgttccc tgaatcgcca gaccacgatc tatcacctct    122940
     ctttctcttt cctccggcac ctggagccat gacagcccga ttggagctag agtgcgcgga    123000
     tagagaaccg atgtgttccc gacaggtcgc aattcatgcg gcgaacctag atttccgagg    123060
     tcagcttcct tcacgtggga ccacagagcc gcaatcggtc ggatcaatcg atgaaacgcg    123120
     gtttagggga ctattagaaa caacctgctg tggaaaactc atacggcgga aggagggaaa    123180
     ggacgatgcc tggggaagac acaaagatcg ctggtcggat caaagaacgt aatggcagtg    123240
     aatgcacggg tagcagtaaa ggcggcggcg tttacgggcg ggtgtcgcgc ctcagtcgct    123300
     tagtctcgag aagctccgcg ctaggctttt tcggtgttac ccgcctgagg catttgcctt    123360
     taatcacaga actcatcagg attatttgct atttgctaca aacaatatat cacttcgttt    123420
     cggggtaggt tctatccctt gaaagtggtg atgaacacct tacaaaactc atatttcatc    123480
     ttaaatatta tcatgtcatt catcatatca atgcgtcgta gttggctaca taaatttccg    123540
     agctccctca cagcaagccc aaagccttgg cttcaatgtc aacaatctca ggaataagct    123600
     ccttcagact gggacggtgg gggttccaac ccaacagctt tctaccacgg taggaagtac    123660
     cgcgagagct gctaccccag gcatacaggc caaattggtt ggtctcagta acctgttcgt    123720
     cggtcaaggg ctcaacctca ggggacggga taagcttctt ctcataagca acctgggcca    123780
     cctgcttctg aatgtcaccc cagcagaaag gaccgttctc tgctaggtag taacccttgt    123840
     cgttccaagt ggccttgcca ccgcccgcag cagcagcctc actcagcaga aggtaaagat    123900
     cactcagatc ctgcacgtgg atttggtgcc agatgttctt accctcaccg acctgcagac    123960
     ccttcttgcg cttcagaaca gcagaagcca gccagtatgc ctgcacactc ttctggttgc    124020
     agggtccacg gcccggtccg tagatggtag gcgggcagac gatggcaatc ttcacactgt    124080
     cgggagcacg cttgccagca ttgatgacga tctcatcgac attgcggtgg aaggaatcag    124140
     caggaaggtt gaggagctcg tcgacaccat cccagtcatc atgttgcttg gcacgttcca    124200
     gaccccaagt gttgctacgg aagtcctcca cagtcaagat accggttcca gaagtgtgga    124260
     tccaccacac tggtcggtca ggggtgtggt gagtggcacc ctttgcaatt gcttcggcgg    124320
     cagcgacatg atcacagtcg gcacagtcta accatggccc gtgagttata cattcaagtt    124380
     acagagagag cacgtgagca gggactcggg aacgtacgga ggacaatatc tgcgttcttg    124440
     acctcctcct caatgatatc ggccgagtca aggtcaccaa gcacaatcct tacgttgggg    124500
     tacttgctgg taacctgggc agccttgtcc ttgttgcgca ccaagacgga gtactgccag    124560
     tccggatgag cctggtagac gtcgtaaaag gtgtctccgc cgatgtatcc agttacacct    124620
     gtactgcaat atacgggcag cggccgtcaa cgagtgtact aacatctttg aagaaagcgg    124680
     agacctacag gaaaaccttt tggggagcca tcttgccgta gtaatcgtaa gaaggtcggg    124740
     aaaggatgga taatgaatcg ctggggaaag agtgctacta gaagtggggg aggggagctc    124800
     gacttttata gcttgatcaa aacaaaaaga gcgaccaact gccacttcca gcttaagctc    124860
     cgctatgctt tgaaatcaag agtgggcaaa atggatcctc tctggtgcaa gaatcaatca    124920
     gaggttgcag acctgggcaa aagtgggggt gggggtacca gaagtagcta tccccatcaa    124980
     ttgcgggctt cgttgtgctt ccagtcttaa ctggaattga tggcttggag catatttctg    125040
     gttccacaga atgagctttc ggcacgaacc cttaaattga caagagtcaa atcctcctga    125100
     cagtatacta ctatcacatt gatcctgata aagggttagg tgttctgggg atggaaaaat    125160
     gagtacctta gttacccctc atgacgtacg tgggcggggc tgaagcccaa cgaattcaac    125220
     aactggccag ttctcggtcg actacaagta gaccggcgcc tcgctggtac attgcttcgg    125280
     tcgcaaatga taaggccaca attaccactt gaagaaccgg ggtgacaata tggaagtata    125340
     accgagaggc tacagttttt gtataaagta gacgtacata tactcttctt tgaacggaga    125400
     caaagttcaa gggaatggta cagcagaaaa gataaagcag agtggctgga ttgcaaaact    125460
     caaaggtggc ttatttcaat agaaaaccgg catcaaaggg gaatcttgca cagaatcatg    125520
     cctataatct acagtcgctt agaaagtgct cgtggccagg cgactagccg cgttacgagc    125580
     gtcaaggcga tcatcgtcgt cttcctccac aatcgagctc acaccactgg cagagcgcag    125640
     gcgcccttta ccggtgccgt gtccgttgac ttcttcgtcg tcttcagttg gggtgggtgc    125700
     aacgaaactg ccactgagac tccggccaag gctgtcgctg cgacgcggta tgccgctcca    125760
     agcatccccc ttggggcctt gacttgaacc aaggttaggt cggcgagcgg ttgggtggga    125820
     ttcacgtcct agacggctga gtcctcccga agcgtcaatg gctcgaatat caggtcgcac    125880
     actctccaag gtagcgaggg tcctccgttc ggattcaatc tggcgcagcg tatactcgcg    125940
     gaggctggcc agcatgtcgt tagtcgtccg gtcaaaccaa cgttgcttct cggcgagtaa    126000
     gttcgacgta acccgctgtg ttcgcttcgt caggtagtcc tcgtggccct gagcctcatc    126060
     cagggcattg atggcctcgt ccaccttgtc cgggcggacg gaggaactga ctttgaggcg    126120
     atcagcggcg gcgcgtttgc tccttgttgc ctgttgagct tggatcaaat cacgaaggag    126180
     gatgtggcga tttgtaagag tctccttgac aataaaggca tcggacgagt ggtagcttag    126240
     cggatccccc agtgttgtgg cctccgcagt cgcctggacg gcatggaaat ccccgaccgt    126300
     ttggatgatc tttcccaatt tccggtatgc atttgacagt ccagggtgcg tctcttgcac    126360
     gtgcatctgg cctaacttaa caccaaagtc ggattctgcg agaccgagtc ctggatagcc    126420
     caatgttagt tcccatgatc atgagatacg aatccctggc gcatacctcg acgggctttg    126480
     acgacacggt caaccttgtg actagtatcc attgttccaa gatagaacat ctttacaatc    126540
     ggacgcgcat tttgtaattc gggtgtgtca tcggggggtg gcgcgaactg cttcaagacc    126600
     ttccttcgaa ccccagtcgc aggttgtttc atccgaacta caggactgta accgaaatca    126660
     ctctcaacga acaggaccac ctcatcgtca tggatgagaa cttcattgct caatacaaca    126720
     ttcaaccacc gttgcaaaga cgacttgact ctgatttcat cctcttcggt tccagcgccg    126780
     gcaggggtaa gtggtggggg gaccgcagga accaacgctt ccgggttagc cgaaatcaga    126840
     tggtccgcaa gcttgacaaa ctcggcatgg gtacgacgaa cgtctcgata ctgtgttgtc    126900
     ctaaacttgg ggatattcgt ctggagcctg taatcagtag gcgcagggcg aggcaagaaa    126960
     aggatatcgc tcacgtgaac atcaaatcga agaatagggt ccttcttgcc cgttctctct    127020
     agccccgtga ctttcgcctg gattctatac acaggtgcgg gttgtctggg attctgtctt    127080
     gggcccgttt ggtagcgggc ggggagctga gagcgaggct gttgtccatg ctgctgctga    127140
     gtgtgttgcg agtgctcatc aacatagccc ggctcaccca gttgtgcacc ctgcagtcgc    127200
     gcagacaagt cgggcgatcc aatctcgttc tcctggaacc caggagtttc ggtaggctgc    127260
     gattcggcat tgtaaggatc ttggggaggc aagggggcag gggggatgtc gctagtcacg    127320
     gaagccggaa aggttgtttg ggtcgggcga ggtgaagccc atggagaagt gcccgcagga    127380
     tgatcaggat cgtttgatat ggcggaatag tccatcgtgg ctgtcttggt ctaatgggac    127440
     cacgtctaca ccgcgctgcg ggtgcgcaat catcagtatt gtctcgtccg ggacggttat    127500
     cattgtggat caattgatgt tcacctaata gtgctcaaaa acaattgagg agaggaagat    127560
     gccgaaaact ctcaagaatt cgggcttgac taaaggagag gcagatgcaa gcgttgagat    127620
     gggggagggg aaactgttca actgagcgga acgggatgga cttcggaggt tacgtcgttg    127680
     gtgcctatgc agcctgattg gccaggcatc tgcggccccg gtcactggac cggaaaagct    127740
     tcaacagctt catccatacc tccagttact ccgcatacat actacctttc gaagggctgg    127800
     gcctttctct tttctacaat tatcatcctt ctctctgttc ttcttgagga tgtatgtcaa    127860
     gttctaggcc ccatattccg ccaattcatt gtctccgatt acatagacag ttgccgtccc    127920
     catggttaca gctcttttct tgcgcgcctc tcaccagacg gtgcggccaa ctggcctccg    127980
     gcaatgccag gcagctgcca gccgtctggg gtgtaatgcg tccttgattc caggggtcaa    128040
     gaaggggcaa tttcctaaga tccagatgct ctcaacgtct gcatccaaat tgcaggcaga    128100
     cacccttgac cgaactagaa atataggtat catcgcacat attgatgccg gtaaaacaac    128160
     gaccactgag cgcatgctct actatagtgg ctttacccga agaattggag atgtggacga    128220
     agggtccacc gtcacagact ttctccctgc ggaacgcgct cgcgggatca caattcaatc    128280
     tgccgccatc accttccatt ggccgcctca agcggctggt gatcaaacta caacccttca    128340
     agataatccg caaaccccaa ggtctgccac ttcccataca gtaaatctaa tcgacactcc    128400
     tgggcatgcc gactttacct ttgaggttat gcgttctttg cgcatcctag acggggcggt    128460
     gtgtattctg gacggcgtcg ctggcgtcga agctcaaacg gagcgagtat ggcaccaagc    128520
     gagcacatat cgtattccca ggattgtcta cattaacaag ctggacagag acggtgcagc    128580
     ttttgggcgt acggtaagag agataagctc ccggcttgcg ggctaccccg ctgtctgcca    128640
     ggtcccatgg ttcgagggcg gaaatggtcg ctttgttgga gttggcgatg cgatcaactt    128700
     gcagggtctc cgctggcaag atggggacgg taaagcggtc aaaatgttca acctccagga    128760
     gctggacggc gaggaaccgg ggcttgcaca ggagatcaaa cgcgcaagga cagcacttgt    128820
     cgagctgctt agcgagcatg atgagactat gattgagaag ttctttgagc atgacgaaga    128880
     ccatctcgca gtgcctccca acgacattct agacagcttg cgccggtgcc tcttgcaaga    128940
     acagggtagg aagattatcc ccatcttcgc aggcgctagc ttccgcaaca tcggtgtcca    129000
     gcctctcctt gacgccgtga cgaaccttct tcctagtccc ctcgaaaccc ctgacgcaga    129060
     ggtgagcatc ggcggcgtca gcggaggtct tcggagcctc ctctccggtg atctattggt    129120
     tgaacagagc gaaaaagcag ccacctccaa agggaagcaa aaaaagaaga agtccgtcac    129180
     tcaagctgaa tcacaaaatg ctatcgagaa gcttcagagc tgtgcgcttg cttttaaggt    129240
     agtcaatgat gccaagcggg gagtcttggt ttatgtgcgc gtgtactcag gttctctgga    129300
     ccgaaacagc gctatattca acaccaatct caagatcact gaacgtgcac cgcgcttact    129360
     gaagatgtac gccaatgatg ctgtcgaggt ggattccatc cctgagggac acattggcgt    129420
     tgtggctggc ctgaagcatg ctcgaactgg agatacacta gtctcatatg cgggcaacaa    129480
     attaacacca ccagaaccac ttgataccct ccaactacgt cctatccagg tgccgccccc    129540
     cgttttcttc gccagtatcg agccgcacag cctaagcgag gagaagaaga tccatgaatg    129600
     tctagcccta ctcctacgtg aagacccaag tcttcacgtc actgttgacg aagactctgg    129660
     gcaaacgctc ctaagcggca tgggcgagct ccatctcgag attgcccgag accgcctgat    129720
     caacgacctc aaagccaagg caacaatggg ccgcattgaa atcggctacc gtgaatgtcc    129780
     gctcggagag tcgcctgttg tcaccaaaat gttcgacaaa gagatcgccg gccgcaaagg    129840
     caaagccggc tgcacagcag tagtggaacc tttcgacccg gataacgcac ctccagtacc    129900
     cgaagacgcg ctctcggttg agaccaaaga gggcaatcag ataatcatca tcgccccgga    129960
     actgcaggta gaaaccaacc gcaaaggcat cgaggaaagc cccgtacttc ccccaggcct    130020
     agatatgcaa tccttccgcg cctccctcca taacggctgc cttgctgccc ttgctcgcgg    130080
     ccctcagttc actttcccta tgcaccacac ccgcgtcacc ctcaccatca acccaaccga    130140
     acacctcttc ggcaccgata ccaccccggc cgccctctcc tccgcagcac gtctagccac    130200
     ctccgccgct ctccgcgacc tcctctcgtc cggcccaggc acctccctaa tggaacccgt    130260
     tatgaacgtc atcatcagca tcgacgaagc cagtctcgga gccgtcgtac acgacatttc    130320
     ttcctcgcgc ggcggccaca tcgtctccct ggacgaagaa atccccctca catcaaccga    130380
     cctctccgcg tccccgcaac cggtcgagga cctcccaccc atcgacccga agaaggtcta    130440
     cgcccccgcg gacccattcg agtctggttc cgttggtgcc tccctcccgg acacagctaa    130500
     ccggcccaga accattacgg ccaaggtacc cctcaaggaa atggttgggt acttgaaaca    130560
     cctgcgtagt ttgagtgccg gtcacggtac atttgtgatg agtgttgatc ggttcgagaa    130620
     gatgagtacc ccgcgacaga aggctgtgtt gacggagctg aggggtgggt tttagcaagg    130680
     ttgattttca ctaccttctt tccccccatt cttctactat atcacatctc tccctggata    130740
     cgctgtatat tataacttca tgggttggtc aaagcttaga taaaatttcg aagtgtgtac    130800
     aatacatctt gacatccagg aaagactggc tgtatatcat ttgttcttcc aatgttgaat    130860
     tcgggaaact tgattgaata actcaattag tatgaatagt cagtaactgt ctcgcttcgt    130920
     tccttactag tctcagtcta atcaacacaa tcagtgagag aataatgggt taatagtaag    130980
     agaatagtaa gggaatggtg agagaatagt gagtcacaac ttttactaaa tatatatccg    131040
     aacacacagt ctccacagcg gttgatcatc taaactccta tccgaaggcc aatatagaaa    131100
     tgcaaaagat aaagtcaatt ccgctgaatt cataatgcac cgcaaaacca caatccagat    131160
     cgaactacaa gttcgattgc acaccagccg acggcaaaag ctgtgttcta gctggaatca    131220
     ccccaaccct ggccatccgg tcaaacgcca agagatggcc cttgcctacc gacctctcct    131280
     ccatgaaccc aatactacgg atcttatcca gactgaattc gcgattccgg tccagtaact    131340
     tgaaacccgc gtagacaaat agccaggtgt ctggtccgat ctgtcgcttc tgcagaccgt    131400
     attccttgca catgcggtca tagtcgtcct ggtggtcgta ccaccacttg tcgatcgctg    131460
     cgtagtccgt ctgcgttggt cttatggcct tcaggccgaa gtactcggcg aggataggcc    131520
     acttgacgca ccatgggcct ggagtggccg tgtctgcgat gttgaatgct tctccgttcg    131580
     cttcatcagg tttcactacc gataggtaga tctctgctcg agagattatg tcctgggagg    131640
     agtctgtgaa agtgtagaca taattggtgg gcgtgcctgg gaacggaact gtagcgccgt    131700
     agccatacac gtagcggtag agagagaggt agagagctat tggctctact gtggtcatgc    131760
     ttgtggtgct ggggacatgg cctggataag tagatttctc gttagcccta tgtatgctgt    131820
     gtcacattgc cagacgtatc aataatacct atgatttgat ctgggcggac ttcacaccat    131880
     ctccagcttt tcccttgagc tgcttctcgg atcaggtcaa cctggccata gtagaaaatc    131940
     tcgtcaccgt atggggatgg gacacgcggg gcgtcttccc tcaggggtgt gttgaaggtg    132000
     agcttgtcga tgtgttggaa agccgcgacg ccgtagtgct attccagtca ggtttactga    132060
     agacatgaaa ttggttcagg ggtatagcat acattggtac ctgtttgcag cacgaagaag    132120
     gtcatgttct tacacagggt atcgcaggca tggacagcat tgtaggtcat gacgacgttg    132180
     atgtccttga tatccatgac attttcggtg tatgcagtag cattggagta cgctgagctg    132240
     tcagtaagag atattcgcac cattgctctg cgcggtcacc tgcaaataac cgatgtctta    132300
     ccgagatagt atacatgagt gacctggtct agctgcggga ttgtttcacg catctgggtc    132360
     attacttcgt ccaggctacc tcgcaggtta atgcctgaat acacctccag tctcggatca    132420
     tcggggaggc ctagttgtac ccgcgtttgg ggtcgatgcg tcaggccgat cacccgcgaa    132480
     aaggtgctgc gagttggata ttccagcagg ctcctagtca cggcccagcc agatattcca    132540
     ctggcgccaa aaaccaacgc aactttgtcg ccagagatgc tgcccattgt gaaccacgct    132600
     gcgaaggata gaatgagata cgagtggaga ggaagaaaag ggtttccttt acaccccctt    132660
     ttattgttat aattctacga ccctgtggaa taggtagaca gagaatgacc cgctattaat    132720
     gatgacagtt gtaggggatt ggtcgtaagg tctgccgtgc caccctaatc cagcgggcga    132780
     catacaaccc catgcctcct gaataggcga gataccagat tcagtaatac ctggagcctg    132840
     gcaaataata tagtgttgta ttaagagaca aaggccatta taacacacga cggaggctgt    132900
     tagtggatat agcctagagg aattgaaaca aacacgtcca ggctggcgct ggttccaagc    132960
     ctctgacacg tatagtggaa tgccttacaa tgcccggaca tggcccggtc tgtgagttag    133020
     attaatgatg ggatcgactg tgcacatgct ttccgttgcc agctactgtg tccaagtttc    133080
     ccttgcccta gttaggtttt ggattggccc tcatatccac ccgtgagcgc accattttta    133140
     aggccgttcc ttcgccccac caggccgcaa cgaaccggtc ttttgcctca gctggctaac    133200
     aaggtgggat tcatttagac taggtccggc gacccgtagt gctttcattt gtgggtttag    133260
     ttccacggcc gagatcccgt tgcgccttat ggcagccttc ggaattgcgg gctggttttt    133320
     agatgcgccc aaagagagtt gctttagtca cgagacttcc ctctatcgaa atcagtaaag    133380
     ccatgtggta aacctgaagt caggtcagaa gtagtgggta ctagactgag agggagggaa    133440
     gaaggaagaa agagaacaag caaaggggga ggagacatga gagaccacca aaaaagctac    133500
     gtgacagggc gctagaccca ttataggacc aggatcaagc catcccgctg tgggctctca    133560
     actaaaccac tcatcgacaa taaaactaaa gtgcatctag tccgcgatgc gattcacccg    133620
     tgcttacggt gggacctgat cctagatata tctcctgcct tcattggctg tgcattctct    133680
     cggcctcatt tgatcggccc atgaacgtcc tttgtccaac ccgaactccg aggcaggaag    133740
     taccattgta aagtgttgat cctttccttc cggccgagta ctatagtagc tagcgacaac    133800
     ataacagcat ccttgtactt acacccatcg taggccaatc aagtacttga ggctcccctg    133860
     ctaatttgcc ccctccacag aagtctggaa cattggccta ccggcatgat cctggttagt    133920
     taggccaatg caatcagccg tttttttcag ctccaaagtc ggtctcagcc aaagtaatat    133980
     aaaagaatgg cgcactttga tcgcgagcga ggcctcttgg gcattggctg tcgttgcagg    134040
     gactcaagat gctgtcgcga tcgctgggaa agggaacgtc cttcacaggg cagcaaacga    134100
     cagtgcttgg aattggagta gcatttatgg catttacctc cgttgtaatt gcccttcgcg    134160
     tctatgtaag aacgcttttg ctgcgtgcgt ggggtgctga tgacggtgag ccgactattg    134220
     tacctaggtc ctttgataaa tctaacgaac atgcagtgct catggtgatc ggaacggtaa    134280
     gccagatagt accatttcga tgttccgtca agttgttgac ctcggggtca gatacttaca    134340
     tacggtcttt ctatcgcctc aattgtgggt aggtccaggc acgtacatac gtcttaagta    134400
     attgagttac tgaccgtggc agctgcatac tatggggttg gaaaacactg tacgtcttct    134460
     actgatttgc ttgacttgac gtcttctaat gtgaaccaag attcagatgt tcatattgaa    134520
     gaccggattc ctatgttcaa ggcaagttat aacactaata ccgaggaaga cgacgaccca    134580
     ctgactataa ccagtgtata tgggctacac gcctcctcta cgtgctcggc ctgtgcttca    134640
     tcaagctatc acttctttgg ttttatctcc ggctggaaac acgacgtttt atgcaatggc    134700
     ttgtgtactc ggtcatcttc atcgttctag gggtatcaat ctcaagcttc ttcgttgata    134760
     cactctcctg catacctcct tctaaatttt ggaattctac caagtccgga cattgtatgt    134820
     caacggcgtc ccagcagaag ttctacgagg tcaatggcat cctcgtcatt gtcatggata    134880
     ttctcatctg ggctgttccc attccgatgc tatggcgtgt tcgtatctct ttggtaagta    134940
     caaagatacc atttccaatt ctttgccacc tcttgattaa catcttacag cgcaagaaga    135000
     ttgcagtact gggagttttc agcgtgggcc ttctgtctat agctggtagg ttgctcatta    135060
     cattatccgt gcctttttgt ttatttctct ttcgtctctt ttttcccctt aaaacagttt    135120
     cggattaacc aatgcagctg cttgcgtgag atacaacacc gtcttgcaac tagccaacaa    135180
     tccagatgaa acatacgtcc tcgctgcctc gcttaactgg tgtggcatcg aagcctacgt    135240
     cggtacgtac catttttcct ccccgacacg tcaggcttcg tactaatgga tcatcccgta    135300
     gccatattct gtggctccac tccggcatta tatgtctttg tgaagcgtta cctcccacaa    135360
     attctgggcc cctcctacgc gcacaatcca acttacccgg gacagagcaa tgcaaagaga    135420
     ttcagcgcac ctttctgcag agtgtcccgt caagatgtga gcgaaagccg gctaggagag    135480
     agccaagatg cattacatga tggggatggc attatgctta agacagacat tcactgggag    135540
     gtcactgata tagatgcgga aggtcgagtg gactcgcacc atgtaaatat atgaagggtt    135600
     gcgccctcta atctgaacag cagatgatat caatgtgagg aatttgtgac tgatatatgg    135660
     cggcatgtct gttaaagaat gtgacaattg caggccacaa tgtggaagga tctcagaccc    135720
     accagactag taaattccgt caccgtcttt ttgtcgtctg gaatttaacg gtttactgct    135780
     tattctaagg aatatcttca tgtgtttctc tcccctcctc ttggcaggga cttctccagt    135840
     cgcttagagc cgcctgcctt cctgcatctc cgccgtttgt cccacggaac gttgtcgcat    135900
     catctttccc aattactatc gctttaccgt cctctctaca ctaatctgca aataccaaac    135960
     acactactac ctcactccaa acatcccaac tgcttccgac ccttccggct acactaaatt    136020
     tgaagcatgc tatcataatc gctcgagccc aacaaattcc cgtcactcgg gcatccccgc    136080
     catcaccatg aattcctgtt agtcactttt acccccaacc tcaccctcta gtcccaagtt    136140
     attagcctcg gtggatcata aatcataata tagattatta acaaccaact agtctttcac    136200
     tcaaccaagc acgccaagac ttcatactat cacatcccct ccaccgtcaa cttagatgac    136260
     gtccaacaaa tcctccacaa ccactccacc cttgcaaaca tattttggcc ccaaaccgtt    136320
     aacgatccag aaaacctcat cttcgaaaac caaactggcc ctagcactac agaaattcaa    136380
     attggcccag catcaggttc aaatcccggc ccttccgcga caaaatgcaa agctcgcatg    136440
     atttctcacc acgaggccag agaggttgtc gttgaggagg aaatgcctct cgggcttcgg    136500
     atgaccctgg tgtatagggt ttctgatgag cctccccagg gtatctcggc agaagaaggt    136560
     gacggtctgc tcgcgttggc tgactcgcag ccctccacgt cgctttcgcc ctctgggtca    136620
     cgaatagggc tgtatctcga ggtagagaga tctgtaatgg caccgaggcc tctctcgatg    136680
     ctggtcaaaa cgacggaagg gccggttgta aagacgaaga atctgttgtt cgttttggac    136740
     gagttaggga acgggaggga cttggatgct gtgttgggtg ctcttaatga tggactgggg    136800
     gaatcggatg atgaaggaga gggggtgttg gagaagtata aggcggattg agacgcatat    136860
     agccacctat tctttggaaa gtttaaacct agccgctact atataatcaa accttggtgg    136920
     gctaagatca tcttttcagt gccgtgcctg ctacaaacta ctaatacgga acggtgatct    136980
     tggagaatca attgattaac tgctgaacca aacagacccc cgtccctcta tccaagccag    137040
     agcgtctcgc atctgaccaa aactcaattc cggtgcattc ccatcccagg aagggtgaag    137100
     gaagacggtg atagtgctag tgaaggcaaa gacatgaata ccactgaaat gattggtaat    137160
     aattccagag ccgaggacgg gaatgaagcc ctattacctc ttcctgaaga ttcaccgtac    137220
     tcggataggt aatatataaa tgtccccatt tcccttcgca gcttcttctc ttttcttcct    137280
     cctacatcct catcttcagt cttggccttg ctgcatctat aacattaaat taataagctt    137340
     cataaaatta tgaatatgat catctactga taatgtgaat atataaaagt ctaccgtacc    137400
     ttactatctt ggggtctcga gaagactact gccataatat ggattataag aagcatgagg    137460
     caggccctgc gccgcttatt ccaaaacatt atctcttgat agcttatgcc tcttcaccaa    137520
     tacgagatat attacaaagt ccagagctgt ccagatatcc aagcccatcc aaggtacaag    137580
     agttcggtgc tatactaatg taaacagcaa ttaatactac atgctacagc gagcttgaag    137640
     actactcgcg ctctattgtc tattacccaa atatgtctca caatagcgac aggatatgaa    137700
     cgggacaata agaaatgcct tcttattaag gtggttgatc ccatcaaagt cgaagtcgca    137760
     cacatctacc cactttcttt gcgtaagaaa gctggacatt ctgagaagca tttaatctag    137820
     taaatactgg aaatgctctg gtccgcgaag aatattgagg cttggaaaat cgcaattttg    137880
     cgactggaac gcacaacaag ctcgcaaatc atcatcctta gcctcgacgg tgtacggaat    137940
     ctgaatgaaa aataatttta agccatatca gctgtcagat gaaaaggtgc ccacggtggg    138000
     attccactcg ctccaaaacc gccatataat gtcttgaccg ctatctccat cgcttcaaac    138060
     actggcagca accgagtcaa tacacatcaa gtcgaagtgc atcacaagcc acattgccgg    138120
     tgctgtggat ctgcttctgg acctattcct acggtaacac gtggccttca agagcctacg    138180
     aggagaactc attaccgtgg aagacggcgt aaatcatgcc gtggtcgacg aatatgacac    138240
     taaccatacc ctgttcaatg cttcgttgaa cggctgttca gacttcaaac atcctctaag    138300
     tcttcacttc caaatcagca ggataaaccg ggtcacatac aaaaggcgta cagtacgcgc    138360
     ataagagtgc ccgacagaac ttaccaagct tggctcgctg atattgaaca gcggtcgaag    138420
     ggtcaaggca accccgttgt taaagctcac cgaagaaagg ctggcgtcca tacctcgatc    138480
     tcggctatgg gaataacata gtaaactaag ttactatgtc attatgggct accgtcggaa    138540
     catgcacggc cactagaact ttccggcaaa tactcgcccc cactcacgta agggcagact    138600
     ggcgaacctg tatgctgtat ggcgaacgac ttctaggacg caaaaccagt gccaccgaag    138660
     atgcctaagg aggcagaaat gagggacgag tccacccagg taggatggac gaccgacttg    138720
     cgccccaagg tgtcgaccac tacaggcaca atagtaattc aagccttcga gccagtttat    138780
     cttaagccag aaatggggaa tagtttctgg aagtttgcca ccgcagacgg ccagactatt    138840
     gcagagtcga cgatccagta aatgaccaag tattcaagcc gggacgccaa actacgcctc    138900
     gcaaagcgca gcttcgttac tttacttact cgtttacctg acatacagac tcgcgcagaa    138960
     gggtattacc acttggtcgc ccggattaat tccctcggtg actagatcac aattaggtca    139020
     tgcatcgcgt caagtctaat atatgcttat aatctgttac ggagacttaa tgtctatcgc    139080
     aatacgcaat atcccacttc gaaactattt cgaatcatgc ctcgtaatat ggatacagca    139140
     accctgcgtt ataaatggtt ctcacagggt gatattggcc caagatcaat cataaagctc    139200
     aacaatgact gggtcgtcca gcaggctata agtgagcaca cattccagaa agatcacgat    139260
     gaccatctcg ctaggagagg tccttcctgg acggcaattc gcctcctcgt cgaagatagg    139320
     agcgcgcgta ccaaggccta tatgcgcact tacaagcaac ttatgcacgg tggcacggag    139380
     gccgagccag ccagggttcg aacccggcag gctaattctt cgtggtgtcc tgttgagctg    139440
     aaggcttacc gatcacttcc taacaagcga cctctcattg taccgcgtct tttaggagaa    139500
     agggtgacca agcaagatgc aagcggttgg gtgccagacg gcttcctcat atatattgtg    139560
     tgggaaatag tacccgggat tcagctcgga gatccttgtg gttccaaggt cttttggaca    139620
     ctggagcgag cagagagaga tctcatccgg gagaaattta aggagggcta tatgaagctg    139680
     tacgaatggg gattcgaccc tcgtcctggg tgcggccaga atctcgtttg gaacgcgaaa    139740
     acgtcgacac tgtaagcagc tggagggcaa catgcgtcta catgctaaca gatattacct    139800
     taacgtatta taggtacttc gttgggtggt ttttggcata cgaggacatt gagaagaaag    139860
     agtggactcc cagattctgg tatttctggg acctagtccg tgctcctgag aagcgtcaac    139920
     gtcatgaaaa tccggatgat agttggatgt ggtaaacgat taaggtctag ccagcaacat    139980
     tatggtactg gtttatggac cggccttgac aaacaattta aacttctact ttaaatgcaa    140040
     tcaggccatt gcagggtatt gaagatatct tattcatttt actactatcc tctgaccacc    140100
     tttatcatag tatttggtcc gtcaaacatc ccgtcgactc caaagagaaa cggtgggata    140160
     tttcttgaaa taatttttct tataaaatcc cactccctat tctttattta cacttgaacg    140220
     cgaaacatct gtgccatgtt tctgttactt aaacactatc ggttcagtac aaacgggcta    140280
     tcgtccattc ttataaatct ctttatttgc tcaaaactat ctttcatata gctttttcat    140340
     gggggtatta tgcccctcca tctagatata tacctatacc aacactgctg aggcctagtt    140400
     atatgtccca ttcccagctg atatgcattt gctgaactag cggaagcaag gaaaacagaa    140460
     tgagatgcaa gcaactcctg atatgggagt cctcctggca tcccttgtcg caatttactc    140520
     tatgccaaaa tagagcactg gccaagttcc atgtagaagt agaacatcac tttctcattc    140580
     tcatggacaa cctctgtcgt cgatgttcag gagccactgc cggcacattc ccatggactg    140640
     tcctatgtgt gggtttatgt tggtgatgag cacggagtcc agggtcagtt caacctgctc    140700
     ataggacagg ctgctacatg taccaaaaag aaagctatgc gtcccaacca aacgttaaga    140760
     aatttctatg gaatactgtg caaggttgtg cacaagagac aatgtagttt acgtgcccga    140820
     aatcccaagc ccagtgggac agagattacg gcctacaata ttctaggcaa gagcattcgc    140880
     gcatggcctg atctagagtg gggatacaac gtatctcgtg agatattttt ctcgcgtatt    140940
     ctctgccccg attgataaaa gcaagaactt ggggtcaatg cccagtttgg catctcggcc    141000
     ggttatcttg attacccaag ctcgaaatct gttacaatca atagcagccc acatatcgag    141060
     acacccagtg atcaactggg cctttttctc aagccagtac taatgctaca gaaactcgca    141120
     cataatttag aagataaatg gactgatgaa gatcctgtga atgcagcctt tatcgagctt    141180
     ctcaatggct ctggcttctt tcttctggtg aggaataaat actactagta cttatgagga    141240
     cagtcacctc agggaatagt tggacaatga ggacacacgt tttactaacg taggacaaac    141300
     aattttcacc ttctaagtac aatttactgt ttcaggatat aaagaaggga tatgctaata    141360
     tacagccatt actgtattta ttgtctagct gaccagccca aggaaacaca atcgcaaatc    141420
     attaaaattg tctgtagagt gcaacggttt tgatggctcc agaaagggta tcgggtccat    141480
     cacttgagaa cagcagccga gaaagaagca gaattcccac aaatgataat taacgttgtc    141540
     aataatacat attcatgacg tttctcgtcc gtcgttgcgc gaactcctac agtagaggga    141600
     atgttcctgt ggcacaggcc aagtactttc tctaattcca ctcggtcacg aggaccacta    141660
     actatgcgcc tttcgagtgg ctgataaacc ataatgactg cgcaaacatg gactaagatc    141720
     cattagtgaa aggtctcaag cgtcgcaaaa cgcaagtcgg ctgcggacgt tccggtggac    141780
     gagcacaatc attgaaacac tcatgaagtc cagggacgag ctaatatgcc tttgttctag    141840
     aaaaccaaac tcacctcaaa ctaatgatta attcagacca gtttgagctc ggatcgagac    141900
     atcgcggaca attttttaag ctcttataca acgtggacga tgttgatact tattgtacat    141960
     agacctttgc aaccagtgta tgctgattat cagtgcattg tattaccagc agatctgagt    142020
     ctctttatta tcctaattat tacattgccc gcgtgggagt tattcaactt tgagtagaac    142080
     aagaattggg aacggaatat tacagataga catgaggata cagagatcag agtccattcg    142140
     tggttctgag gcaacggaca tcatccggca agtaagatgg agcatgcgcg aggacagaac    142200
     ccatctacga tgggatacaa aagtctgcga gtctactcat gtccggtctg cataaaaaaa    142260
     gacgaacctt gattcaaatc gctgtattga acacgcaatt gagcgacgca tgggattatg    142320
     cactgcttca cgtctcatcg attttagcat tggtgagatg ccagtggata agagatttca    142380
     ctgtgtgtgt ggtgacattc gaccaaatac ccctaaaaaa aagaaaaaag aggggagggg    142440
     gggggggggg gttatgactt cacttctcca tttgcaaatt cgacttacaa gacccgacta    142500
     aggtgttggc ctggaaattg tggaaggggt ggttatgtgt tatatatgac ctacgtgcgc    142560
     accatatccc cagtcatcac tgtatcatga tgtgtaatag ctgaaaactc tgctatatca    142620
     cccttcctcc agctttgcca tttcatttct gctcacctct catcaccctc atcgctctca    142680
     tcactctgac tactcctact actctcatca ctctcatcat ccaagatgcg attctggtcc    142740
     tggcttcggg gagagcccag acgcgaatat tactacaaaa aacgtcttca ggaaatcaaa    142800
     gaccatattg gctatgacac cccaaaagat ccagtcaaga aatggatatc cgagtttaat    142860
     gatgaggaaa cgctggggtt tgccattata cagcgacagc gtcgtctgga gaatgagaaa    142920
     aagacggctg aagagcaaca acagcgagag gagaggcggc agtttcggcg gcggcggtgc    142980
     gagcagtgcc ggtaccagga agagatgtgc agcgcctgcc atgaagcgac gcaggcagca    143040
     gatgttccac caccctactc gagcagatcc ccagaggatt tcaagcaaga tctggccaag    143100
     ctgcgcgaag agtttgtgaa gaatcgaatt cgcttggagg cgatcaaaca aaaacttaca    143160
     gatagtagga gttggtgggt cacatatgcc atggcccccc gctggcatag agacgacact    143220
     ggccggacgt ttaagtggat tgaaggccgg agaaagtgtg ctgatctggg gggttgctgt    143280
     ggccgtactt gcggatgctg cgagaaagtt ctgattgaat atcaacggcc gaaattctgg    143340
     cggaaaacac actcaaaggt acacttcagg gtgcatggtc attgcacggt ggagtgtgct    143400
     tgctgtatcc aattctgggg gttctatact ccccatcctg ctcttcctgc tatgtactag    143460
     gaggcgcttt acctttagta cagacagtac cttcctcaaa tatcaataac tcgctcaacg    143520
     gcaggcaaac catcgtcgta ggctttggat cccctctctt ttctcttctt cttgttcttg    143580
     aaaacagtcg ctcgtttgac aacgctcgtt tcacacagca ttaagtcact ctttgcgaca    143640
     ttcactctta tccatctcgt tcattacccc acattctctt ttatataggc ttttttccat    143700
     tttttttttc tttagatagt tatggctgag gcggtagatg ccaacgccac actctcgttt    143760
     tggcagaagc tagaccccag tcacgctagg tggctgttcc tcgcggtctt cgtgatcgtg    143820
     atttgcaacg ttcttttcgg tgcggtgagg ctctatttag agctattgat caaacgccac    143880
     cacatcgaga agctacgtgc aatgccccca tcacggaggc gcgacgtgga aatgggtaag    143940
     aatgaggaag aggaggattc tgggggagaa ggggggcaga ggagggagcg gagggggagg    144000
     tggaagaggg gggaggtgag gacggagagg gcggtgagga cggggtgggt gttgttgaag    144060
     ggggggtata ggttgggcgg aggtgggagg agaggaagag gaggataggg gagagaagag    144120
     ggggtttggg tgggtttaca gggtgggtgt ggcgggaggg tgggagggtc ctctctctat    144180
     agaaccatgc tggccgtttg tctaggactg accgtttcac gatgatccac atcgcattga    144240
     cttgaagagc tcgccgatga agctcagcac ggtatacggc atcaacttgt gagttgaaag    144300
     gatccctttg tttctgatat actgaccgtt gctataggac atcgatttat cttttcatct    144360
     cgcctcgacg gctccagtcc gatgggtttt ataggcgtcc agggggtgtt ggagactatc    144420
     tggataaatg ccagtaagtc acacctttga ccattgccat cagttgagcc attttctatt    144480
     atcaacctca tactgacttc gccctgtgat agcaacctcc gaaaccatgg ctcggaggct    144540
     caggatgatg acttggaaag gagggttaag gtttatacgg gagggaaggg tgataagagg    144600
     aggtgatgtg tggaggtggg ttgatgcgaa aagggatata gagggaagga agaatggagt    144660
     gagatggata gagggagaaa ggcctggtgt actgtattat ccacgtcttc atatagcaca    144720
     atgggaggaa gagagctcga tcatggggct ggaaacaatg ggtttcaatg ttgatatcag    144780
     atgcggagta tcaagtcagg ctctgctgaa tgtacgacag gggactggta ctcttcctta    144840
     ctaatattta aatatgccgt gcaactgtag cagttcaagc tttcagccct gtgaaatgca    144900
     ttactagtca tcttatgcat ctatgacaaa tagatactat cttcaagtca aagagtacgt    144960
     aggtaagagg ttggggacat catgtatgtt atccgaatat catcaattat ttacaattat    145020
     attcatgaag cttccgaccc gggtggatca tccagggtta catcgtactt tgtgaaagag    145080
     atacatcata ttttatgata cctagcacgt ctaggattca attcattagt cattgtatag    145140
     gaaggaaatc atttaataat cgttctgaca ggtgatgtat tgctattatg catatcaggc    145200
     taattaattg gaagctctag atacttgtca ccgaaagcca atgccaagcc gctgactggg    145260
     agaacagaca ggtctaacat ggataggaga atttgtatat gtcgggaata tgaggttgag    145320
     cgatgctaca cagcaacacc gggtctcttt agatgttgaa acaaagtagt agttgtaata    145380
     aaatgatgtc gtattgtcac cgaaagtcgt aacaattgtg taaataaagc cagccagggc    145440
     catagaatat ccgtcctatc tatatcatca atgggtaccc accggcggga caacgttcac    145500
     aggtttgcgc ttcgagaaaa gattcttcaa tctgcgaaag actgttttat cattgacagg    145560
     cgcgtcctcg gttcctcgcg atctgagctt tcggctcgtt gccttgctca ttgtggacca    145620
     cgaggttttc aatcttgagg cattagatcc aggacgaaga tttgaaacat tgtccgtcga    145680
     ctcggtgtaa actggtaggt gtggcgagct ggcattagca attgtgcctg ttctcatctt    145740
     ggccatcact gcctgctgga tgttcatgtc gcgttcgctt tcatctgcag ccgtgaggac    145800
     gtgtgctagg ccgctgctgt cgataataat tccggggtgt tgtttactct cttcgacagc    145860
     agaagagccc aggtccagcg gagccgtgta ctctgggggt tgaacggttg gggtctccaa    145920
     accagctact ccacaatggc cgttcggtga tggttccaca gacttgccga gaccgggtga    145980
     aatattgctg gggactgaat ggggtgaatg aaagctagga acgccagtgg acatgagtgt    146040
     agtctcggga tccagataga cctccacatc atcaccgcaa acagcatcca caaattgagg    146100
     gccatcctca ttcgaatgag attcggactc agaaccatcc aagaaaggtt tgacactctg    146160
     gcccctatcc ctactccatt ttcccgaacc tattacttgg ttatcataac ctgctcgact    146220
     aggtggggca ctcgaggact gtgttccgtc gctggggagt gctgagtggg aagatgtcgc    146280
     tcgtcccgat ttgagactat cgcacttgag gttctggctg gtctgagaat ggagaaccct    146340
     catagcctgc atactgggct gttgggtcaa ggcgaccccc gaatcgtact tgttcttcag    146400
     ggctgccaca tcggctccca ctttcgggga cacatacatg gagtcgattt gaggcgccgt    146460
     ggacgattcg tgcatcgtcg tattggttgt gaccgcgcga gatcgcttgc tagaccccga    146520
     ctgctggcct ttcccgatct tgtatacgag taacgaacag gcatttctaa tctgctcttc    146580
     cacgtcggta ggtatgtttg gtcggtcaac caacggcgat ggtggctgat aggtgccagg    146640
     gctatcaaca aaatcccaat aacgggttgg ttggttatgg gcaggttggc tttgctgggt    146700
     tatcaaagtg ggtttctagc tagcacatta ggccacgatc gtgaggcagt ttaagggaat    146760
     acacacctgt gacccgaaca gaaaagaaaa tgaggtgcgt cgcttcgtgc taaactccat    146820
     cgtggctgat gtttgcaaat atgacgaaac aagaggcgtt cggtccggaa agggatcagc    146880
     tagatagact gcaggaaaga ctgtggcgac gccagccaat gtagaaggac gcaatggtgc    146940
     gtcgacaaac gactcgtgat atggagagta gcgacacaaa ggaaaacaaa tccggtcgct    147000
     gggctaccag tcccagggaa atggaccaaa accggcgata ctcaagatca gcccagtcca    147060
     attcctgagc caaagaatcg ctcgaagagg caggttctgt ccaggaactg gtgggatgga    147120
     atgtggggag cgattcgagg aatgctgtcg agatcaagga aaggaggggt gaggaccgat    147180
     ttgaaggtca ggggaagaaa agccaccgga aattatgaga gacgagaggt aacaagatga    147240
     ctcaggagca atggaccagt ccatctgcta ggtataccac ctctaataat caatcgcaag    147300
     gagtaaatag aatgcaaccg cggcgctggg gacaccggct gtctcaacga gggaccaaag    147360
     aatgaaatat cagagactgg aaggccagtg agcaaaagca aacgagcgtg gttggtgcga    147420
     tgaggccgtc ggccagggaa gagaaagcag gaaaagagga gaccctgcag aaaagcaagc    147480
     ctttgtcaca cggcatcacg gggctgctgc aggcctgaaa acctcgccgt ctgattgcct    147540
     cgtagtggcc ccggacttaa tcttgcagtg cactattgtc gatgatgcag ccagtccggc    147600
     tgccattcgc taggggtgaa accggccaag gaggggtagc aaagtaggcc atgcagcggt    147660
     cgatgcgtat gagatgatga tgtccgcgct tttccacttc taatggtagc tagtgctgat    147720
     cagaacgtca cagagaagtt gcgggttgtt ctcccatcag actcactatc ggacaaacca    147780
     agtcatcccc caatgcgagg atatgagtct cacacgaatc aactgggtgt gacagcatgg    147840
     gtgttgcacc aaacggaacg cttcccttgt ccaacggttt cgcaaggggg ccgttggggt    147900
     tggaagaagg gatgaatcaa ggggctggac aaacttttcg tggaatgacc gatcgggtag    147960
     caagaatgag atccatcact tataggcaat tctagtggga ctgcagcaac ttctgatagg    148020
     cggttcgccg ctgcctttcc tgctgggaag agttgatcga acgccctact gtgtacttaa    148080
     gttgccatca ccgtcatgcg gccgccatgc ggaaacgctg tcggaccatg aatatgatcg    148140
     atattgtgac acaagacgaa ttcagtatcc cggactcaag catatccata ttgacccatt    148200
     cgcccgaaac tcaagtccca gaggctctgt gacatctccg caatgccgaa gcagcatggt    148260
     acggagtaca gcaagcgtct ccgtgatgca ttctgggaag gttgaagcac cattccagcc    148320
     gagcgagtgg aagtcaaaat gatacatcac atcctaaccc gactcaaccc gtccatgcca    148380
     acctaataac cagcttcaaa gttcgcacgc agcatcccca tctgcactcc gcatttcgct    148440
     tcaattcctg caagcagccc agctctgcct tgtacttaat ccccgaaagc ctatccaagg    148500
     cgttctcaca acgccaacca cgtcatattc cctggtggtt cttccataat gacctcagga    148560
     gggctttcag gcaccgaact ggtaaggccc aacggcgggt atcatatgcg gagcagagct    148620
     gcagctggcc taggttcctg gtgcaacgat ggttgctggg cggattggga atcgaactag    148680
     atggaaaagg ctggactggt tgatggagaa tattgagagg atgatggtgt gatggtaatt    148740
     ccgtgtagta ggatgaggtg aatgaatgat tttgaagttg agtctgcaga gttcgtgcgg    148800
     gatgtctggt tacatgagtc cttaattaca aggccacacc gccaggctcc taatgtagtg    148860
     gataaccggt gctctgaaga gatgacaaaa caaatctatt taccataacg aatctatgta    148920
     cgatcgaaca cttttcttat caaggtcacc caccaccctc ggtgtcttga cgtgtgcaaa    148980
     gacactcggt gagggcttat ctgatggaga gcagttggat gcttcttttt cagccttacc    149040
     tgtgtagagg aaacgagaga ggcagttgga tgctcatctc tctgactggc taagataata    149100
     aatcacaaga ccgcaccgct acttccccaa ggcgcctgag cctggcgggg tccgaagccg    149160
     ccggcgcgtc ctctctggcc gagagaaagg ccgggacatg cccacgcggt acatcaggca    149220
     gaataaaagg ctgcaactaa tgcgccacat ctaataggac tctgagggtc agtttaccac    149280
     gcggtgatat cttccacttc cgcttcgccg aacgtgctgc tcttggttag cttgttgact    149340
     ccgtccacag cctggactcc ttcggcaggt gccttggaca tgatgtccgg caggacctcg    149400
     cggaagaact cgaggatgta acggttgacc tgttcgaact ggaggaggaa ggcgtcgtga    149460
     ccttcgggac tctcaatccg cttcaggcgg gagtccggaa tgccggccgc gatctccttc    149520
     tgttcgtcga aagtgaacag tccatcagat tcgataccta gaaccagagc aggctgctga    149580
     atttgagaca gggcttcacg gacggggttc tccgcggaag gactggcccg gtgtcgggac    149640
     acatcgtgcg tgtcaagctt gcgggtgatg gcgatgtagc aattggcatc gaaacgcttc    149700
     acgaatttct cgccctggta ccgaaggtac gactgcgccg agaaataggt ggggagccgc    149760
     ttctgggaac cgttggtctc gatggtcttg ctgaaggtct tggcaccaga gaattgagga    149820
     tcttgaaact ggacttcaga atgttgggcg tcggactgcg gcccgggcga gctgcgtcca    149880
     ctcttgtgtc cgtcgttgtg gatagcccag tgctcgttag ggggggtagg cgatctttct    149940
     tggccattga tggtctgccg cttggaggga tcgggcacgt ttctgccaaa tcgagactcg    150000
     aaagagttgc ggctgcggta ggtgaggagg gcagacatgc gcgccgcacc caatccggtg    150060
     gccggaggat cgtcaaacgg gtagtagcca tcctcatact tcgggtcact gtagatgctc    150120
     tgccgttggg cttcacccca gctgatacac caagccgaat gacgaggaga ggtggcgata    150180
     gggacgattg cacgaacata gtccttgcca aagtaggcgt actcgagagt aagcatacca    150240
     cccatggagc cacccaccac ggctgcaatt tgacggatgc ccatgtcatc cagcaccatc    150300
     ttgtgaatcc tatgcgttgt tagcacgccg ttacaccaca aagaaaacaa gagaatgaaa    150360
     actcacttta catcatcacg gacggtagtg agaggaaact caggaccgta caagcccttg    150420
     gacggatcgc cgtccttgta ggtcacggca ctggcacttc cgtacggact acccagactg    150480
     ttcaagcaga cgacgaaaaa ccgcgaggta tcgaaagctt gaccggggcc accaagcagg    150540
     ggaccccacc agtccgcgac atccgcacta ccactgagag catgacagat caccaatgca    150600
     ttgtcacgtt cgggggagag ttgacccctc gtcgtgtagg ccacaggaac gttgtgcaag    150660
     gtaacaccag actcaagggt gaaggaagga atggtaacga tcgtttgatc ggtgatgaga    150720
     gccgaataag ggttttcggg ttgggagtca gccctctcta cgggatttag tagctgttca    150780
     catttaaaag gcgggggagg ggaagagggg ggaaactgac ggaattgccc gggggcggtg    150840
     gcttgagcga ccatgctgaa cggacgcgtg tggttaacgg acgtatggac gcagaacaag    150900
     tagcaagaac gaagttaaag taatgggaga aggagagatc aagatgaagc aagtagagac    150960
     acacaaatga ataggaggga aagttaaaag gtaaaaaaga cggaaaacgc aagatgatgg    151020
     cgatctctgg tcccccgggg agttttccgg ccttgactca tacgccatca cgggccaatc    151080
     acatgtctca cattgatcct gaggcaggat tgagtctacg gaattaggtt ccaccgagga    151140
     tccgcccccg gtcccgcttc ccggcttttc tctgtctctc cgatcccggg ctctccaagc    151200
     atcgtcatgt ataccaccaa ttgaataagt ggtctgcaac aacggatcca gcacgtttca    151260
     gctgaggaag ttatgagatg acagtgtggc tgcattaggg atccggttcg gtatcgtttt    151320
     agcgaatacg aagtctaccg tttcatcgaa gcttcaattt atttggtcta ggccccttcg    151380
     cttgctatgg ggccgagtaa gtatatcgaa aacaactaaa aagctatata atggacatga    151440
     cgtttctcag acttgtcact tgtttccgca gcgatataac ttttgtcgat gcaatgtcta    151500
     ggtaactgaa ccagcaacgc tctaacacct cgattttaac gatatccgga caaaaagaaa    151560
     ttagtcatgt atatgattgt tcaagcctcg aagataaaag atcatgtcat ctccaaacgt    151620
     ctcacaatag agagatacta ctatcggatt acaaataagc ttggatataa aagaaacaac    151680
     acattgacaa tgtctgaaag ccgctatatt acaagataac ctttaatcac aaatctaatc    151740
     catcatcatc gctcacccac ctacagcgaa acaaccaatt tctttgccga aacgcccttc    151800
     ttcaaaacat tcaacgcctc ctgcaccgac tccaatccct cactcaccac ctcaaccttc    151860
     ggcgcactaa caaagctccc ctcttttaac gccgcaggca agaaatccac aaagatagca    151920
     ggcccaacct cattctcagc caagtcacca ccaaagacga acttcgactc gaccccatcc    151980
     gccaacggtc cagacggcgg actcaccaac gcaacaaact tcctcccctc gaccctcgcc    152040
     acaatctcac cacacttttc aggagacccc gttccaatag ccaatgcacc agcactagac    152100
     ttccccgcaa atgtagcaat gagatcctca accaccgtct cggagttata gtcgaagacg    152160
     tgactcgcac ccagagactt gacaaagtcg taattccgcg gcgaagcagt cgtaatcact    152220
     tcataccccg ctgccacggc aagctgaata gcgttgctgc cgacactgga tgatccgctc    152280
     cagatgagga cggtctggcc tgttgatggg gcctgagggg ccatgggatg ttgcagcgcg    152340
     aggtagtctt tctggaagag gccacatgcg gcggttgaga tgccgagggg gattccggcc    152400
     gcatcggcgt aggatagatt ggatggaatg ggcgatgtca tatgtgcttt gagcacaacg    152460
     taggtctgga aagcaccttg gcaggaacgg gtgcttttta gctcaccggt taggccgagg    152520
     acacggtctc cgggcttgaa tcgggaggag atggtgcctg gtccgacttc aactacttcc    152580
     cctgcaacgt cgctgcccag aatggcggga tagggggtcc aggcgaagag ggcagagcca    152640
     aggtcttgac gggcgtagtc gacaaggttc agaccgatgc tgtggttcct gattacgagt    152700
     tcgttttcac cgggatgggt gtagggtgct gtgtcgattt ccaacgggta ggccttttcg    152760
     gacttgagcc aggcggcggt gttggttggg gccattgtga tgagtcaatt gtgaccaaag    152820
     gcttagtatt aagatatctt gagtaatagt agagaatact tgtgaagatg ctacaatgaa    152880
     ccgtcagttg ttcctgacca gcgatctata tactaccctc gccaagttga agttcaacgg    152940
     catctcggat tagggcacgg tgataaggcc gtaatatccg atggcgaatc cttcggtgct    153000
     tacaccccga cggggtttgc gattcttaaa tcctacggca ttgccgccca agtctgacgg    153060
     aattccgacc cctcttatct tgtgtcatga ttcatgatca aatccgcttg tcgccatgga    153120
     tcagtccccc accgatcagt cccccaccga gtatgatctc gccccggccc catacggccg    153180
     cgcctgcatg aattgctcgc agtctaaatg caaatgcatc ctgcccaaag ggggcgggcg    153240
     atgccagagg tctgttttac gtatagtgag accagtgtga gaccagtgtg aactgaatct    153300
     gacggtaatg ggtgatggca ggtgtcagcg cctgaacaaa gaatgtcggc catcggcgtt    153360
     ccatcgacgg cagaatgcac gcaagccctc gaagacaggg agattggaga agaagctgga    153420
     tgatttggtg acactgcttc gcgcgcaagc gccttcccat gcccatgcgg gggattacgc    153480
     agagttgatt gatgatctgc gacgagagcc agatgaagac ctccatcacc atccaccacc    153540
     accacgctcg cagatcaagg ttactcggac agtctcgacg gcggagaaat ccatcgactg    153600
     tgagttcctt aatcactttg cgcaggtcgg agcgaatacc tcctcccggg atgagtcgaa    153660
     cgcgagtgca gcagagccga gctggtcgca ggctgaagag tatctgagca tgtttgtcac    153720
     tcaaaagcta ccatatttgc cattcgtgta tttcccgcca ggaacaacag cacagcacct    153780
     tcgcagtgac cgtccgttcc tctggctatg cgttatggca gttacggcaa agagcccgag    153840
     tcagcgacgc acgctgtgcg atagaatccg cgatactgta gcccaacgca tggttttaga    153900
     ctgctacggt cgcgatctcg acttcctcct cggtctcatg gtatacattg cctggtacga    153960
     tcacccttcc cccttggtaa gacatactaa cagccacagg tccaaccagc aaatcttcaa    154020
     gaggctcaac atgaccatat acagccagtt cgccacagcc gtagtcttcg accttatgct    154080
     caaccaggcc cctggcggag acaaaccatc actactgact atactccaaa cccacccaga    154140
     cgaggatccc tccccgccac gagcccgaac aatggatgag agacgcgccg ttctgggctg    154200
     ttttctctta acctccaggt actccatcca cctcccatcc catctaccaa gtataatccc    154260
     actcctaacc caatcccagt atatccctct tcctagaaaa gagcgaaccc cttcgctgga    154320
     ctccccacat ggacgaatgc ctacatcaca taagtgaaca ccccgaatgc ctcaacgacg    154380
     agattctcgc ccagcaagtg cgcttccaac tcatcaacga gagaatcaac accaccgcca    154440
     caaccacaac cgacttctac cacaccagcc tcctatcccc ctccccattc agacccccac    154500
     tatcaatcta cacccacgcg atagacaccc acctccaaca aacccaaagc aaactcaccc    154560
     cccactccca acgctaccga atcctccagc tccaccactc caacacgcac ctcacgatcc    154620
     acgaatccgc ccttctaaaa ccattcccta acccctctac cacacaaccc cccaatcctc    154680
     ccttaacaat caatcatcat cttcaccacc tcgaatccct ccacgcctgc ctctccgccg    154740
     tgaatgcctg gataacctcc ttcctcgcca tcccaccagc cgagtacgca ggcttcccct    154800
     tccccatttt ctcgcagctc gtgcgacacc tggcggcgtt gtatcggttg tctacacttg    154860
     atgatccgag ctgggatcga gggtttgtgc gccgcaccgt cgatctgatg agtgtgatgg    154920
     atcggttgat tggaaacctg ggacaggcgg cggcgttggc gagactcgag gcgcagggcg    154980
     aggatgagga tgaagatgtg tttttttatt cgattgggaa gtacgagtct gttaggttga    155040
     agtggggagg tgtttttggg ggcagtgccc ctgggaatgg gaatgggaat ggggtcaatg    155100
     ggggagtggt ggagggacag ggggtgcagg atggggttgg gggaagtaat gggttgggtc    155160
     tgggtctggg tcaagctcag ggacatgcac aggcacaggc acaggagatg gggggttggg    155220
     gggcgggtta tgatgattgg ttgtcggagt ttttgaattc gatggtgcat tgatcattga    155280
     tcaataatag tagtattact agtatctttc ggttgcttaa tgggggtatg ctgtgggttt    155340
     gggatcggtt tatgagtatg cttctctcag atattatatg atagatagta tatagtatat    155400
     ctactactat gcaagcatct cccaataata caccaaaaac aacacatcta ctgtagtatc    155460
     gagcttgcta tgcaaaaata tctcccccct ccggtccatt cctcgccttc tccatcctct    155520
     ccacactcgt cttgaacaac cttggcatcc ccgtctcctc gaacttcttc cccgactgga    155580
     tcatctccgc cagtccctta gcggacagca gaatcaccgg cattccatgt ccattaaacc    155640
     cagcacagac atactgcccg ggtttattgg gaacttcacc gatgtgcgga tgcgagtcgg    155700
     acgagtagcc cataactgtc atcaaatcag taccagccat tcctcaattt aaatagaaaa    155760
     tacaaaggag aacgaagatg aataatactc accacccgtc caaatctcct tcacatacgc    155820
     cccactattc tcccaccccc taaacgtccg ctgcatatac ccatcatagt aactctttgc    155880
     agactcaatt aacgtcgtat catccacaat tccataccat tcctcccgct tgtctttgaa    155940
     tgtcgcctgc gcgccaccca ctataatact cccatccggt ctggaaatta gatagctgcc    156000
     cccgccgaca acgtcagatc cgtacccgat tgcgtacgag taagggagga acggagcggg    156060
     cttcttgccc tctccctcgg ggactgtaat atgacagcat attcccttgc agggaataat    156120
     attggccgag tactcgggga gtaagccggc cgtgtaggcg ttcgtcgcgt agacgatttt    156180
     gcgggcgcgg agagagccgc ggggagtgga gattatgttg atgttgtctt ctgaggtgat    156240
     ggatgtcact ggggtgtaag tttggacgtt caattgtggg aattttatga ttttgctcag    156300
     taggccgagg atgaatttgt agggccagag agtgcccgat gtgtaggaga tgcaggcttt    156360
     ggcgttatgg gcgcctgata tctgtgcctt cattagtatt ctcttcttta tcgtcgtttg    156420
     ggagatgtaa atgtataatg aaagaggata tttactcacc acctccgcat cccttttccc    156480
     cgtataatgc aaatcctcgg ccagcttgac ccccctcgcc tgcaacatct catacgcaag    156540
     cttggctttc tccgccgact cttcatccaa atacacattc atattccggg taatgttcaa    156600
     atcgcaatcg atattctcct cgcggagaag atcttttagc gcctggatat gcgcgtattc    156660
     gaattcggcg atctccagac ccgcttctag tccggagcgc tcgatgtagg ttgggatgtg    156720
     gccgtagata tccgggcgga ggtggccgcc ttcactttca cggttaacat ggtgtcctaa    156780
     ctaatatgtg gcacgttcag acatgaacag ggagtatacc atttcgacct gtcgcgcccg    156840
     agcaaatctg cctcgcttcg aggagcgtaa tactggtaga cttgtccccc tgcttagaga    156900
     gctgcttgag gagatagtaa gctagcgtga cgcctgagta gccgccgccg atgattacga    156960
     tgtcgctttg cgggggcagg tcgggggtgc tccggatgtc gtcgagcggg tcgagttggg    157020
     tgcgccagaa gggagtgatg gggttgtctg gggggagcat ggtgttggtt gctgtgttgg    157080
     agcccatggt gatgtgttta cagtggtatt cgaataagac gtgtgagtct gagagatgtt    157140
     tactacaatc atgttcagtc ggctctcacc gcaatatata catgagtcga tcgcccaacg    157200
     ttttagccgt ttatcccgcc ccaacataga tggggtcgat aggtggataa cggcctatct    157260
     gctttatctt cggagtccgg cttggggtcc attagttggg gtgactatcg gccgttgtcg    157320
     gagttgtgtg gaggtgtagt ttgaaaagcg tgagctctaa ttaatagtat gtggttctat    157380
     gtgggtgata gtcttctaga aggcgggata taatcgggag aagttttacg aataccactg    157440
     ctgaatatgg tttctggaca tggttctgga agagcgggct gagaaccatg tctattacgc    157500
     caagctggcc actaagaagc tctcccctgt aaatgcccgt ctatcataag gcttgccttg    157560
     tatcagccac ccacgtctta tcaggcgtcc ctttcgatga aacctcatta tcatgatgca    157620
     ctccggctta tcaattccct caagtgcaga ttgaacgaat gcgggggctg ttgataatct    157680
     gataaactac acctggcctg agcttaagcc ttgcggaact ctcccactga tttcattcta    157740
     tgaatagtac tactcctaag tatcatgtca gagtgagatg taaatatatt cactttcccg    157800
     gtattgcaac aactgtaact taccactggt actagtagct agtattgtgt gggaagttcc    157860
     ggctaagaag acagattggg ccgcaatcaa atagtagact tgatacatca ataacacctg    157920
     gcaaatactt aaaaggacaa ggtgttgctc taagctctgc tgagtacaaa gaagcatctt    157980
     cagctggagc tccccaatcg ggtaattttc ttcaagtgga gccttactca gccaaaccgg    158040
     atcaggcaag tcaccatacc ggaaatagct acgcacccag tgaccaccgc cctcatccag    158100
     cctagcgcgc gacatcatct cgatcggtcg cagctcaaag actcacttcc catgcccgac    158160
     caccgcaggg gcatcgcatc gcatctcaac acctcccagc aatgattacg cccgtttgaa    158220
     ttcatccgaa cgaaagaact atcgccgata atctctacat gctcgagtct accacgccgt    158280
     gcgctttccg ctacaatgac cgactattct aaatggaagg tgaccgatct taaagccgag    158340
     ctgaagcggc gcggcatcgc gcagaccggt ctccgcgtga aacaacagat tattgaccga    158400
     ttggtggagg aagacgctcg cgatgagaag gatgctgttg caaacggaga gccggccgcc    158460
     gaacaggatg ttgcgccgca ggaagcgcag cccgttgacg cggaacagcc tgtgccagag    158520
     ccagagccag ccgcggatgc gccagctcaa cccgaggcta ctgagtctga ggtgattgac    158580
     aaacagacag aggagccagc acaggaacag gaacaacaac aggcacaaac ggaggaacag    158640
     ggtgatgcgg ttcctgagtc gaagcctcag ccggtgactg acgaagcgcc tgccgaacag    158700
     gctgctgagc aaggacagca acaggaacag ccagagcaac cggtccagga atcaccgaaa    158760
     ccagaggaac cagctcaacc caccgatact actactgtta accaacccgc cgatacttcc    158820
     atcccgcaag accagaccga gaatgacacc gctgcagcac cggtagagca ggctcctgga    158880
     gaagcagcac cggaacagtc tgaggacatg gagccaaatc ctgcagaacc agccgcatct    158940
     ggtgagaccg ctgcgccgcc cgcggcagtc ccctcggaga tgaacaccgg gttgtcgaca    159000
     cccctgccta cagaagaaat gctggaggac agacgcaaga ggaagcgtcg cagtcagagt    159060
     cctgtgccaa caccggaagc gcttgcaagt aaaaaggcca aagccctaga tgagacaccc    159120
     cgtgtcgtct tgcccgagga ccgggctgcg gtggacaaag aacacgagtc acggccggac    159180
     gaagctcttt ccggtccgca aggaacccct gaagaacgcg cggggcgcga ggccgcgccg    159240
     gaggaagccc cgcctgtgca agatgaaaca tccaagaaag gcgcccccct gaaacatgac    159300
     gttcgcttca aggggctttt tgctgccaag gagacggaac agactcgccc cgtctcccct    159360
     ccaccggcgg atgcggttat ggaagatgcc gacgtcgagc ctgccgtgca tgctgccaca    159420
     gcagctctct atgtcggcgg actgatgcgt cctctccagc cggtcgcgct caagaaccat    159480
     cttgtcagtc tcgcgtcccc tccggatgcc tcacccaatc cggatgtggt cgtagacttt    159540
     tacctggacc ccatcaagac acattgcttt gctagcttta ggtctgtctc agcagcgtcg    159600
     cgagtccgca ccgccctcca tggtacagta tggcccaacg aacgcaaccg caagactcta    159660
     ttcgtggact ttattcccga agacaagttg tccctctgga ttgagaagga agaaggatcg    159720
     cgacagcgtg gtggccctcc ggcgcgctgg gaagtgcgat atgagccaac tgatgatggg    159780
     gtagaggctg ttctcgaaga ggttgatccc cgaagcgctt catctcagca tatgcgtgca    159840
     cctgacgcct caggattctc ccgtccgccg cctaccgggc cacgggcgga actgggcgct    159900
     cctcgacgtc ccagtggccc agtcacggca gactcgagtt cacgacctgg gcaaggattc    159960
     aagccgctgg atgaactttt catgtctact actacgaagc ccaagctcta ctacctaccg    160020
     gttcctcgag aagtggccga ccggcgtttg gatcggtttg acgacctgct acggaaggga    160080
     gagtttcccc gacgaggagg ggacgagcgc cgtcgcatca ccttcgagga tgaagatttc    160140
     ttcgtcgata acggaccgga ctttggtggt gggcgcaacc gacgaggccg aggccgtggt    160200
     ggtcgcggac gtggaggatt cggagattcg tggagagatg accgacgtag tcggtattga    160260
     aatgaacaga tatacccctg atgatatact atgggactgc cacggtttgg gattaggtgc    160320
     tttgtgtaat tgcaatttcc tgtacagtag gcgaatgcca agatggcgcg ggggacaagc    160380
     aaaaaaaaga aaaaaaaaat atgatctacg gacaagaagt gattttattt gagccaagat    160440
     ggcgaggtgt atactaggtt gggtaagtgt tccgggagac gaatcaacga ataccatcag    160500
     gatttatttt tattcgggga gtctctgttg gcgtggatgt gttttaggtg gataagttgg    160560
     aacatcagaa tcatgcagtc agaaccgctc actactttca cttgtttaaa attgcggtgg    160620
     cgcagcgacc ctccgccatt gcgatgcgcg gcagatgcac cgaaggtgat tgattggcac    160680
     aggaactgtc ctctgtagta acaagaatcc atcgtaagaa ccgcatctga cttaagaata    160740
     aatgtggctg ccttgccggt tcggcctcat tctcctccta ccaagacttt ttctctggca    160800
     ttactccacg atctattgtt ttggataaca aaggaccaag aaccccgacc ggtccttcac    160860
     ggttacacct tatatgatta tctgttccta attccgaatt ccatgcctga cgtgcaacga    160920
     cgacgtacct cccgacttgc tccacttcat taacccaact gcactaatta gtctccgtca    160980
     ttccaactct ctctcatccg ccggtcgctt gcaaatcccg cctggttgtc ttccctgcca    161040
     gcgcatcccg aagcatcgcc agggcaatcg gtccgtattg acttcgcagg atcactttcg    161100
     ccagtgaccc gaccggcctc ccgagtcgaa aaagaggcac aacaacgtga caaaagctta    161160
     aacttgggtg gctcccaggg gttcatgggg ggccaagccc ggctgtgcgg ataagatatc    161220
     ttaagaaaag cgacgggctg gcgtccatca cgacgatcct ctttcttctc cctcttctcg    161280
     ctttcgcaac ccgtctcttt tcctttcctt tccttccttg cacccccaaa ggctgttcat    161340
     ccttgcagtc tcctctccct acctgcaaga atgggctggc cagtgtgcaa ttcgacctcg    161400
     gaagatgaaa ccagtaggca acccccccct ctgcgccttg ttgattgcga ctcgggtgcg    161460
     tgtcattgaa ttgggctgac gcggactttg acagtcacgg aggttgacct ctgggatggc    161520
     ggcatcacct tccaccaact ctgcctgatc atgggcgggg cttttggtct catggctata    161580
     cttgtttcct tctacctgat tggaatgcac gctacacatt acagcaaaaa gatagagcaa    161640
     cggcagtatg atttctcctc actcactggc acttagtctc ttgctgatag ctgactttcg    161700
     cttcccttca ctagtatcat tcgaatcctg cttatggtcc ccgtttattc cgtcgtcgca    161760
     tggctcggta cctacttcta caagaacgat gtctactatg atttgatcgg caactgttat    161820
     gaagcgtttg cgatttcggc tttcttctct cttatgtgcg catacattgc gcccgacttg    161880
     catagccaga aagaatactt ccgtggagtc gaacccaaac cgtgggtctg gccgatcccg    161940
     tggcttcaga agtgtacggg tggagagaag ggcatttgga ggacaccgcg cagtggttta    162000
     acatggttca acgtgggtgc cgacaagcca gaacgtgcgc gatcgaagtt gtgctaacat    162060
     gggcgctagg ttatctgggt gggcgttttt caatactgcc tcctccgggt cttgatgact    162120
     atcatcgcgg tcgtcacgca aaagtttaac ctgtactgcg aggaatccct caacccggcg    162180
     ttttcgcata tctgggtatg tgttgtgcga ctttgttacg aactcggcta acatgcaata    162240
     ggttctcctc attgaatgta ttgcagtctc catcgccatg tactgtctga tccagttcta    162300
     cattcagatc aaagacgaca tcagccagta tcagccattc ttgaagattt tgtcaatcaa    162360
     gttggtcatt ttcctgtcct tctggcaatc ggtaagcgca gcattttgcc cgcatgtcca    162420
     ttccggtcgt ctaacccatt tctagacttt gatctccttc ctcacctcag ccggagcgat    162480
     caaaaccacc tctaaaatac agagtcccga tctcaaagtt ggactgccga acctactcat    162540
     caatattgag atggccttct ttgccgtcct tcacctgtgg gcattttcct ggaaacagta    162600
     ttcgctcaag aaccagccgt ccgagatcac cgacttctac ggcaacggca aaggcagcta    162660
     tgagggcggt cccttcggcg ttaaaggcat actcgacgcc ttgaacccaa tggacctcat    162720
     cagagcgatt ggtcgcagtt tccgctggct cttcgtcggc cggaagagac gcacgatgga    162780
     tcccagctac caccaaactg caaatgacgc cttcaacatg aacgctaccg agagcggtat    162840
     cgattcccac ggcaccgaat acggcggcgc aggcgtaatg atggccggtg gacgctacag    162900
     tccccccggc gaagaaggac aggtcctcct gtcgcacgcc cagccaagcc ccggtggtcc    162960
     cccgcctccg atcgacgacg aaacggaccc gaaccgcttc tacaatcata accgactcag    163020
     cgcagcctcc ctcctggagc caacagccac gcatactgcc cggccgtact ccccttacga    163080
     ggaggacgca tgcaacccct acctcgtgaa ctcccacctg gaacaagacc actaccacga    163140
     gcccgtccac gccaatccac cttatccaga ccaccccacc acaacgctgc aagaacagcc    163200
     tcccattcct ctcccggaat cctaccaacc ccctcccccg aactacgaca gtgaccacca    163260
     gcaacaacaa caacgaaggt aaagcgacga gatttgattt cgacgagcaa caaaagaaac    163320
     tccgttaact gcggagtatg atgacccatt taagtcttca tgcatgttct ttcactttct    163380
     tgcgcgttcc tcatcctccc tactgggtaa gaattgagag cgccacggct tgctatctag    163440
     ctagccgtgt ttatctttgt ctcttggcgt tggcttactt ttattccctg cctgtctgtt    163500
     ctatgcatct gtcgtataat accctctgaa tttctgggct gcctttcttg tgtttgattt    163560
     attctagcta tatgatatca cggtatgaag attgagcttt tgatgagacc ggattgactt    163620
     acctgggaga cttttctctt ggttgaggga ggttgtttat atatgatatc acttcccctc    163680
     gtcttccttt tttttgtttt ctttcttcat catactttct tgctatattt ctgtcttttt    163740
     tgcgaagata gagattacat attagatact ttcgttgtac aatattatat ttatattaga    163800
     gatatatacc tttgtggctg tggttgactg cattatagtg gtaatagtaa taagttatat    163860
     atgtttatga aatgggtagt ggtacaagtc tacatataca tagcaagtat agcagtcagg    163920
     gtatgatcat gcattcatgg ttcgttaaga ctcttatcag ctactaatgt tgattaactc    163980
     catctcacac cagatacctc actcctatcc atgactcacc ccatccccag tcgaaaaagg    164040
     ttcagtgaac cgattctgcc aagataattg ttgcgttttc cgcgacatca tcgtccgtct    164100
     gacactgttc atcagcgcag ttcgtttccc gagctcgcgc atcgcgctga tgctctggcc    164160
     gagttgtcct aatagggaga cgaggtggac gtcgttgctc tgggcgatgg cttcggccgt    164220
     gaaggcgctt cgttcatcag gggtgagaag ggagaggtgc gagaggagag cgttgatgtt    164280
     gcggaggatg gggtgggaga gggttgttgt tgaggtgggg gtttctggat cggaggtgga    164340
     gttgctcgcg acgtaggatt tgatgaggga gatacgggat tcgagggtct tgatggcgtt    164400
     gaggcgagtg gtgaggctgg cgattactgt gtggggtggt tttggttagt gatggacttt    164460
     ggttttggtt ttaggtatgg gggtggtgga gtgcttacgt tcttcttcct cgggggagag    164520
     cacttctgac tgatccttgc tgggttcttt gccggctgat tgctttgtga gagaggccgt    164580
     gccttgtgtg tctgcggcgg cgtttctggc tgtccttgct actgtgtcga cgccaatcat    164640
     ctcggcttcc cccgtttcga cggagtaggg caattctcgg aagcgaatcg ttagggattg    164700
     ttcctctcca tcaacctgca ttgtcttgct gttctctgtc gcattttcgc cctcgtatac    164760
     gctttcgtag attgtcacag ggagcttgcc gccgttggag gatgcatctt gtaccaggga    164820
     tgggtggaac gcgaggaaca cggcggactc gttgtggttg tggaggatct ggcgatggat    164880
     tgggaggtgg acggtgttgg ggccggacgg gggagcagtt gaccaccagc cgacaaggtc    164940
     aagggcagga gctttgtgta catctttgac ttggaggggg tcagcgccca gatgcatgta    165000
     gatggttgag atacaagtgg acgggactta cattgcttga ctctctctac gaaccagtcc    165060
     tgcggaatct gcagatctcc attggggccc tcgttcacaa tacactcaaa gacgtgttcc    165120
     aaggtgattt cgcgtccgtt ctgctggcct agaagcgctc ccactatagg tccttgctga    165180
     gagcgggcgg catggcgggt gatgtggtct gagatggtca ggaggatcag agggtggagc    165240
     tggatatgga ggccggagtc ggagttcttc ggagatagga gggattccgg ctgatcagac    165300
     atgatgaaca atatgtcctt gaaggaggag atggtatacc gaggtgaaat gataggagga    165360
     agcagtgata gtctggaact tatcgtcggg gaaactggcg gagatgtcat cggtgtttgt    165420
     cccgtttgca accagctttc cccgccgccg aggataagaa agccgttcct gacttgcctt    165480
     cgtcgtctct cgcttcccca cggatcgcat catcgtggat ctgtctggaa tcaacatggc    165540
     cgtcccatct acttacgatg aggtccgaca gcacctggaa caggtgcagc gcgagccctc    165600
     cactcctctg gatacgactc tcctagacaa gttgaagctc gagcttaccg agaacgtcga    165660
     tcgcagagtc cccgccaccc ttttgatcca gatatcgcag cttctccccg tcctgcagga    165720
     ggacccgact cctcttaccg ctcttggagt caaggctact acgtatctca gcttcgctga    165780
     ccttcactcc gtcgatcctc cgatcaattt catcgccggt ttcaaggccc catcggaacc    165840
     catcaaccta ttggctctgt cattgctgcg caaagcaggt catgtcgcta gtgatgctgc    165900
     catcgttgcc ggcgatccgg aattggtctc gtctctggtg gagctgtggc tttcgacctc    165960
     ttccacagcg gtagcacagg cggcatttga cacaatttgg gagctgttgg aggttgactc    166020
     ggccagtccg ctcgagaata gtgggcatga gggagaggag gccaccggtg gacaagggct    166080
     cgtttggaga cgaattttca cggacaagga tgtttatgga ctgctatttt ccctctgcag    166140
     tctcaaggag aatggatccg gaagtctgtc caagcgcgac aagactgtag cccagggacg    166200
     gttgatggga ctgcttgtga aggcgggtcg actgcattgg gatattattt cgaagccaca    166260
     agtgccagaa gttgagagga aataccagag caatggcctt ctccatttcg ctgcttgcca    166320
     tatggtcgac aaggatgatg tgctcatgca tatgactttg attaactttt ttcatgatct    166380
     cctggaaatt gatgcgcctg gcctcatcgc gcggaccatt gtgcagtcag cgtccacctt    166440
     ctcctctccc gccctggatt tccttatttc gcataaaatc cacagtacgc tattggagta    166500
     ttacttggat gagtcaaagc tggacgcggt ggacctggct tacctgtgcg gacctatcat    166560
     gacttacgtt gcgcagtatg ctgagctgta tcccaaccac ttcctgcaaa acccacagta    166620
     tctgctggac cggatactat ctcgcattgc tgcttcggtg gcggtttcat cttcccaatg    166680
     ggcgcatggt ccagttccta gcgggcagtt gaacgtactc tcctgtctgc cccgagtgtt    166740
     gctcgtggaa gccagcaagc agggattgaa ccctgtactg gccttgccaa ccagtcctcc    166800
     caacaaagag gctttggacg tgctggctaa gatcctccat ggcccaatta agcaagacct    166860
     tacagactcg atggagttga acgcatctgg tcagatgccg acagactggc acaaagaggc    166920
     tgcggccgcc cgcacgctgt acttcatgta cactaatcat catgccaact tctggactga    166980
     tgtcgtcgcg acggcggata ttctcgctat gaaggatgtc tcgttggcat cgatatcgct    167040
     catgaaatct ctcatcactg caaactggca gatcttgacg ggcgaagtca cctcgtctgt    167100
     tcccgggacc tcccgatacc agcttcccac cgaacaagct ttggagagtt tgtctccggc    167160
     tacacaaggt gttcttccat catcgggtgc ttgggcagct cttacgcctc cagccctgac    167220
     tattctcttg ccatatctgt tcaagcctcc tcgctcatat gccgaatttg tcgggggcgg    167280
     agcaggtgat tcccagcatg cggtctggaa agtggccacg gcgaagtacg aggtcttggt    167340
     ggcgctgtat gactgtctca aggagaacgg tggacaaatg gaaggattcg aggatatcat    167400
     gcgtactctc cggcaacggg tgaacgaggg gccatggggg cctgtatccc agactacgaa    167460
     ccaggttgcc actattggcc tataaggcta gcgctgcgga catgcccacc tcactggacg    167520
     atttacgatt atgccattag atacctgtac ttttcatcct tcagaagttc agcaatgagc    167580
     aactaatttc aacatcagta ataaataaat cctacatact acgtagtaaa actactaata    167640
     gtagaataac ttatcaccat acgccctctg attggcccat cccagccatc ccagggttcc    167700
     cgccccggta ccctaattac ccaattcgcg cagatctccg caggcggtga gccaaatgca    167760
     agctcggccg gaactttttt ctcagccatt ggatcatggc gctgtgaacg cccgccagcg    167820
     cttcggcctt ttccttcctg gacatttaac aatctggccc caacggagcc atcctcaacc    167880
     gattgacaaa aagggggcac atttgcagtg aatattatca ccgcccggca tgtcccgatt    167940
     cggcgcaaag aaaggcagaa agctccccgg agccgaattc acttgggagg cagatcccag    168000
     cggagaacct gatacggcgc cgacgccttt gttcccggta tgttttgggc tgatgtgatg    168060
     tgatgtgata tatttgcttc tttgtccgtt tgcttttgtg acacggtatt ttcttcgttg    168120
     ctgttgcgtc taccagcgtc gtttacatca ccctgttgct atagcattct ggcttgctgt    168180
     tacttcttct tctacaataa gagaaaggga caggttctaa tcatgtctct ctacaaccag    168240
     aaatacaccg tcccccgcgc cagacctctc acctcgcagg aacaattgca ggtggatttc    168300
     tatcgtactc tccgggaacg gttccacgat ggcccgtatt actcgattct ggagggggcg    168360
     gggtcgacga tgaagaagga tagcgcggcg cgggtgaact tcgatccgtt tcatggcatg    168420
     cctagttatt cgggcaagta tcagaaaaag aagagggcgt tgccgaggtt acaggggaga    168480
     cagtatggtg agtttgtcca ttatttttca tgaacgacgt gagagatatg tgctaatgag    168540
     atcgtctttg tagtgatgaa gttcttcccc cgggaattgt ggcagacaat tcagccgacg    168600
     ttcaagcccg atgccgcgat ggatgggtac gtgccgcagg tggcgcgggc cggggtgaag    168660
     cggggattcg aggacgatga tgaagaggaa gatgaggatg cggcgaagcg ggcgaaggct    168720
     ggtggtgagg agggtgaagg agctgaggat gatgatgacg gggacgggga tatcctggat    168780
     ccggaggagg agcaagaagg ggaggaggag attgaagatg atgactttga ggatgatgat    168840
     gatgagatgg gtggggatta taacgctgag cagtactttg atggtggtga tgatgagtat    168900
     ggggatgatg ggttcggaga tggtggtggt ggaggggagg aggatactta ttagatcgag    168960
     ctggattctt gagataccct ttgttcaaaa ctattattct ttgtcggttg atcttatcaa    169020
     tctagcgatt actttggttt ttctcctgag gttgattggg taaattcacg ccattgccgg    169080
     agtatctgac gatataatta tctatctaac attaaagtag cacaacagcg catacaccaa    169140
     atattctcct cctcataact accttaatac actacaatcc tatctccaac accagcaatg    169200
     catacacaac cccctctatc taccctccaa tatgcctacc ttatcctctc cgatcctcgg    169260
     gatgacgtca tcccgctatt cgcgccaact ggacgatcgg atcgaacccc tcaagccaaa    169320
     cgaggggaag gaaaaaaaga gacccgcgaa cgataagccc accctatcca ttgaagaaca    169380
     gcaccaccac accacactac taccagggag aaataggggg gtagtagata ggcacaatgg    169440
     acggcaaccc atcaacccca ccgcggcgct cagctctcgt cctctatggc tccgaaacgg    169500
     gcaattcgca agaagtcgcc gaggagctgg gggcgctagc ggagaggttg catttccata    169560
     cgcatgttgg ggagatgaat gagtataggc cggtgagttt atacctttca attcgttacg    169620
     cttagttatg ttttacgtgg atttggatgt gaatgtgggc gtgcaatgta tgctgacggg    169680
     gtgtgtgacg atgtatagga ggtcttgaaa tcgcatacgc tcgttatatt cgttgtcgcg    169740
     acgacaggac agggtgactt cccggcgaat gcaaggtcgt tttggcggtc attgttgttg    169800
     aagaggcttc cgggggattt tctggatggg gttcagtttg cgtcgtttgg gttgggggat    169860
     agttcttatc cgaagtgggt tttgttctat ctcatacaag gattaaatgg gaagaagaaa    169920
     ctaattgact gggttgggca ggttcaattg ggcggcgcgc aaactgcata agaggctgtt    169980
     acagctgggt gcgaatgaga tatatgatgc tggggaggcg gatcagcagc atcccgaggg    170040
     gtgggttaag ctatcgatgg tttgctgctt ggggatggct ttgctaaatg agtgtacagg    170100
     ctcgaaggga cgtttattcc atggttgaca ggtctgcgta cacatttgct cgagacgtat    170160
     ccgctgcctg aggggctgga gccgataccg gatgatgttc aattgccgcc gaagtggatt    170220
     ctgaagctcc aggaggggaa tgcggcgaca gcacaggaag gacatgcagt tcctgggaca    170280
     catgagaacc tgcccgcgcc tgaagagaac ccgaagttga ctcgattgga tcacgacctg    170340
     cggcctctgc ctgatacctt gacggcaaca cttagggaga ataagcgatt gactccgcag    170400
     aagcattggc aggacgtgcg acatgtatcc cttacggtcc ctgaacatac gtcctacgtc    170460
     cctggggata tgttatgcat tacccccaag aacttctctg ccgacgtgga tgctctgatc    170520
     caaatgatgg gttgggagga taaagctgat cagctcatct gcttggttcc taatagccat    170580
     atccccgctg atgatctccc tttgccacct attcggggtc tcgactccta cccgcagttg    170640
     acactacggg cacttcttac ggactatctc gatattcagg ctatcccgcg tcggtccttc    170700
     tttgcggaga ttgcgcatta cacgaatgat gagatgcaca aggaacgtct actagagttc    170760
     acatatacca gtcccgagta tcttgacgag ctctgggatt atactacccg tccgagacga    170820
     agtattctgg aagtcttgca tgagtttgac acggtcaagg tgccgtggca gcatgctatt    170880
     tcggtgtttc ccgttcttaa ggggagacaa ttcagcattg ctagtggggg cgagttgaag    170940
     aggggccctg agggcggcac caagtttgaa ctgatgattg ccattgttaa gtaccagacc    171000
     gtcatcaaga agatcagaca gggtgtatgt acacggtata tatctgcgct tcgacccgga    171060
     agcactttga aggtacaact gcagcgcggt ggactcaatt cctccgtcaa ccagctagtt    171120
     ggtccaaccg tcctggtcgg ccccggcacc ggtctggcac cgctgcgatc tatgctctgg    171180
     gaaaaagcag caattatcaa ggcatatcag gaggaaaacc ccggggttga gctcggcatc    171240
     ggacctacgc ttcttctcta cggcggtcgc aaccgcgagg cagatttctt cttcgaagat    171300
     gaatggcagc agctcggcca gttgaccaag ttgaatgtac tcactgcatt ctctcgagat    171360
     cagaaacaaa aggtctacgt gcaagatgtg atccggcaga actatgcgct gctgtttaag    171420
     ctgctgcatg acatggcggg gtcggtgtat atctgcggtt cctccggaca gatgcccaag    171480
     gcagtaaggg aggcgctgac agaagcattc cagcacggcg cagaggtgga aaccgatcga    171540
     ttcaacgaac aaggggccga gcagtatctg cttggcatgg agaagacggg acggtataag    171600
     caggaaactt ggtgatccgc cactaagagg taccgtcaca tgtgaagcgg ttatacaaag    171660
     taccatcaat gcctatagat agagcgatgg catgtctgcc atatccgaca ccacgcggat    171720
     agaggaaaac gagcacaata tacccacata ctcaatagaa ccaacgcacc ctatgaggtc    171780
     atttcaatac ctttttaccc cactaaacct gccaatctgt cgtacaaagt cccatcatag    171840
     aagaggctaa cctcggctgg cggcggaaga gcagcaagtg tggatggaat ctcggcccgc    171900
     ctcgggggac tctccgccca ggtcacctgt tttctgccgc ggaagggcag ctgctgctcc    171960
     gacggatcgg tgtctctcta ctcttccctc aaaacggctt cttgctcgcc ttaagagtcg    172020
     acgccccctc actgtccctt cccctccatt gccccttctc ttttgaagtc cctttaccac    172080
     ataatattgt cataatgagc ggcttgcgaa ttcttgtccc cgtgaagcgg gttatcgact    172140
     atgcggtgag ttttggtttt tgtcgcctcg tgctcctcct gctccgttct cggtgaagag    172200
     tcacatctcc gagagcaaag ttgcccgcac gcgcagtttg caattgtgct ccgtcggcac    172260
     caacacctac attcaccaca ccattatgat gttatagcgt actatagcaa tattgagcat    172320
     cactgataat gataggtcaa accccgcgtc aacaaggcca acaccggcgt cgaaaccgcc    172380
     ggtgtcaagc actccctgaa cccgtttgat gaactctccg tcgaagaagc catccgcctg    172440
     cgcgaacgcg gcgccaagaa ccagagcccc atgaaggtcg aaaacatcct cgccctctcc    172500
     gctggcggag ccaagtgcgc cgataccctc cgcaccgcta tggccatggg tgccgaccgc    172560
     gcattccacg tcgacgttgg cgagagccct gatggaggtc ccgagcccct gacgatcgcc    172620
     aagatgctgc agggtgtggt caagtctgag aacattaacc tggtgctgct gggtaagcag    172680
     gcgattgatg gcgaccaggg ccagaccggt cagatgctgg caggtctgtt gggatggccg    172740
     caggcgacgc aggcgagcaa ggtcgatatc aaggatgcgg atggtacggt ggaggtgacg    172800
     catgaggtgg atggtggtgt tgagacgctg cgggctaagt tgcctatggt cattactacg    172860
     gatttgcggt tgaatgagcc ccgctatgct acgctgccga acatcatgaa ggctaagaag    172920
     aagcctttgg agaagaagac gttggcggat ttcggtgttg aggataagaa gcgcttgaag    172980
     actctgaagg ttactggtaa gttcacttcc ctgcgttgca ccccctcggt gttgtttaca    173040
     aactaacctg ttccagaacc ccccgctcgc cagggtggtg gcaaggtcga ggatgtcgac    173100
     ggcttgatcg gcaagctgaa ggagctgggt gccctgtaaa tgtggagtag ggcagatgat    173160
     tggatacaat aggtatacct ttgtgtgtat gtttacgact agactcgcgt ccagtgtcag    173220
     ctgaaccggc tggaccttat ttctcaattc atttatcacc cgcggaccat gaccccgacg    173280
     tgttgtctgg ctcctgtgta tttacttatg cttaactcta tctgtggctg gctatacctg    173340
     ctgcagtggg tcgaccgcac gaatcactca tcgggacagg agcaattgcc tgttagagta    173400
     ggagagttct cgatgaagta ctatctagct agctagacag ctgaacagct gaactcggga    173460
     gttcatccgg caactgagta gactagcaaa ctgtctccaa tatgacacat gtctatcccc    173520
     ctgtcacgct gacatatacc cacacgcact aataacagct agtcgattat atccgtacgg    173580
     ggatcccgat ccgctagatg gcaaccagta gtccagcgtg ggacccgggc accgggaacc    173640
     agccggtcat cgaatcggga tctcgatgga ggcagatgat ggctagttag tacggagtag    173700
     tatctatagg gggatggtag taaactgcat gcactaggat gagtactagt ttgattgaac    173760
     taagctggat ggagatatat tgttggatgt ataccatttg tatagatata ctatctacca    173820
     gtagatgatt agtaggcaga agggaaggga ataaggtgga ttttattgat aataggaatt    173880
     agtagtagtt agtatattgt ttgttactag taggagttta gtttgatgtg aggttgctct    173940
     aactctcagg tttatatgta tttactagtt atattgactc tagatcctat actgcatact    174000
     cacccacaca tgaaatctag atatagtagc atagagaagt agagttaacc ttcaatgcag    174060
     atattccacg agccagacaa agcagacaca cagacacaaa cccaactgcc ggacagagtg    174120
     aacgacactc ccgttcgcag ttcgcatcag tcaactaact aactacattc tccgatcgat    174180
     ccatcatccc ccctcccctc ctattgacag aactttttcc aatccgatac atcatatcag    174240
     gcacggttgg tagtgcgaac tccaactcga actgaactca aaaactcaaa aactcaattc    174300
     atccacggag cacgaatgta tccatccaca tccatctgtc tatctaactt tctgatcctt    174360
     agcttagcta acgaactgca tgattcgctt ccttagctat tgatccacta gggcatatga    174420
     caggaacccc agctatccat caactaggct agtgatagtg tatagagtac actagttagt    174480
     tcgtttggaa agtcaagccg aagtatgatg atcgtcgaat tgactgggtg atgggtgatg    174540
     gctgagtgtt tcggccgaag ttgcctcgtc tcgtctaaga atagctagta agtagtacgg    174600
     agtacaacac aaggagacag ggattgcatc tgtggttcag ctgaggtgag ctggactgga    174660
     gtggagtgga gtgtttcgaa ttagttgcca gggatcatgg aatgttcttt tctatttaca    174720
     tttactatct atggtttact atagagggga atatactcac tcaccatctg actgtccatc    174780
     aacaacaggt aggggtacag agagaccttt ttctctaggt tacctacacc ctacccaagt    174840
     atgataataa ccttctcttc tcaaccgcaa taaccgcatc aatcttcatt cctcgtggac    174900
     ctaccttcct tcccaccgat ggcatatgat atatccaaac aaaaagctaa accataaagc    174960
     aacacgggaa gtgaaaatta ttttctcgtt ctaatgcgca catggtcctg gaccaggtcc    175020
     aggggagatg gagatgagag gttcgttcgt gagttctgct cccgttccgt ccgtttcctc    175080
     ggcttcaatg acccgggatg atgaaactct gtctgaaggg gtgatggtgg gtaggttggg    175140
     ttggactggt caggttgatc taactgtatt gagtagtaga taatatcttt ggtaggtaat    175200
     taggtaggta gataggtctg tggtaccttt tgtaacaagg tacttttttt cctttcttat    175260
     tcttggtttc tttgctcgaa acaatgcaat tgaaggggat gctaagtgag ccacttgcgt    175320
     caattgagta gtatcatgtc ctgctggagg taccggtagg taagtaggta taggtatagt    175380
     agtatttcaa gcaacgcatc ttccctgtcg ttggtgagga gtggaactaa ccagactaga    175440
     ctagactatt ggatctcgat tgggggtgga gaagaagggg gggaaagaaa ataaaattgg    175500
     acctgtcagg gacaggatat tatctatttt ttctacttcc ggagtagtta gccagctata    175560
     gtatttactt cgatattgac ctggtgactt gtttacttac tacctactta gctgctgcta    175620
     cttactcaag cctgcagcta gggttggagg ggatagtgga gaaaggaaac atgaaactaa    175680
     tgcagagaat tttctttgcc tgggcgacga gaaggaaatg aagcgagggg actacaccaa    175740
     gtcaatgcga agggatacaa tttacccatc catggatggg agccagacag agagctagtc    175800
     tagatactag ttaggttgac gggctggctg gtttggggct gaaggaagaa gaaaaaaaag    175860
     cagcaccact gcacgtaagc aaaacaaatt cgcggcagaa gaagcgattg gacctgtcat    175920
     attcttcggg tgggaagttg atacatccct tgtgtgggtg ttttttgtgg acgcagggat    175980
     gaagagggga aaattcatgc ggatctagtg gaagttaatc ggaaaatgaa ttttaatttt    176040
     tttgatttta cttttatgat tttttttagt taacaaggaa attgtgaggg tggattctac    176100
     gttagcaaga aagcagacta aactagacaa agattagctg gggatctggc tcagggactc    176160
     ttggccccat cgccatcgcc atcgggtacg tagacgatga cgctgtcatt gggggttcat    176220
     ggttgaggat tcttccacgg aaggaaaggc ctcattgcga gaacagcaat gaactgacat    176280
     acaatgaata atagattagg atacaagaat gtagagcaaa atatctgaac ttctacatcc    176340
     gaacagccga cgggcaaatt atgaatgtag agaaatctaa tccgatcggc ttatcgggcg    176400
     cggcgaaagc gatgacgctg atgctgccat gatgccatgc atccggaacc agactgaagg    176460
     aatcactgcc taatcgtctt gtactcccct tctctctcct ctcacacatc agactctctc    176520
     cacttcctcg tcatcttgct gactgacttg actttctgta cgccttttca cccggccgtt    176580
     ccatctccgg ccagccactt acttccctcc cacttcccag tccaaccatg cccttccgac    176640
     ccagccgtgt gagtattcgt gcctggttcg catccacggc tctccagact tctaccattt    176700
     agttcttgtc ttcccctctc gcattctgtg agaggatccg tccgtctttt ccctttctgc    176760
     ttgcttgctt gcttgctttt tcttcctcct cctccccccg actgcattag ctctcggtca    176820
     tacatccagc ctacatctct agcacatctg accgacgggt cctacgggtc gatcaccccc    176880
     ctccactctg gggttacctc tctcctccta cataaactgt ccctgctcct gcttgctgcg    176940
     gacacggaaa ttagctgctg tttcatctgg tccctttttt caccttctct cggatatatt    177000
     ttcaggtttc cttttcgtgg ccctggcgag gctcaggcgg aggtaagccg acccccgaat    177060
     cccatttgcc cgtcccatgg ttcccctcct tcctttcctc gtatgtcacc ggttctccag    177120
     ctgctcgcca cccactcaag gctcggtctg gaacgcacgg ctagcacggc gaaaagctcg    177180
     aggtcgtctt gggtttaata atatggccct ctcctacttc ttctgcatcc atacatgcaa    177240
     ttttctctcg tcgcagatca ctgacgttcc ggctactata tagttgactt gcattctcac    177300
     tactctccgg acccgcattc ctcggttgtc atcccaactt ctgttgcgcc cgtttgctgc    177360
     ctcttataca ttcctggccg cattgggact ttatgtgaat tactggggcc gtcttcgtct    177420
     acaactgcta ctgcacccgc aattatagac tgcctcatta cccactgcgc ggtcctcggg    177480
     actccgtcct gtgttactct gcttggtagg cttggtgacc ccacgggatt ctgagtcgcc    177540
     accatgcctt ccactctgtg ggagaagacg aaaggcacat ctaaaaaagg attcgataaa    177600
     gcatggcata ccctcgacaa gctgggcgat cccgtcaacc ggctttccta taaggtcggc    177660
     gcagaggctt tctggcccat gaccctcgat aaagaaagcg ataaagcggc gcgcattttg    177720
     cgaagtttct gcaaagatgg tttttattcc aacgatgaag ccgaacggaa aagcaccgac    177780
     agctcgatca gcaaagaatc cggcaagata gatcgcccca agggcaagca gcgggtctta    177840
     aagaagatcc ccgctagggt tatacagcgg gctaagggtc tcgctatctt cactactatg    177900
     cgcacaggcc tctgggtcag tggctcgggt ggtagtggtg tgctcctggc gcggacccca    177960
     gataccaacg aatggagtcc gccttccggc attatgcttc atacggctgg tatcggtttt    178020
     ctggcgggcg tggatatcta tgactgtgtg gtggtcatca atacctacga ggccttggag    178080
     gctttcaaaa aagtgcggtg caccttgggt ggagaagtca gcgctgcagc cggtccggtt    178140
     gggatgggcg gcgtgcttga ttcggaagtg cacaagcgcc aggcccccat ctggacttac    178200
     atgaagagtc gtggtctgta tgctggcgtc gcagtggatg gtaccattat tatcgagcgt    178260
     accgatgaga acgagcgttt ctatggcgag cgcatatcgg ttactgacat tctcgcgggc    178320
     aaggccaaac ggcctcctgc atcgattcaa accctcctca acaccgtcaa agctgccgag    178380
     ggcaacccaa cggtggacga gaacttgctg ccacccggcg aaacccctgg ggatgttgag    178440
     cttgcgccgg gaccgggctc gttcggaatt cccgacccgg aggaccctga tccattcggt    178500
     gtcaaggcgc tggaggcgga gggtctcttc attcgcgaag ctggatcaaa atccagacca    178560
     tcgcaggaag cgtttgagtt taaacccggc ccgaacagcc cgatatttgc gactttccga    178620
     cggagcatcg acagctcacc acgcaatagc tggcgagcaa gtgtgcagag ctacgccagt    178680
     atggatcgag ggacccaaac tgatgatggt cctacgactg ccccgacctc tatcagtcgt    178740
     gcctcctccc ggagctaccg tgatgtatcc gaccgggccg aaaccagtcc ttgggacaac    178800
     gaggagggac gctgggagac tgtcatcccg gaacatgatg aataccacgg tcgggatgat    178860
     gttgaagagg acgtggatct ggaggatgac gatgtggaaa ttcacgaggt cagcagcgcc    178920
     actgtgtcga agcgcgagag tgctgcccat tctcctgtcc cgattgaaga ttccatcgcg    178980
     cctgtcgaat tcaagcgtca ctcgcctacc tttaccaggg cacgccttgt gacgatccct    179040
     aagcggattc ccccggccct tccaccccgg aacccccagc ggacacccgc tcccgtctcg    179100
     acctcgactc ctagctcgcc tacggcgaac ccctacgcac acagccgccg gcgttccgtg    179160
     gcatctagtc cgggacacgc cacatatggg ttcacaggga tgcctcttta ccacaagagc    179220
     gattcggaaa gtgacctgtc ctccgctggc gctcccgagt cgtccaacaa gccgtcacca    179280
     gaccgcgaag agttccactc ggtatccagt ctgcacgact cggacgtggc atccgagaag    179340
     gagaccgagg ccaaggaggc caaggagatc gagaccgagg agaaccacga gccatcatct    179400
     gatgcgagca ctcccacata tgttcacgag tctgatgtct cgccctgggc gaagtctgac    179460
     acagacctgg cacccacgaa gaccatcact tctgatgacc acgtcaaagt tgattctacg    179520
     gcacagcctc aggctgtgtg agtgctaaca gcacattacc gccacttctt tgtatatatc    179580
     cttctggcat attgttattg ggattcatcc cgttgcatat tgcatgttga ttcccactgt    179640
     gtttcggctg tttgtttcag agccatcagc tcttgttgtt atgttttatg tcatagtgta    179700
     atgctagcct tagcgtgcgt ggtgtttgaa tttcagattg ggcatggata cctgggcgtc    179760
     tcgggatgga tactgggacg tggtaagatg cttggaagcg ttgattttga gtttgacaat    179820
     atatccctat gtttctcttc tccacaccct tttaccgtaa tgcgacagca ttgtgtagag    179880
     tgcattgcct taattagaac ctacgaatcc ttgatttgta tatgacaccc gatcaccatc    179940
     gagccaccta catcatggcg cgctctcaga tcctccgaac caaaacagta atgtcgatcg    180000
     tcgcgcctga accaaggctg attttccctg ctgaagcgtg tcataaagtg aaacatactt    180060
     tgtagataaa ctcggcaatt aactgccact taccccatac atcgctaccg gagagtggag    180120
     cgagtgcacg gccatcaagt gaaactgata accggcgatc cgccggctta tcggcgatgg    180180
     cgttatcaga gggaccttag taggttgcac agttcactag tatttattac taagtacttc    180240
     cttcgccttg cttattgccc atgattcgtc cttctctttt tctttggtta attgaactac    180300
     tctccatgag agttctgtac aggttgagat agaccaacca ccaccaccat gccttttccc    180360
     ttttcgtccg ctcttctcgg ctatatctta actacgagca ctactctcac ctccctagtc    180420
     gcaggacagt attaccctcc gacgcctgag gatctcaccg ttattcattc ggagatattc    180480
     cctggtgcga ggatctccta taagcaagtg agaaatacac cacccttctc ctcaatccca    180540
     atctaacacc ccatactaat actatgtgac cagcccctcg gcatctgcac caccaccccc    180600
     tccaccccca gctactccgg ctacatccac ctccccccac acacccttac caatctctcc    180660
     attccaggaa tcagcatctc gcaaccatac cctatcaata cctttttctg gtactttcct    180720
     tcccgccatc accacaacaa tgatacatcc ccactcacca tctggatgaa cggcgggccc    180780
     ggcggatcct ccatgattgg gctatttcaa gagaacgggc catgtactgt gaatacggac    180840
     tcgaattcca cggcctataa tccctggtcg tggaatgagt acgtcgatat gttgtatatt    180900
     gagcagccgg tgcagacggg atttagttat gatgtgttga ggaatgggac gttagatttg    180960
     gttagtgggg agatagatgt tagtattagt gatggtgaga gggatggagt aggacagaat    181020
     gagacgtttt tggtggggac gttgccgagt caggatgtgc atgggacggt gaatgggacg    181080
     gttaatgggg gaagggcgct ttgggttgcg ttgcaggttt ggttgggtga attctctgaa    181140
     tatgtttctt ctgttgacgg gaatggtggt ggtgatgaca gggtgagtat atggacggag    181200
     tcatatgggg gacggtatgg accggcatac acggcgctct ttcaggagat gaatgagagg    181260
     attgagagtg gggaggtaag caccgggaag aagatccatt tggatacgct gggcattatc    181320
     aatgggtgtg tggatttact cgtgcaggtc ccttcgttcc ctgagcaggc gtataacaat    181380
     acgtatggga tcgagggaat caatcgcacg ctctacgacc gggctatgga tagttggagc    181440
     aagcctggcg ggtgcaggga tatgatcatc gagtgtcgcg atgctggcga gctcggagat    181500
     cccctcatgt atggcgacaa tgagacggta aatagcatct gcgaggaggc gtcggactac    181560
     tgttcgcggg agatcaagag cctgtatacg aatacctccg ggcgaggata ctacgacata    181620
     gcgcatttca cgccggatgc agctctcgtg ccttacttcg tcgggttctt gaatcgccca    181680
     tgggtgcaaa aggcacttgg ggtcccggtg aactatacca tgtcgtcaga ggcagtgggg    181740
     aacagtttcg cctcgacggg cgattatccg cgaaatgatc cccgcggaat gatcggggat    181800
     attggatact tgcttgactc cggtgtcaag gtggctatgg tatatgggga ccgggactat    181860
     gcttgtccgt ggcgcggcgg ggaagatgtc agcctgctgg tggagtacga ggatgcggag    181920
     aagttccgtg ctgctgggta tgccgaagtg cagacgaagt catcctacgt tgggggtcta    181980
     gtaaggcagt atgggaactt ctcgttcacg cgtgtctttc aggcgggcca tgaggtgcca    182040
     ttttatcagc ccgaaacggc gtatgagatt tttaatcgcg ctcagtttaa ttgggatatt    182100
     gcgacgggag gcatttctct ggagcagaat cagagctatg ggacggaggg accgtcgtca    182160
     acgtggcata tcaaaaacga agtgccggag agccctgagc cgacgtgcta tttgttggcg    182220
     atggattcga cttgtacgga tgagcagagg gaacgggtgc tgagtgggga tgcggtggtg    182280
     agggattggg ttgttgttga tgatattgag gctgaaagct cgttcagcgg tgttggtgat    182340
     cagctggcac aggtcccttt gggacattga cgttggttgc catatgttga cagtgttggt    182400
     ggatgaaagt gatatagatg gataaagtta gtgcataagt gcatagctga ctaagaatga    182460
     gcatcattca tatatggata agtctggcta gctcgatccg gcaagtggcc ggctgactgc    182520
     ctaaagtgga agactggaag ccttcagatt tccatcagtc catctcaata tctccatctg    182580
     gcttgtcaaa ctcctatatc caccggccgg acccttctat tattaacagc gccgctatca    182640
     cccggacaat ccgtatggca tcacgggttg acccctccat tgcggccatc gaaccttctc    182700
     gaaccttcta ttggtcgacc gctgcggtca acgtcacacg tcaccgcagg ctcacctgaa    182760
     agccgccggc gttgcactat acatcagccc tcgtcctcac acctggcttt ctccgctaat    182820
     cctccaagta cacccttcac tgtgccttga tgtcttgaat caacatctat aaaaactgca    182880
     ttatctcccg tttgatatac gctcggatcg gatcgcggat cgttgaatct tctacgtcat    182940
     tcgagactct actcccctcc cctcgatact tcccatctca caccgtggtg tgactccctc    183000
     gtggtgtgct tatatggtgt ctggactcgc caattagcgc cctgcatcac atttctacca    183060
     cgtctgtcga tttcgtgatt acggttcctt tgacctatcc tctggccctc accaatcgac    183120
     tccacaatgg ttgcagaaac gaaactctac gatgccctct cgatcaggcc cgatgcctcg    183180
     caggatgaga tcaaaaaagc ttaccgtaag gcagcattga agtaccaccc cgacaagaac    183240
     aaggataatc cgaccgcctc ggagaagttc aaaggtatgt tctgactcta cttaccccgc    183300
     cccagcctcc cttttaggtc aatggtacta attttctaca gaggtgtccc aggcatacga    183360
     ggttctttcc gaccctgaga aacgaaaagt ttatgaccaa ttcggccttg aatatctcct    183420
     tcgtggcggt cccccgccga ccagcggtgg tggtggtgcc gacggcccca accccttcga    183480
     aggtggcatg cccggcgggt tctcgttcgg cggcatgcct ggcggcggcg gcggcggtac    183540
     ccggacattc cacttctcga ctggtcccgg cggcggcggc agcgggttcc ggttcagcaa    183600
     tgcagacgat atcttccgga actttgccaa aggcagcatg ggcggtatgg gtggtggtat    183660
     gggcggcggt atggatgacg acgatatctt ctcaatgctg ggaggtgggc ttggcggcgg    183720
     tcggaacttc cggagtagtc gcgggcctag cggattcaag caatcgtcgc agcgcgcgcc    183780
     cacgcccgag cccacggtca tggagaagga gctaccgctg acgctggagg agttgatgcg    183840
     cggtacgacc aagaaggtgt ctgtgaagag caagacgttc gatgcgagcg gcaagcgcac    183900
     cgtgcaggat gtgacgcttg aagcgaatat caagccgggt ctgcgcaccg gctcgaagat    183960
     caagtaccgg ggagtaggcg atcaggagga gggtggccga caggacgtgc atttgattgt    184020
     aactgaggta ggtttttccc ccattcatat gatattggta aatatactaa cagccagcag    184080
     aaagaacacc ccaacttcaa acgccaaggc gacaacctcg tgacaacagt tgaactcagc    184140
     ctaaaagaag cgctcaccgg ctgggagcgc atcgtacgca cgattgacgg caaatccatc    184200
     cgagtgtcca agcccggccc gacacagccc ggacatgaag agcggttccc cggactgggc    184260
     atgacgatct cgaagaagcc cagcgagcgc ggcgatttgg tggttcgggt gaatgtgcgg    184320
     ttcccggcta gcctgagcgc gtcgcagaag gacattctca aggacgttct cccgtgattc    184380
     ctttttcttt ttgatactcc tattgtctct accctatttc tattcccatt tcgtcggtct    184440
     gttagcatta tggcgttggg cgtgcggctg gttccgtgat gagtgatgga tgtgatgatg    184500
     acgatgcagt agtagcttgg aataaaagct tatatacctg tatgagtgat aaattggtta    184560
     atgtaatgct accatattaa atccctacag aatactgttc atacctataa ttacactata    184620
     atggacaccg atagaataac tacccagcct atcatatcat atcacatgtc catccgaaac    184680
     aggaccagct agctagctag ctagcttatc gataagatag cggtcaacaa caacatctca    184740
     cctcacagct ccagctcgct ccatctccgc aagacaacca aaccaactca ctaccaatcc    184800
     attcattcac cccccctctt atctcaccaa tttccttacc tacctagcca ccacaaccac    184860
     caacaatcga agaattataa taattgaaaa tgaaaacaag aataacctac ctccaacccc    184920
     cctcctcgcc attcacctcc acccaagcga ccctcacccc gtcatcactc aagatcagcg    184980
     atctagatgc tgcaaaagaa gtccgcgtta cggttgatct gagtgaggtg gatgatgatg    185040
     aggtatattg ccctctctct tttttttttt ttttttttac tccctcggtg tgatgtaatt    185100
     tagctaatgc atgtggaatc tcatctatct aggtccggag tatcttgacc aatctgcacg    185160
     aagtacatat ccgctgggcg agggaacaac catatgggat tgtttcgccg ttcgggagta    185220
     gggtttcggc ggggttgggg gtgggtgtga gtcctcttca gggtggggat gatggggatg    185280
     gggaaggcgt atgtcgtctt ctacggagga tgtttgggac ggggattgag tgtgctaatt    185340
     atatggtacg ttttacattt tcagttctgg tgaggtatgt acatgggatg cttattcggg    185400
     atatttatac atgtaggact cattcaccag ccctcccgtt gtctctacgc gtttcgcgtc    185460
     cacgtccacg tatcaattcc actcttccct gccggaacat aatcttgggg agtatatagt    185520
     gaagaatatc tgtcgcgagg agggtgctgc gtgcgctgcg gaatggggtg ccgctgatag    185580
     catcgacgtt gactatgatg ctgtgtcgcg ggcgctagtg gtctccgggt actggggcca    185640
     gcctgttact ccggagggat ggacggagga gattcgtgcg ccggggaggg atcgtgatcg    185700
     cgtggaggtc gggttgttgg ggacggagaa ggcggtcgag gcggaggaga ttaaggttgg    185760
     tgggttgttg ggtgttgtgg gtgttgataa ggagttgagt atgttttccc tttcctctat    185820
     ttgtttggct gaggggatag tggtgtgcta actgctcaga accaacgcta ttctccttcc    185880
     cctccagaca ccatgtcctc cctcgcgagg cgactttcga cgtctccttc ccccgtccga    185940
     cgggcacgca tccaaccatg accatttccc tgtccccggc tgcgttggag taccccgctg    186000
     cgccggagga cacgacctgt gcgctgcatg cgtatctgac gctgccgtcg tatatcttcg    186060
     gggacaagta ccagctgagc acggatgatc cgctgttcct ggagtcgcat catctggtgg    186120
     cgttgcgggc agtgagcggg gcaacggacc tggaggcgcc ggattggttt gtcccgcact    186180
     ggggctcgaa ttggctgctc gagctggcga cgccgtctgc tggccaggtg ccagaggagt    186240
     ggaacgtcac ggtgccgctg catctgcggt acctgcggcc gtcggagagt gggtaccgct    186300
     ccgcgggggt gccgtggccg gtggtgttct gggcttgcac ggcggaagag ggcacgaaga    186360
     tgggcacaaa cccgttcgat cgcctgaacc tcggctggga tgggatgttt ggcccacgga    186420
     cgatgttcta ccaggtgcat cctagtggag agaagacccg acatgtcgaa gacttggatg    186480
     tcccggtgct ccggttagag gagggcggat tcttcagtag caagacagtg gagctgggca    186540
     cgatggcagc gatcgtcctg ggattgctgt gggtgctgtg gaagctgggt agtgttgcac    186600
     ggtcttccgg acggaagaag agcgacaagg agaagaagtc gcagtaaccc acctctcccg    186660
     ccccatagaa tgtgtttagc gtcgaacctc cacattatac atcagtgtac ataaaccgct    186720
     ccatatcgaa actgcccaaa ctaggaatat caatcagcag atcactcaac cacgagaacc    186780
     ccggataatc agccagcgaa tgatgcggct ccatagaacc accaccgcca tcagcagcag    186840
     ggctaacctc ctgtcccatc tcaaactgct cggccgacgc ccccgaatta accctcaaca    186900
     catccttcaa cgccttcgta tcctcctcct tcctgcgttg gtgcaataga atcagcaaat    186960
     acgccgtact atacgcctcg cgcatcacct ccgtatcata cgcggccgcc acctcacgca    187020
     gcgtgcgcat cgcacccccc aacatgacca acgacgcccg attgtctatc gccaggagcg    187080
     tgcacacaac ctggaacggc acattcgcga tctgatgcca cggacaggtc gtcgcgacca    187140
     tctccctcgc tgcctggagt cccttcacgg agagtgccag tacgcggtcc agtaagtccc    187200
     cggagataat gcagttcagg gcgcgcaggc gccggtagat gcagagcatg aggttacatt    187260
     gcacgaggat taattggggt aagacgtggg attggtcaag gacgttgcgc agcgcggatt    187320
     cgagttctgg agggtcgggg gttttgattg tgtttgggtc gaggctttcg gacatgggta    187380
     ggagggtgaa gatttctggg gtacctggga cgcgcggtgt tgggggcagg gaggttgcgc    187440
     cgtggaggac gacccgggag cgggcgagtt caaaggagat ccaaacgttg aggtggcggg    187500
     ccatgccgaa gagacgccgg cggaggtccg ggtcgactgg ggtggggagc tggttgatgg    187560
     cgtcggagga gggctgttcg aggtgcaggc ctgtagcttc gatgaggtgc attagggtgc    187620
     agctggctgt ccaggcgagg ttcggggtgg aggtcaggcg gaggtaggcg acgcggagga    187680
     cccaggctgt tacggtgtcg agagtgggag tagtgtctga tagtagggtt tgttcgagga    187740
     tgagccgggc tgtttcggcg agttggagct ctgtggagct ggattgtctg cgggagaaga    187800
     ggtagccaaa tgctgcgacg ccgctgagga cggcgtcgta ggggctgtag aggagagcgg    187860
     actcggctgt gggtggaagc cagcgtctgc tgacttggcg aaggagggtg tcgcggtcga    187920
     cgaaagggta gcatgggtcg actttgtcga agaagatggc tacgagggag cgcatctcgt    187980
     cctgcgagat ggtatccgtg atagggactg ctttgggggc ggatgatggt ggcattgatg    188040
     gaggtggaag atgacgcgcg ccgacgttcc atgcgaatag atgcatcttg ggcgcattgg    188100
     tgggatcgac cttgaggccg agtcgtctgg cgaatgctgc gccggagttg gcatctagcg    188160
     agctgagtcg ggctgctgtc tcctccgggg agatcttgtg ctcgtggcgc ggaggatgcg    188220
     ctgcatccgg ggccactggg gattctgcag aagcggcgga ctgcagttgg aatagcctgg    188280
     catcgcgctt cctgcgtgat tggaggtcat agtggcagtc ggagccgaac tgggcgcatg    188340
     ttgtgcatgg ctggtcgccg gagcatttgc gcttgcgcga ttggcatagt gtgcaggcga    188400
     cacgggaacg cttcctggag ggttcggtca tgtctccctc ggcagaccat gttcatgacc    188460
     ggagggtctg aggtgttgat aggtgtgaat gtgggaataa gatcaggaag ttgattccgg    188520
     tcagttgatg ttgataatag tgcggagcat gtgatatatg aatgagtcag catggcattg    188580
     tgcggcagca taagatttat ccgcatctta tctctacttg ctgatctaca ttggaccgat    188640
     cgactaattg cgagggtctc aacattggcg atagggtcac tctgtcgtcc ttcacagttt    188700
     caatgctttc tagaggcgga gactccattg acaaagttca tttcaaatcc accaacagca    188760
     aattgcaatg tgagatatcc acaaatacga gccatcggag tcggagcctc gcaggctccg    188820
     ctccgcttca gcccccatgg cagcgatgcc agcatgggtt tatcttgtct gacgatgagt    188880
     atgatgcctg tgtagctgtg taaccggggt caaaatgcca gccgtacggg cctgtacaaa    188940
     ctgtgtccga gcaaagacga gatgtgccct cagtggagct tccgggacat gtgaacggtt    189000
     agtccgctct cattgatatg ctagtcaagc tgacagtcct aaagatgtgt acgccttcgg    189060
     aaggcttgtc agccatcgcc tcccgtgcgc aagcgccggg tagtggccaa ggcctctgcg    189120
     aaagatgtcc agaagctgga ggagaagctg gacggactgt acagtatcct ccagggccag    189180
     acgggtctgc tgaacggacc gatgcagccg gcccaggagc ctgtaattcc agcacctcac    189240
     acggacgaaa ctgtatcgtt gcctattcct ctaacacaag atctgtcagg aacaacatgt    189300
     agtccggctg ctccgtcttt ggaacagcct cgggccactt cttacgagcc taacgatgat    189360
     gatgccgagc tgtatttagc taggttccgc tctgacttta ttgaccattt gccctttctt    189420
     gacattccag tatctcaaag tgcccatcag ctgcatgagg agagtccgct gctgtggcta    189480
     gctataatga ctgttgcatc tactcggacc acgcagcaga aagccatgtc caggcagatg    189540
     agagaggcat ttggccgcga ggcgtttgta gaaggcacga ggagtataga cttcttgttg    189600
     tcagtcctgg tatatgccac ctgggatcgc tactacgccc ttgacaagcc gctttttact    189660
     agtttgatgc agttggctat tgcaattgta tacgacctag gcctggacaa gccgccggtg    189720
     caggacccga gtcttctgct tagctatgac ctgaagggac acaatcggcc gtcccattac    189780
     tctcggctgc ctaccatgca ggaacgcaga gctttgctgg gttgctttct tgtgagcttc    189840
     acgtaggtgc aacggaactg tgttataaat gccttctgac gttccaaggt cgaatgtgtc    189900
     ccgaaacggc gagccacttc agtggacgcc ctcattcgac gactgtcttc gcgtattcga    189960
     agaagaaaaa gaatcagaca atgacaccct gctggtgcag cttgtcaaac tacgcctcat    190020
     cacaggaaag gtgatggagg caccagggac agagccaagt gacacccaaa tcctgcggct    190080
     atcagcttca atctatttgc agtcatttca gaagcaaatt cgcacattcc gatcacaaat    190140
     ccctctcgaa ctcaccaata acagtaagct cccgttccca atcaaatacc cagctaacgg    190200
     catcacagag atcctgcaaa tggagttata cagcgcagaa atgatgatcc acgagattgg    190260
     cttctcatca gacccaacta tctttcctcg gcaatcaaac caacaatttg aatgcctatg    190320
     tgcctgcctc caaaccatca agtcatggac cgacaacatt ctggccctgc aacctgtaga    190380
     gtatgtcggg ctttcgtgct tgatgtgtgc caacatggcg cgcagcttca tcaacctcta    190440
     ccgtctcact gtctgtgact atcccgtttg ggaccgtaag ctggtgcagg aaacgataga    190500
     cgtgtcctgg gtactggaaa gggcggcgca gcggttcacg caggtcaaag acgcggcggg    190560
     actcgatcca gaaggcactc aggaactgga tttcttcatg attatggcag cgaaaatgga    190620
     ggccatgaag atgtcgtggg acacggcggt gatgccaatg atggaagact cgtgggagcc    190680
     gactttggat gatctggaca tgttctctag cgaattccgc aatatgtgga gttggtgata    190740
     tctctgcagc tgaggaacag taagaataca agactttccg gtgcttaccg ataagcagtt    190800
     tcataacccg tttgcaggcg gaggaatctg aggcagtgtc tggtccatcg gagcggagtg    190860
     tcacagctcc cactccgatc cagatatatc tcacatcctt ctccatataa aaggagcagc    190920
     catgtcatga ctatactccc attgatcttc tcatcctcat caattcctca agcttcccta    190980
     ttcatctcaa tcacctcctc ttcactcctc cacatcctcc catatttatc catcaacagc    191040
     atcatcatca tcaccaccac caccaacaca accatgccct tccaccccac caaagacata    191100
     ccggacctaa cgggtaaaac catcctcatc accggcgcca acagcggcct aggcaagacc    191160
     tccgtgctag aattctcgcg tcacaacccc tcccaaattt ggctcgccgc gcgcaacctc    191220
     accaaagcac aatccgcggc ggacgaaatc aaacaacaag tacccacagc ccgcattcac    191280
     ctcctcgaac tcgacctctc ttccttcgcc tccattcaaa aagctgtaga agtattcctc    191340
     tccaccgcca cccgcctcga catcctcatg ctcaacgccg gcgtcatggc cgcaccaccg    191400
     ggaatgacgc ccgacggacg atacgaggtg caattcggga cgaattacat gggtcatgcg    191460
     ctgctcacga ggctgctgtt gcccattatg gagaagacgg cgaagcggga tgatgctggt    191520
     gtaggtgggc gtgtgaggat tgttgctgtg gcgtcgcatg ggcagcggta tgcgccgcct    191580
     ggagggttgc agttcgagac gttcaagacg aacggggaga gtatgggccc gtttgcgagg    191640
     tatgggcaga gtaagctggc tcttgtgctt tgggtgagga tgttggcgca gttgtatccg    191700
     tggttgactg ctgcttcgat tgatcctggg gtggtgggca cgacgctggg ggatggggct    191760
     acgggtgcac cgaggtatat tcagtttttg ttcaaggtgg cgttggtgtt gaggctcgcg    191820
     gcaagtttgg aaaacggggt gaggaatcag ttatgggcag ctgtgtcgag ggaggtgaac    191880
     agtggggagt attatgatcc tgttggggtg gtggggaagt cggcgcttgg aagggatgag    191940
     gagttggcga ggagattgtg ggtgtggacg gagggggagt tggataatta tctgggggta    192000
     agggattgag ttcgtattgt atgttctttt gttggtgtgg ggttgcttgg ttatggtttg    192060
     atttctctca tggcttggtt tgatgtactt cggtgatgca gcgtgtttgg tatgcatagt    192120
     atcagatcta atgattgctc tcaccttatc atattacaga atgcagtcac aatcaattct    192180
     tggtacactt ggtacacttg gggtatatct tgatatcggt caatcttcat atctcttctc    192240
     atcaggatac cccatatatc cttccaactt cttccaatcc ggcgttcagc cggcccaagc    192300
     atatatagcg acccacaatc gggtaatgtc ctacaacggt gaagctgatg atctcgtgga    192360
     taagcgtgaa gagcttcgtc atgacctttt tccaggatct tgaaggagtc ccagatgtga    192420
     ggttttagag acttagatgc agtttgtcga aggggatgag gccctcgccg ttgcagtggg    192480
     tgtcattagg ggttgagagt gtgcaggaga gggagtgagg agggtttaat tattgttggt    192540
     gttgatggtg tggctgggga gggtgagggc gtgtgttaag gctgggagca tgaagatatt    192600
     gaggtattcg aggtgtatta atatgctatg tagtaggtag gatatagttt gggtgttatg    192660
     atgctgatgc acgacatata ctgtaatgta ggttttattg atgctattat atattggtct    192720
     gatcaagtct tcgagtacat aatctgccgt gtatcacggt catgtataat gcaggaaaag    192780
     agccggtgct gcattagatg gctctgtggt aagtttagcg gactgtctgc agctggttgg    192840
     ctcctctgat tacagttgca catcttccta aggatgtgtc tgagcaatgc gacgggtcaa    192900
     ttggttgttg agtcgtaacg tcttccttgt gctgactagc cgtgcgactc tcggtgccaa    192960
     ctcccaggtt atataccatc accatctacc ctttagcagt agtggtcgta tactatgatg    193020
     tagtaaaata accccagcat tcttatattc cgtccggggt ttagactatt tatattagtc    193080
     aagaatatgc cggaaagaga gaatgaaggc tatcagttat gtaaaagtta gtcaccgaga    193140
     tctgccatac ttggggttat cagaaccacg aaacccacca agtggagaga cttacatcaa    193200
     tagtgagtca tggcgagtgc tcagtggaag gaaagggaga acccgccccc ctgtttgggg    193260
     cagccatggg atggctgggt agctgttcct gttgttgagc tggcagagct gcactaatcc    193320
     ctactgttca gaggaactgg ggttcattat tgaagaaaaa aatggatcca tcaagtgaag    193380
     ggcgcgagaa tcggcggatg cgtgagtcaa cgggatgaat aaaaccctgc caaagttggc    193440
     ctccccgata gcggactgcc tcaatggccg ccttccgatt ggccggacca gccaaaccaa    193500
     gtcggtgaga gaggacggca cgtgccaccc gaccgggccg gcacactttt tcccttcttt    193560
     tttaatctct tggtctctcc ctctctttct ctccctttct ttcttctccg tatcccagat    193620
     tactccccca gaatcatcag ctcaacttcc atgtctaact aattagaccc ccctcccatc    193680
     tcaatccatc ttgtatacca atcctcagtg actggtaaca gcacagtcgc gcttatgcgt    193740
     ttggcacctt ccgtcttcac ttctcaggta cgttgtctct cccactatgg gttcccatgg    193800
     ctactccgca ttcccccctc cccgccacta ccgtcactcg ccatgaccat ttcaacatcc    193860
     aattgaaagg cattaataga atactaacat gatatctgca ggactacatc tcggatcacc    193920
     tctggaaagc ttccggaaac ttctgaatcc acttcacaca acccgccgta ttcttttctc    193980
     gcaacaaata aattcatatc acaatgttcg ctcgtgtgtt caaggccatg cccgccaggg    194040
     cccctgcctt cacctccgtg aatgcttcta tccagtcccg attcatggct accgtccgtc    194100
     agggacgtcc cgccactgaa cgtgccactt tcacgatccg agatggcccc atcttccatg    194160
     ggaagtcctt tggagcccgc tccaacattt cgggtgaagc cgttttcacc acttccctgg    194220
     tcggataccc cgagtctctg accgacccct cctaccgtgg tcagatcctg gtcttcaccc    194280
     agcctctgat cggtaactat ggtgttccct ccgctgagag ggaccagcac ggtctgctca    194340
     agtactttga gtctcccaac ctccaggccg ctggtgtcgt cgtcgccgat gtggctgagc    194400
     agtacagcca ctggactgcc gtcgagagtc tcggtgaatg gtgtgcccgt gagggtgtgc    194460
     ccgccatctc cggcgtcgac actcgtgcca ttgtcaccta cctccgtgag cagggttctt    194520
     ccctcgctcg tatcaccgtc ggtgaggagt acgacgctga ccaggatgag gccttcgtcg    194580
     accctgagca gatccacctg gtccgtcagg tcagcaccaa ggctcctttc cacgtcagcg    194640
     ccgccgaccc ccagtgccac gtcgctgtga tcgactgcgg tgtcaaggag aacattctgc    194700
     gtagcttggt cagccgtgga gccagtatca ctgtgttccc cttcgactac cccatccaca    194760
     aggtcgctca ccactttgat ggtgtcttca tctccaacgg ccccggtgac ccgactcact    194820
     gccaggacac cgtctaccac ctccgtcgcc tgatggagac ctcccaggtg cccatcttcg    194880
     gtatctgtct gggtcaccag ctcctggctc tggccaacgg tgctcgtacc atcaagctca    194940
     agtatggtaa ccgtgctcac aacatcccgg cactggacac cactactggc cgctgccaca    195000
     tcaccagcca gaaccacggt tatgctgttg atgcctccac cctgccttcc gactggaagc    195060
     cctacttcgt caacctgaac gattctagca acgagggtat gatccacaag actcgtccca    195120
     tcttcagcac ccagttccac cccgaggcca agggcggtcc cctggactcc tcttacctct    195180
     tcgacatcta cctggacagc gtcgtcaagt acaagaacca ccagctggcg ttccacccca    195240
     accggaacac cgtccccagc cctctcttgg ttgacctctt ggccaaggag cgtgtgggcg    195300
     tccagcctac cattggcatg cagaacgtgg ctgccgccgc tgctgctgcc gttgctgccg    195360
     cttaaaagga atgtcatatg gaactggagt ttgggtttgg gtttaggtcg gaatatcttt    195420
     ggttgtacat gattctttcg gtttagtttg ggtacatttc ggtttaggaa tatattttac    195480
     ttcacatact acttcaatct ccctcttcaa catcaaagta gacaatagtc atgtagccga    195540
     taacttggtt tgtcccgtgt accactcaga actcgcagcc catacctgcg ctgctcattt    195600
     cgttacacgt gcgtaagagt tgaggcatta ttcatttgct gatacgggcc ccaatcacct    195660
     ttgcctagca taacacgtct atatccccat taaatcacat gagttcagta tttgactcct    195720
     actcataacc ctataaatac actatacaat gaatatagag atctttcact tatacacacg    195780
     tagtacatac acactatgaa atccagctga ctgccagatc atcccctaat acagcggcag    195840
     ctcgtaagca tcaaaatcat acacccaagt ctggtacgac tcctcatcaa agacacaggt    195900
     caactccgtc ccattgttca catagtaagg tctgagcggc caagcacaca attgctgaac    195960
     ctgaccgtag ttctcaccct cctggaccgt tgcattcaac ctatcgggct tctggccgtt    196020
     ctctacccaa tcaaacaacg tcggcagggt gctctgcggc cagccgccat tcggctggtc    196080
     cgtgctgtac gagcagtgcg ccgcgccagg gacgaggtac agacgattcc agtcgttcag    196140
     ggcgtcggag gactcgttaa aggagaggga actgtacatc gtcttgcgga cggattcgtg    196200
     gtagtgcacg gacgagccgg tggggatact ggggtcggat tcgccgtgga cgtggatgat    196260
     cttgccgccg ttggagtgga acggggtcag gtcgggccag gtggtttgga ggacgtcttc    196320
     gtagcgttgc cagcccaggg acatccagtt cgtcatgaca tcgtaggtga cgttgtcgag    196380
     ggtggagagg ttatcgacat cgcggagttc gaggaacttg gcgacccatt cgccgcccag    196440
     ggaggtgatg tcgagttccc aggagtcggt gtcggagttg tattccgttt cggcgtcgtc    196500
     gaaggtcgcg ctgggttggt accagatgta agcgcgtttg ccgtcgaggg tcttcaggcc    196560
     gtcgaggatc ttggcggcga cggcggcgcc ttctttggtg acggtgccgt tttgagctgg    196620
     ggtggtgttg ctggtggaga ggcgcttctt gagcacggtg gtagtggttt cggcgggaca    196680
     gtagtagggg gcgccgatgg tggagttaac gttgaagtgc agcttgcaga ggtcggtgcg    196740
     ggcgacgacg ccgtcctttt tgccgtcgag ggcgtcgcag gcggcgatgg tcaggttgtt    196800
     gatcttctcg agttcgcagg gcggggggta gtagcccatg gtgtattcga cgagacccgg    196860
     gtagaggtgg ttgggctgct gctggccgta gcggatggca ggggcgccga tgacagcgcc    196920
     atcccattcc tcgccgaagc gctggacttg ggaccagccc tcgcggccac cttcggagca    196980
     gccctggtag taggagtaga gcttggagga gccgaggttg aagaagttct tggtgaaggc    197040
     cttgccgaca gcgctgagtt cgtagtgggc ttggtagccg aacatgtaga gggcctggcg    197100
     gtcaatggtg ccgttggcct tcaggaagac ggcgtcgaat tcggtggaga agctaccgaa    197160
     accaccgtca gtctggccgg aggcagcagc atacatgaca ccgccgggca ggtcagcgct    197220
     gtcgccgttg atggcatagc cgaaaccacc ggtggagagc cagcggttct tgaagtcggc    197280
     tggggcaggg agccagaact gcagcaggac ctggtcatcg agcccgtcgt gggtgtaggc    197340
     cagagtgacg ttgcagaagt cgaaggtgga ggcaggccag aaggccgtgg aggcggagct    197400
     gtagttgtag accgggttgg ctgtgatgga agtggtgtcc acggtgacgc ccatgagggg    197460
     gctgctgggg gccacggaac gagcatagga ggatgtgcag acatccgcca ggctggtcgc    197520
     ctgggcaaaa gaaagtgcgg ccgtgccggc cagaaggctc atcttggagc gcattgcgag    197580
     agagtgactg aaatgagtga ctttcaatgc gagaaagaat gtgcttgccg gcgtgaacta    197640
     ctgggcagat cctagctggc agtagagtga ttttatatca ttcaagaatt tgagaatggc    197700
     cgttgcctag tgtgtagtcc tgctatcatc gccatgggta tctggcaaag ccatgcaact    197760
     gttgtatcta gattaaggag gacaagcatc atcgacccac cccggacatc ggaatttcgg    197820
     aatacgatag aaagtcacga caggccattg gtcaacgggg aagatgtacg cgtcccctgg    197880
     gttcgagagt gaagtgctta gcaactgccc cgggccatag atcgtcaggc accattcgtg    197940
     tcatctgtgg accggttagc tcggaattaa cgggatgggt gaggacgttg gtcggtagtg    198000
     ttttgcttac cacgaagatg ctggataaag ccgtgatgga tgtggtcatg tctgatgcaa    198060
     ggcaaagagg gcgaagtaat tggcgtggtg gaagggagga aaaataatta taaaaatgag    198120
     agcaaagagg actgcagaca gagaccgagg gatgaagaag aggaagttgc tttatccggt    198180
     ggagagacga taagtccgag aaaagcggat gtttccaccc caataaggaa gtcaaatcct    198240
     caggctaagc tttggcaggg tcggaactca ataccctgac gcgtgtaccc ttaaactaat    198300
     cttttctatt ccctgccagg tggatcctga acactgaaga atgatgaaga gcctgacgtg    198360
     acttgttctc catcacttcc aagatccaag tccgagggat ttccgccggt gggttcatac    198420
     gacaaaatga gatctgcaga aagtacacca agtctagtat ctactccggc cggaaatgtt    198480
     cagttcagag aaggcgccgt tggttcgact aaagtgtaga tgcatgaact atattccgct    198540
     tcatttagca acaatcgaca ccacgtcctc atccgacacc acatgtccca agcccacccg    198600
     ctgtgggata tggcgtgcac tcgctcccca taccatcgca tacttgaatg tctccttcaa    198660
     cgtgcggtgg atgttatcgc acacatcctc gatggttgag ttgctgcggc agatcaacgc    198720
     ctcggagaaa tcgggttcct cgcctttcct gtagcatcgt tagcaatgtc tcactcgtaa    198780
     aaataggtgg ctggtcgttg gctgaacgaa ccgtttcgtg tagacccgga tcagacggag    198840
     ttccttccag atgcgatcca cgacgtcttc cacacccaga tccagttcac aactcatgac    198900
     ggctgtgtac ggttcgcggg ctagttggtc gaggaagtcc agactgacac cgtcaatctt    198960
     gttgtagacg tagagactgt aatcatatta gataagtgat gaatgctgat agacgggtaa    199020
     aaaattacca tctgatgtat ttacggtgat ccttcatgat cacgtcaatg aagtcgtcaa    199080
     tcgtggctag attgatgtca gcgatgagac tcaagcggac ggttaaaaca tgattcgtac    199140
     catattcatc acgaaccaac acttcgcagt taagcatctt gtaatcgcgg agaacattgt    199200
     agattatctt ctcatcaagg tacttaggcg gcgtctggaa ggtgatcttc ataccgccgg    199260
     ccttcttctg cttaaggtag atgttcctac acccattagc ccgataccta aagtcaacaa    199320
     cgcttgaaat actcacggag gctccttgtt caacctgatg cctacagcat ccaattccgc    199380
     ctccagtagc gctcgttgct ccgctcgttt cgtagcatcc aacaccatca gaatgagatc    199440
     actcgtctag gccaaattag ccccagagtt ttagacaata cctcagatgc agggatcgaa    199500
     caaaccttag cggccgaaat gacctgtctt ccacgtccct taccctcaga cgcaccctca    199560
     atgataccgg gaagatcaag aatctggatc tccgcaccac catactcgag cacaccagga    199620
     atggcagtga gcgtagtgaa cgcatacgcg gccgtctcac tcttcgtctt ggtgatcttg    199680
     ctcaggaagg tagatttacc gacggagggg aaaccgacga gagctacacg cgcatcacca    199740
     ctcttgctca catcgaaacc ggcaccgcca ccaccggagc cgcctgttgg ctccaggagc    199800
     tgggctcgta gacgggcaag ttttctgcgt agcagttagt gctggttcca catggcgggg    199860
     tagacttgaa gatgaggggc atgagctcga cttacccctt cagtagacca agatggtact    199920
     ctatagtcaa gagtacgtta atatggacct aagatggcat caacggagac atcaaatcgc    199980
     acctgtggcc ttgttctctg tgcacaggtt agcatggcgg ggctatcgag accttgatat    200040
     gcgatcggaa tacttactct gcgtcctgcg catctcatct tcaatcctat aaagcgagac    200100
     ccaagcgtaa gcaagacata cccccagaca gtagccgcag acctgcaata tgggcaacat    200160
     actccttaat cttttccgta atgttcacca tcttgccggt tatgagcccc gcggactcga    200220
     tttcccagat acaacaaacg acacaaccag acaaccgaag ctagatttcg ccgcaagcga    200280
     agtctctcaa gtatctatta aacaagcgag ataatccccc gcaaatcgat ttgattgcag    200340
     cgcaagaaca cgagcagctc tggattggga aaaccgtcct caaaatcatc cgccgcgcca    200400
     agcaaccacc ccgcttacgt aattgccacc tccggcggaa tcttcgaact tcccgacatc    200460
     aaacatcaac atccccatcc tttccatcaa cttcacctca catcatcccc aatccctcca    200520
     ccatcacagt agccatggct gaagcaacac ccccaactga aacagtaacc cctcctacgg    200580
     aggaggtcgt cgaagaccaa caacaaaccc agcaacaaga aaacgaaaca acagaagaaa    200640
     ccaccgccct aacaaccacc gccgacggcg ccgtcgaacc gcaaaagaag accaaaaaga    200700
     taatccgacg caagcgccgc ccagcacgcc cacaagtcga cccagcgaca atcaaatccg    200760
     agcccccacc ccaagtcggc acaatcttca acatctggta caacaaatgg agcggcggtg    200820
     accgcgaaaa ctcctaccta agcaagacgg cagcaccctc acgatgcaac atcgcgcgcg    200880
     acagcggcta cacacgggcc gataaagtgc ccgggtcata cttctgcctg ttcttcgcgc    200940
     gcgggatatg cccgcgcggc gcagagtgcg aatacctgca ccgtttacca acactgcacg    201000
     acatattcaa cccgaacgtg gattgctttg gacgggacaa gttcagtgac tatcgggatg    201060
     atatgggtgg tgtaggatca ttcatgagac agaatcgcac gttgtatgtg ggacggattc    201120
     atgtgacgga ctcgattgag gaggtggtgg cgaggaattt ccaggaatgg ggacagattg    201180
     atcggattcg ggtgcttacg tcccggggtg ttgcgttcgt gacgtataca aatgaggcga    201240
     atgcgcagtt tgcgaaggag gcgatggcgc atcagagttt ggatcataat gagattctga    201300
     atgtgaggtg ggctacggtc gatccgaatc cgttggcgca gaagagggag gcgagacggc    201360
     tggaagagca ggctgctgag gcggttagga gggcgttgcc ggcggagttt gtggctgagt    201420
     tggaaggcag ggatcctgag gccaagaaga ggaagaagat tgaggggagt tatgggttgc    201480
     aggggtatga gccgccggat gaggtgtggt tctcgcgtgc gaaggagttg gaggatgcga    201540
     atgcgattgc gcaattggag gctccagagc agccgctgat gattgagggt gcctctgaga    201600
     ctgctgctgc tgctccgcag gaggaacagg ccggagggat cttctccagc tctgctgttg    201660
     cggcgttgaa gggcctggct ggcggtgctg tcacgacgca gcaggcgcct aaagctgctg    201720
     gacctctggt ggcgtacggg agtgacgatg atagcgagta atttggttga tattcattgc    201780
     atgcattctt acgtgtacta tagcagagat acctgaaaaa tgtgcttggc ttgactggat    201840
     ttcatttcat cgtttggctt ctatggaacg gctaatttca acgcttgttt gcatggcata    201900
     attgtgggta tattcgaaaa gaggagattc aatcaacggc agatacaata agagacacat    201960
     aacacgtaac atcacacatc atttcatctg tcggctgcgc ttccaaggtc gtagtatatg    202020
     catgaccctg tgcggtagtt gtatataaaa gcattgctga aactctccat cccatctaca    202080
     cgactctcgt tggcaaggtc tagtaatagt tcgtggacct gcgtgaggta tttccgttct    202140
     gtcaagggcg cgttttggat gactgtgcgc caactttcag gatcagagag acgggtattc    202200
     ctgatggcct ctagcaactc atcgcgagta tcgatagcag caacgggccc gttcagggca    202260
     tcctcaacca cctcgcggga tcggaatagt gctggaaaga gttagaggga tcctgtgata    202320
     tcaaagggac aaattgaaca tacctgtctc gacaatattc ctgcggttgg acttcttgct    202380
     tcggtgctgc ggtacaagaa tgcggacatc gctgaatcgc tcgttgaatg aaggccccgg    202440
     gtctgcttgg ctgggcagac gagactgccg taaggggtcc gcgccctctc gctggtagcg    202500
     cgcacgtatc tcgttccgca gccaaggaac aagttcggag ccccggatat cgaactcttc    202560
     ccttggggag agactcttga ccttgaaacc cctctcctga ctgtcttgct ttgcaataac    202620
     aatccagcca tggctgtcat ctctgtactt gttcaggagt tcttccagcg aggaggcatc    202680
     cacagccaac tctgcactga cgtcattaag ccacagatcc tggacgattt tgatgcccat    202740
     ggtacgcaac actgtgggat cgaaacttgc aacaagcaca tcgcactgcc agctgttagc    202800
     atctctcggt tactaaatgg tgggcattcg acttacccta cgtgtcttcc agaaagctcc    202860
     agcctccata tcaaaactct tcgctggagt cttagcagga gttccgaggt actccaacat    202920
     agccgagctg aggcgatccc agctcaggtt gaaccccaca gcatgagtct gagaacgact    202980
     agccaagact ttgggtcgga actcttggac cagcgagtca taccgtccgc cagccgcgaa    203040
     aacatcgcgc cgcttactgt caaagacaca ctggaagaga atactgcctc gaaagaactt    203100
     atcgttcaga ctgccgagag ggttcatgta aaccttccgc ttgacatcaa agttctgcag    203160
     ataagccacg agcagattaa ttcgagcaaa gataggtgcc aatcgctcag caaatatcgt    203220
     accctgcata atagcccgca gtcgtttctg aacctgcttt ggagagtctc tgaagtcgaa    203280
     ccgtgccagg tcatccagcg aggtcgaggc aacaccgatc gcaggggagc gaagctcact    203340
     tcgaatcttc tgcatcgtcc attttcccac gttcagcttg ctgacaacct ccttaacacg    203400
     agggatctga gaaggtgtga tccggcaaaa ctccataatg gtctgaagca ggtccgaatg    203460
     attgataaca aagcacatag gggaagatct taggggcggg aattcttcga taatctcatc    203520
     cagcactttg attacctcgg cttctttcaa agccagatcc aaagtgttgt gtgatacaat    203580
     atcgaagtct acctccttat gagttctggg ctcgccacca tggggcagtt ccctgtagac    203640
     cgttccaaaa gcgtatgtct tttccaagga aggatcttgt cgtggaatag cacgcgcatt    203700
     gggcagggta agatcaaacg gcagttgaag caagttgcca gaggagtcaa gcaatctcac    203760
     agcgccgtta ttgtagtgtt gagatctggg gaacagcatc tgcctctgag tttcaacagc    203820
     cccatggcgg cggaagatcg acgttagctt ctctttaacg aggccctgaa ttaacagctc    203880
     ggtggcacct ggtgtaccgc gagagtccat atcccaggcg atgtcttcga acttctttgg    203940
     tgattgagaa aatataccgg ataagatctt tttgtagtcg ggcgagttcg gatcagagag    204000
     tagatgcatg atcgcgcgcc taaaggtttc ttcttcgacc tgcagaggaa tctttccgct    204060
     acggagaaga tccgaggctg tgggccgctc gctcgggtta tggctcaata acgaattaat    204120
     gatcctaccc tggactacct tctctgaaga ctggaaggta gacggcaggg tatggtttgg    204180
     ttcgcggata gcccgcagtg tttggtctcg ctccatgcct gtggataagg catggcacat    204240
     ttcaaaaaag atcacaccca gagaatacat ctatgtcccg ttagaccttc tctcgcttgc    204300
     ttgagtgggt tgcacttaca tcaactttct cattgtagtt gcccgtgaag cccgacttca    204360
     tctcgggagc gacatagtag gtcgtgccca ggctgcgagt aaagttgcct tcaaaatctg    204420
     cggtggtgga agagcgcacg gctgtcgtaa actgaccact cgtggcaaga ccaaagtctc    204480
     caatacgggg gttgttcgcc acatcaataa agatattgtc tggcttgaga tccctatgga    204540
     taataccatg accgtggata tggctcagtc catccaggat ctgccggaac aggcgccaag    204600
     accgatcaac atcatcgtac agaccatttc ttatcagatc acgaagtgtc tatgtaagtc    204660
     agcatcagct gcgtactttt taggcacaat atcacgatac tcacgtgttt ttcgcaatac    204720
     tccatctgga taaagagcgt agtaagcacg ggcctgccct gggagcctga ccgcacccga    204780
     ctaagctcct tgcctgtggc gctctccgtc tcaaacgtcg agggcgtatc gcccttatct    204840
     ccattggaca aagttccatc gttgtcctcc tcactgtcgg agccaaattc aatcttagga    204900
     taaccgctcg agctgataaa gtcaagcccg ccggtactat aatcataggc atgcgtgtcc    204960
     cgactagcaa agacgtcact ctccgtggaa gaaatggctt cctcgtctac ataatcataa    205020
     tcctcctcga tccacgcagt ataataacgt actacgtaag gatgatttag ccgggacaag    205080
     agcataatct ccgacagtgt gtctttcagg gccgcggtag acttctgagt aatcttcttg    205140
     acagcgtaaa agcggccatc gagcttattc cttgccttaa ccacctgacc aaaacctcct    205200
     ttccctaatc gcccagcttc atcaaagtcc tggttgtacc gcgagaaggc aggcaagccg    205260
     ttcaaggagt cgagccgtgg acgcctcggc agggagattg agtttgaggc acttgtgcgg    205320
     gaaatcaagg gagtgtccac tcggaagaat tctgaaggct gcagttggaa agcagtcggc    205380
     cgcttcttcg gatcgggcct aaagaattca tgcaggagat cctgcaaagc agtcgttagg    205440
     cctagcgtgc ccatcagcgc atttgctgac gtataacgct gcagcacatc cattccgaat    205500
     cccatctgaa ggaagacgat acccaggtcc cagacgtctg tcttcatggt cagcggtgcg    205560
     gtcccgtgtg ttaattccgg gggcatccag aatggtgatt ttgacgttgt gagcaaccgt    205620
     ttgctggcag gtgaatcagg aagggcttct tcaatgccag ctcgcagttt cacaatggtc    205680
     ccaccagtac gagttctgaa caataggatg cgaccacaat gaatattgcc atgaacaaat    205740
     ccactgcggt ggtaaaactc caaggcttcc agcagctgga tcgtccagct gcggagcact    205800
     tccactggga cggttcccac aatatccaga aactcggcca gtgttccctt gttcgaatac    205860
     tcctggagcg catagacagt ccagatgctg tcctgagcat cctgcatgct caagggtcga    205920
     gttatcttga acccaacaaa atccacaagg ttcggatgcc gtagtttctt caggccttcc    205980
     agcctgtcct cactcgagcg catcttctct cggaacagaa ggggctcgac tcccttctca    206040
     tccagtgaaa tctctctcag aaccagtaga ggcgcatggg accggttgtc ggagacgacc    206100
     ggtctcacgg tatacgtctc ctttcccggt ccgatctgga gaagcgattt gccgtacact    206160
     gcgcggaaga ccagggtggc ctggtcggaa tccgtcatag ctaacggagg gtcgaaggtg    206220
     attgcacccg gaatgttctc cacagcatca gcgtccccat tcgcatccag tccaggggtg    206280
     cgacttttac gccgggacag ccgtgccttg gcccgctctc ggactttgtc ctccaagagc    206340
     tgctgtaggg cacgctcttc ttcagctgtg gctgcctcct gtttccggat ctcctcttgt    206400
     cgctccagct ccgctcgctg gtttgcggcg gcttcctgtt ccattcgctc ctcctctaag    206460
     ctcggaagat ccttgtcttg agcttgagcc tcagccacat cttccaagac atcttgtatc    206520
     gacacggcca gctcatagat catttccgag ccgaggagcg tcttcggctt attctgtata    206580
     atgtcttgaa ttctcgatcg agcacctttc cggagatcgt ctaagttttc cagggatagg    206640
     ttggggtagg tcttgggata ggtggtgggc agctcgacga gcaattccag atgaacgtcg    206700
     ggattggacg atgctcgtaa atgaagcttg aacgagacct cggacgattg ctatagagct    206760
     tcttggtcag caatgcctta gagcgatatc aatgcgacaa tcacatacct gccaggcaga    206820
     acgcctgtgc tgcacttcct caaagtcatc accgtagatg gagcgcaatg cttcgacttc    206880
     attctggtgg atctcctggt aattggtggg ggcaactacc ggcggcgaga aagacggcga    206940
     gtctggccgg agctgctgct ttttctccgc tcggggagag ccgtgcttgg gggcattgct    207000
     gaaattcttc ttctgtttgt gaggcatagc ggggcgctgg tcgggcggtg aagatagtgg    207060
     atgcaccgtg atcgagattg gcctttgcca cggaaattag tgacaaagat gcagccgaag    207120
     ctgcagccct ctatagctca gtagagaaca tatctaaagc agaggaatca aaagggaaga    207180
     aaggtgggaa agtatatgtg gagagagaga gaaaggtaat tagaccggag gaagagggag    207240
     ggggaggaaa cggcgagagt tagtctagca gtcaaaagac gggaagagag gaaaagagcg    207300
     gtaacccgac agcgagtata tgaacgccca atcgaagcgc cgccccgtcg tttttccgcc    207360
     caccgccttt ggggcgggca gctcgtgact tggcgcatca tcgccgtaaa caaagcacag    207420
     cgttccacgt caatcctctg gccccccaat ggtcttgctg gtgccatgcg tgtctcgtcc    207480
     agtcccataa tttgattgct ggtgaatcgc cggatacctt gtcccctgca gacgcgatgc    207540
     tggggtggat cactgggcag gaagaccagg tcgcaggtgc gtgtatttcc ctctgtactt    207600
     tctgctggtc gctacgagta gtatggcttg ctgcccgccc tactgctgct gctgctgcgt    207660
     gcgcgcgccc ttccctccac ctccctccag atacggccca ataatggcct tccaattttt    207720
     ctggccttgt ttcccacccg cgctcatcgc gcgctgactt gtttttctaa ctcgtttatc    207780
     cccatagaca actcaagggc tggagagcca cccgagacgc ccgctcccgt gtttgcgatc    207840
     cgcgctttca agagcgcctt gtttggtacc ccaggcgccg atgacgacga gtccacccac    207900
     cgtactacta ctgctactac tgctgtgaag acgaagaatc cctcgaccaa tcagctcctg    207960
     aatgatcaca tcacgttgaa accatccagt ggaaacacag gggatgcttt caaggcttcc    208020
     aaagccgact tggatctggc aatgaacgcg atggcatcgc ctacaaaaag tatcctcgta    208080
     acacccggaa ccgcatccaa ccgtcgcaaa accgtgtcgt tcggcgacgg tgtcgtcgat    208140
     aacgagcgca agcgggaaga cccgttcacg aaacctaaca aaacccccac ctcctcttcc    208200
     aacaacttct ccagccagtg gtcggccacc tcgtcggacg gaaagttcaa acctcgcagt    208260
     aaactgacgc aagccttgat ggattcgcga gagaagtcca agggcacggg gctcttttcg    208320
     tcacaggacc tcgagcccaa cccctcatcg gaggggtcca gaccatcgcc aacggaagat    208380
     gacaacgacg ataccatcaa cttggatgag ccacggtcgc agtcggggaa atactggaaa    208440
     gccgaatttg ataattaccg gacaaaaacc acgtgggaaa tcaagaagct catccagtac    208500
     cgctcggccg cgaaaacata cgccaagaag aaggatgaag aagcgtcgcg actcgccgat    208560
     aagttgaggg aggaggagat caaggtgtct gagatggagc gccatgttac ccatctagca    208620
     tcgaccatgg ttggggaaag cgctaatgcc gataaagaga aattggtgca ggacctcacc    208680
     aagcagaccg cgttggctct gcagtacaaa caccgggtca actcactacg caaactgctg    208740
     gaacgacacg gcgtcgtggg gaatgaagtc gacgatatcg ctgagcaatc tgaatccgaa    208800
     agttcttcag agaagactac agaagagctc cgcaaaaccc agcaggctct ggacgaagcg    208860
     aaagccaaga tcgacgatat gaagcttcag cagtccgact tcaccaaact gcaagatctc    208920
     gcgcgcagct ctgaacagaa agcctgcgag ttgcagaagg agaacgcgtc tctcaagcag    208980
     accctagccc gtgtgaagca ggagatgagc aaatacgaag gacgccgcaa agagaaggaa    209040
     gccaaactga agcagcgcga ggctaaactg gaaacgcgca tccaagagta ccgcgaacgg    209100
     ttgaagaacg cctctcagca gcatcgcgat cacgaggaga gtttaaaaga atccttcaat    209160
     gaggaacgcc accgcatgca ggagcagatc gaccaactca agatcaagct taccgcgata    209220
     gagagcctcc cacacaccca ggttcgcgcg cgccatagcg agagccctcg caagaactac    209280
     accggtgtgc atgtcttcga tttcgggcag aacagtcccc agaaagaccc cgaagacgac    209340
     aacaccgcgg acatcgacga gccaccaagt cccagcccgc gtgcaaaaga acgccgctcc    209400
     tacccatccc gatacaccac caccgccggc gacctcgacc tcaaacgagc catgaaagcc    209460
     atgggcatca ccgacgaaga ccagctcgcc tacctcggcg aatccctcaa acctcccaaa    209520
     tcccgctacc aaaacgagaa ccacgatgac gaagaaccag ccaccatccc gccctcctcc    209580
     ccacccgact acccccatca ccatcaccac cctccaccct ccacccgccc gcgccccaaa    209640
     cagaaatcca acaacacaaa cannnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    209700
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    209760
     nngatgggaa cggtacggag tgaaatggac ggatggtgga tggatggatg aaactccctc    209820
     tctagtcacg gtttgctttg atacttcaac cacctttccc ctttgtgttg tgatcatgga    209880
     aatacctctc cttgttgtct gatctgatct gatctgatct gtcttttgtt gttggtggtc    209940
     tggtgatatg gtctggtctg ctttgctctg atccgggtgt tccttttcct ctgttgatgt    210000
     tgatgtcact gtcactcact cactacttag ctctagtccg ttgatcgtac gtaattttta    210060
     gttcttattt ccctccacac actctctttt caattcagaa gtagagtcaa ctacgtagtc    210120
     ttgtttagtc tctaatacgt acttactttg cacggcagaa gaagtgtata acaaataata    210180
     acttagtgta tcccatctcc atctatcagt ccattcatat ctatcaatga tttatcatct    210240
     aatataacat ctacgcaaca tctaagcctt cccatcacaa aacgacacaa cagcccactt    210300
     cccactccac gcccacttcc gcgcctcgtc gcccccaccg ttaggcatct ggcggagctc    210360
     ctcatccaca cccttgggca gaccaaccac cacatcggcc ttgcaggtgc ggaaagccat    210420
     gacgcggacg ccggattgcg ggcccagtgg gccgatggct tctgtgaagg gggttgtggg    210480
     gtcccaggca gcctgtacat aatattagat cagaacttaa gaagggtggt gatggatgga    210540
     ggggacgtac atcgttggtc aacttgcggt agttcaagtc acccttgaac aagaccaatt    210600
     cgctgtcctt caggtcgctg aagaggtccg gggctacata tggcatgcgc cagtagcttc    210660
     ctggggtagt ccagaaggtg tgaggacgga tgatcagctt tccttccgcg tggaggtggc    210720
     tccagtggtc gaagaggaat ttgacttcgg agacttcctt ctccgagagg gggtcgaagc    210780
     tcttgccgga ctcgtcgggg gcagtgtaga aggcctgcgg gtcggagagg gcggcgatga    210840
     gggcggcgaa gtccggggga gtgacgtcgg agacgaacca ggggatgttc ttggggtgga    210900
     ggacgacagt ggttgcgagg ccggcggaga ggaggtagcc ggcgaggatg aggtcgacga    210960
     agagctcgaa gccggagttg tcgaggacga tgtcgacgcg gcgatcctga ttcttgcggt    211020
     cacggcgggc ctggtgcagg acgtcgaagg aggcgttgag gtcgttgacg aggatattct    211080
     tctccgaggc cttgcgggct tccgagccct ggagcttctg gatgtcttcg taggtgaggg    211140
     aggtgaggag ggagaggtca gtggcattgc cccagaggca gatctcgcac atctcggaaa    211200
     agaggatgcg gtcggcttgc tcgatctgct ccggggtctt gccctccgtg cccttgcttg    211260
     cttcctcggc cagttccttg tatcgtgcgg cgagttcgag gacggcgggg cgagatgact    211320
     tgaaggtgga catcttctgg cgggcgaaca cgtcatagcc cttccagtgc ttggagaggg    211380
     agaagaaggt gctcaggcgt ctgtctgggt gggtgtcagc tggggtgtat gtatggaggt    211440
     atgccaattg cacgcacaga ggtagcattc tgagtagagc catgcgacgt cgtgccatga    211500
     agggtttccc cgctgctcca gctcctggtt gtacgccgca atgtcgggct ggccgtcgtc    211560
     ggggagaggg ctgtagctga gtcaatgcct gctttgttta tggagatcgt gtagacgggg    211620
     atattgatct cacgtcaact gtctgttgtg ctgcagctca tatttgaaag ctgcgaggct    211680
     cccaatgatc gctttccctt cctgacgctt ctcctcgtcg gttacatcgg caacgctgcg    211740
     gtgcagatca tcaatcgcgc cagtctgtat atgaagtgta ttagtcgagg catgtactgc    211800
     aatagtttag attgcaagga gcataccaag atgaccggcc agcgttcgtg ggccgagacc    211860
     gaggcgaagc tggacttgtc ggaggtgaga tactgcgctg cggaggggaa ggcggggtta    211920
     gtttgggctg caggaagagg ggcagtcatt gtcactcacg ggccttagga tcgtattcca    211980
     tgatgaagaa aatgattatg tgattaaata gataggaata actcaaagag agaagcagag    212040
     aagaagaaag agaggaaaga gtgcgagcca agatgaagag cgagaaacaa acaagacgtc    212100
     ggttgggaat cgcggggtcc ctgcggtcgg gattctctgc accgacagac acttttagac    212160
     ctcatccatt cattcattca tttatttctt ccccatcttc tatctaatta aatggacgca    212220
     gaattccgac tggaagacaa gacgcaacac aagaaccaat tcgtccaaca attccctgtg    212280
     cgacagccaa tccaacgccg ccagacctgc acatgcggga caactcaaca gcaaagacat    212340
     acagcttgat aacctcgaaa ataacatata agtagcaaga tagatagatt tccgctatgc    212400
     aaagagttca cgagatcgtc gtcaatcatc cgtagataca tggccctcgt actgtgtaat    212460
     ccaaggcttt ccgcatcttc ttcttctcat ctgaacgtcg caggtcccat cctgaaatgt    212520
     gtgtgtatat gtatcatgtc ccgtccgatc ggcgagattg actcgctccc aatccatccc    212580
     atgaacgcca gcttgcagag cagttaagcc tctcacatca tcgaggacat gagagagttt    212640
     tgcgcatacg cctggaagtt gtcattagca tgccagtccg gacttctcat taagataaac    212700
     ttaccatcgg cttaatatcc gggtgaggaa cagcctcaaa cacctggtac tcaagcttga    212760
     gctcgggccc gatcttgata aaggctccct tgttctccgt ggtgtcgcag tacttcggag    212820
     cagagaagac ggtgatacac cgtccgtcgt gctcgacctc gtagccctcc atgcgcacct    212880
     cgtgcgaacg aatgattgcc tccagaccat tcttctcaca gaagcgcttg gtgacgtccg    212940
     gaccaaactg aagaccaaca ccacgcttgc tgggtccgcg accgggcgcg gtctgcgggt    213000
     ctgtccacag catttccatc atcaagccct gttgtccggg ctggcgctgg ttgtgacggt    213060
     tcagcttgcg gatatcatcc agagtagtgt tgtcatccga gaagagaccg ccgtggagca    213120
     cgaggtactt gttgccgatc aacgtagcca gcggcagagc cgagaaggac tcggagaaga    213180
     ccttgaacac cgtctcattg tacttggcct tgcactcgcc ctcaaagcca tacaccttgt    213240
     tcatgtcgtc cgtctcgtgg ttcccacggt tcaggaagat tccgttgggc cgcagccact    213300
     tgtaggcgta gagcagaaga gcaatctccg tcgaccacga tccacggtcc acgaagtcac    213360
     cgttgaagag ataagcatgg gtatcgctag ggtacccgtt caggcggaag atctcgagga    213420
     gatcgaagaa ttgaccatga gtgtcaccgc aaaccgtcaa cctagtaccc tccttaacac    213480
     caacctccac catcgtcggt tccgcataga caagatcctt gacggcctta attatttgga    213540
     aagcatattt gcgatggatc ttcttcccgt tcttgaaccg ctcaatcata tcatcaatga    213600
     actcctgcgt catttccttc tccaagcgca caccatcata cttgtcatcc acaaccatcg    213660
     catcgatatc caggtcctcg aaagcagagg gcgggtcacc gacctcgatc gccttctcga    213720
     actcgagccg acgaacgagc ttctcgcact cggtgagctt tagcttggca tcacggttgt    213780
     tgggctctct cttgatcacg gccttgaagt ctttcagggc ttccttgtag ttcagaatag    213840
     cggagttcgc aagggcgcgg cgccaatagg cctagcaacg gggttgggta agtcaaaggc    213900
     gaacaacagt agcaacaacc agcagcatcc caacgaacct tgacatagtt ggagtcaagc    213960
     tccagtgcct tggaggcatc agcgatcgca aaaccgtaag cctcaagttt gatatgtgcc    214020
     taaccaggaa ccccagaaac agtcagtatc ttcaacacct ccaccagttt cagcagtagc    214080
     gccacctacc tgagcgcggt tactaaagaa cgacggctcc ttatcatact tctcaatggc    214140
     tctcgagtaa aaatctatgg cagtaggcca ctcatgttcc gcgaaggcct tgttcccctg    214200
     caccttgagg gcagtggcgg cctcgagatc gggggaagcc atcggcgcaa aagaagcgtt    214260
     taacgaaagg aggggttttt gggcaagaga gcacgagagc gggacgttcg cagaaatcta    214320
     gtcagtatat taaaggaaag cagaagcgtt tataaaaaaa gaaatgaaaa taatagagaa    214380
     ggcaaaaaag aaaagaaagt tcctgaaact tttcctcggc tcgcccgttc ctggattcaa    214440
     ctttccaggc gtagactcgg gtcgatgatg attgactgac tgactgattg attgacttgc    214500
     ttcccttcgt ttccccgtca cttttctccg gcctggtggt cttggcgcgc ctccgattcc    214560
     agaaccctct tgtcttgccg catgcatctt gcctacttcc caacaccctc tcaccctccc    214620
     taccttgtct atcaactccg accctgaaaa tcaaaaaggg aaataaagat gtccttctac    214680
     gtcgccccca gccagcagcg cactctccgc gcctgcatgg tgtgctcgct cgttcaactg    214740
     cacagcgtac gttcagctgc tacctcccaa ttaaaaccaa cccaacctaa cccgaacaac    214800
     aactaacatt ttctcctttc ttactgctta gaaattcatg cgcgaaggct gtcccaactg    214860
     cgacaatgtc ctcggcctcc gcggcaacaa cgacgcgatc caagaatgca cgtcgcaggt    214920
     cttcgagggc ctggtgacgc tccgcgatcc cacaacgagc tgggtggcta ggtggcagag    214980
     attggatagt tatgtgccgg ggacgtatgc ggttaaggtt acgggatcgg tgagtactct    215040
     cgcccaccca tactgaactt caattatgtc cgggggtggt ggtgaagaga atattgggct    215100
     aacggtgatg ggtgaacagc ttcccgatga gattatttcc agtttggagg attcgggtgt    215160
     caagtatatt ccgtatgttg cccttctatt ccttctttgc atgtctttgc gttgtgtgtt    215220
     gcgtgttgga ttaattgatg agtgctgatt attatgtgtc tcgatacagg agggatggta    215280
     gcacgggtga agaggaggcg tgatcgatcg ctgtctgctc agctcttttc acacaattct    215340
     tcgctgcttt tgttgcgata tgtcggttct ctatcttgca cggcatagcg atattttctc    215400
     gatagggaga tggttttggc cttctttctc gatttgcacg attggagttt cggatttata    215460
     tttctcgctt tctattatgt acggtacggg gtttgtcggg ttggtatgat tctgcacgct    215520
     gtttataatt acaaaggggg atgtctactg gatacccgga caatagatca agatcaacgc    215580
     tgccttgacg gcatcacttc gttgcttaat gactagacta gcttcaatgc cataaatcgt    215640
     agcgcaaatt gccatataaa tattggctaa agatatctcg aaaacaaatt gccccatccc    215700
     aataccgtta taacgccaaa agtcacagac tagagttcaa taaaatcaac tgcgcgctta    215760
     cagctgctta atgatcttct caacgctctc caggaggata tcagctgcaa catgttagtg    215820
     tcttatcttg ttaacccgaa tctagggccg acttaccatg gtgcttctgg aagaccagca    215880
     tgggcctcag gcggacggcg ctctggccgc taccaccaat gttgacgcca acgcccttgg    215940
     ccttgaccag gaactcgtca cgcttggggg tatcccaggc aatgaaggtt ccctggccct    216000
     taccacgcag gttctgcagg tgctcggggt actgcttggc gagacgctcc aggccggaga    216060
     agaggtagtc accggtggca gcagtattct ccaccaggtt caggcgctca atctcctcga    216120
     tgatgccacg gaagatcaga gcacgagccg ggtcacccat ccaggtgttg aactgacggt    216180
     aaggcttgtt gggacgcaga gccgggttgc catagtagta accggcagtc tgggccttct    216240
     tggagaaggt caccatgtca gggggagtct ccaggttcca gtggtcgtgg gcccagaact    216300
     tgccggtggc acccacacca gtctgcacct catcgacaat gaagaggacg ttgttgcgct    216360
     tggtaatctc acgcaggcca cggaagaagg ccggggaggc gtggttgtca ccaccctccg    216420
     actggatggg ctcgacaacg accgcagcga cggggttgtg ccactccttg atcagacgct    216480
     cggtctcctg caggcaacgc tgctcttcct gggcgttctc ctgggcgtgc tcctccaagg    216540
     ggtacttcag ggaggggaaa ggagcctggg gccagtcaaa ggcggggata tccagcttgt    216600
     ggatgggctt gctgcgagtg gtagacagac tgccgaacag gcgaccgtgg aacgccgact    216660
     tgaaggacat gatggacagc tgaggggaac caggggactg gttcttcatg gtggtctcca    216720
     gctcctcttc ggtgaactcg gtctcagcgc caccacgctc gcgctgacgg tagtacataa    216780
     aggcagcctt gtaggcagtc tcgttggcat ccgagccagc cagggcggta aacacctggt    216840
     taaggccctt gggggcggcc ttgaggatac cagtgtccag gatgtcagcc cagtcgtgag    216900
     aggggaagtt acccagagcc ggtctgttga tcaaagcatt gaccatctcc ggagattctg    216960
     ccaccttgcg gaggtggggg ttgttgtagc cgacggggat agaggcaatc tgagcatagc    217020
     tgaggacaat atatgttaga aaccattcga gcgcattctc gcaaaataac cacaggctaa    217080
     ttgtagtagc ttacacatct agaagcacgt ttccgtccag atcggcaatg ctgtgtcaaa    217140
     gttagtgctc gttcggcggt cttgcccgca aggggtgaga taaatgcagg ttgacttgct    217200
     agttaccgtt ggacttgtag tagtccgcga gcatgttcaa gctgcggacg tcaaagacct    217260
     tgtcgagctt cgcagcagcc gccttgttgt tggggccagg aatggccgtg gccagcttgg    217320
     gagcggatgg ctcatcgggg aaataaggct tctccgcagc gcgcatgtgc ggagtagtgg    217380
     tgagggtgcg gacggccgac aggcgcgtcg tcgggcgaag tctcaagctg gaacggaaga    217440
     tggcagccat tgtgatgaat taatggagag gagatgggtc tgagaaaaag gaatgagttg    217500
     gggtggccag gggcacagaa atacccagct ggaaatcagg gatgtgggga aggatacgat    217560
     gacgataacg caatgatgat tgataaggag ctcctcgatc gatgctcaac cagacaagca    217620
     gcaaaccagc accgattata gcttcaactg gtgcaattga gatgactatg gggagagaag    217680
     ataaagcacg agaaaaatgg ccgcgcgaag ggcttttaaa tggaagcgag ggggcagctg    217740
     ttaaaggaga gctcgcgatg gattggaagc tgccccgcgc cgtacagctg cttcggcgtt    217800
     ttgcaccaat cagcgatcgt gttggccccg tgctcggcga cttgccaacc catccggaga    217860
     gtcgccgttc agcatgataa ttcccaatga taataggaat tccataatcc aatcattcag    217920
     atgaagatgt tctctgttga tgcaatctgc ttgcctcttc cgccggctgc cgatgacggt    217980
     ggagtggcaa tagccataag atgcgactgg tcaatgtgtt gagaacatat cagatctgca    218040
     tcgcttatca gtggcagggg tgggcgataa gcagcccatc tctcgctgcg aactccgatg    218100
     ccatcaccgc cgttccaaag atagccaatt gctaataaga acaattgctt agatgaagta    218160
     tagaataagt aaatggtttg atgccgtcac tatagctgga aatactgctg gattgtccga    218220
     tagcttcagt agtaagaact tgttctcaat ggttgtgctg cttggtatat atattgcaac    218280
     tagccgtact gctactgaat tggatttctg cgaaaattga gtgacttccc ctttccactt    218340
     taggttgaac gtggcgctgc ttcttgttca ctgagtggcc tggagtataa gagaagtaca    218400
     aaagtatatg ttttgagcaa tccctgaatg atcttggatt gccccaggag aatatattag    218460
     agaaagtgac tgttattctg agcgcttgtc taagcttaca taatctagct atgtgatcta    218520
     aataaactgt gcactaacaa tatcaagtat tgtacttctg tccagccggg ttgtccatca    218580
     ttatcctggt ccttataaaa tattgagcct tattttaatg attcttttat atttgagcca    218640
     aacttttgag tatcaacata ctcttgagca ccaatagtat caaatcgcaa gccttaaata    218700
     agcaggctcg ggtcatcttg gcacaagccg agccgggcga tcccgagctt ttcgagcaag    218760
     ccctgccata tctaggacgg atagatcgtg ctaatcgaac gtgcctttga acaagatgag    218820
     atagccttcc agctatttct tatattcata cggaatccta gtttgttcag ttcgcttaaa    218880
     agtatgtgag acctcaggca ccaataggtg catagggcgg agcttcttat actggagcca    218940
     tcagtcctat aacagcttgc ctgactcgtt tggctgacta ttacattatt aatttggcag    219000
     ccactcggca ataacaagaa tccagagata aaagatgctg gtcagcattt agcggcaatg    219060
     cgatccaatc tgagggtctc gagctccaca atcttcccta ttgggcgagt gttgtcaaac    219120
     atggcattaa tatttccctt tttttcgccc cccatatccc cgtggttaat tccggatggc    219180
     ttcagagtgg cggaacgggc aagattgagg tgtctgtggc ctcgtgttag tactttgtaa    219240
     gccatgacca gaagatgctg ttccgaagcc tccggtccag aacgatatcg cgcatattta    219300
     aaaggtcatc aattgaaccc taatcccgga cagcagatct tcctgaaagt gcttttgacc    219360
     cgaccaacat tcccttcttt aattcctagt taccccaact tacaacatga gtacttacct    219420
     tgtcaccggc gcctctcgtg gcattggact cgaattggtt cgtcagttgg ccgccaaaac    219480
     aagcgaaact gttcagacta tctccgctgc tgccaggact tctggaggcc ctctttttca    219540
     ggagctcttg caacagcacc cggatcgggt aatcttcgtg cctctggatg tcacagagaa    219600
     agagagtgtc aagaacgccg tgacacatgt tgcgactgcc ctcaatggaa aaggcctgga    219660
     tgtgctaatc aacaacgcgg gtgtaatgac gcctggcact gttgagaata tgtctgtatt    219720
     tacttgccct atacgtcccg cttggcttta agctgtccta gcaaagcagt gtgttctaat    219780
     actttcttta tagggacgat ttagaagata cactccgcgt caatgtggga ggggttcatc    219840
     ttgtcacaag agaattcctc ccccttctaa gaaacggaaa taagaaaaga atcgtcaata    219900
     tgtacatgat ccacccaaat tcttccgatg tcctactatt aacaatagct tcctattcag    219960
     ctcgacaagt gtaggctcta tccagttgca gccaacatat agagcgatgc ctacaccctc    220020
     ctacaaaatc tcgaaagctg cattgaacat gctcaccgta ctctactccc aagagttgga    220080
     ggctgagggt ttcaccgtat tctgtgtgag ccctggtgta agccgcccca tcttacctga    220140
     agtcatctcc attcaataga ccaatcgttg accaaaaaat agtggctgaa gaccgatatg    220200
     ggaagcgatg atgcggatct tccagtcgac actggcgttt ccgctgttct ggatgctgtt    220260
     ctcaccaccg gcaaagaaaa gaatggacga tttctcaata tcctcgtacc gggatgggaa    220320
     aataacccag gtatgaacca gtacgatggg aaggagttgc cgtggtaacc gatatatcac    220380
     tactggtacc ctgtgcgaca tccatgtcgc tgtcctctag tgtcaatgat gtgccggcat    220440
     ctcgattgga tactgcctag cagtttaaat ccggaggatt cactcctgaa gcagaccagg    220500
     atgggatcct gaaagtgcgt gttctgtgag taatctgtga gtgtcataaa gtgtacacag    220560
     accgttcacg tgctgctctc ataaaagcgg cgatatcata attggataag taaatggcaa    220620
     ttgcagcgaa acaatttgct tatgcactag tagtggcatg tatacatcct actaccctga    220680
     ttcacactag catcatccaa actactacta tgtaatcata ctactataga gcaagataat    220740
     aggggtctcg ctttgcgatc tcccttaata tcagttattg taaaggatag taagaaaata    220800
     tatcatctcc gtagtacgga acctggtgta gattctagat atacatgact ttcacaatat    220860
     gtgtataacg tcctggatga tctcttagta aaataataag tgtacagcta tctggatctt    220920
     atcttaatat gaatagatat ttaccaattg acaatctaca gcaagtagta atgaactcag    220980
     tcaaacagac aagaaattta ttaagaccag atagttatgt tcttttcatg taatatacgg    221040
     aatacttctt ccggatagtc tttcctcgga tataccttcc tcggatatga cactttcctc    221100
     ggatacactt tccgtgagta aagatttatt ataaatcata attggaacga cacgtaaaga    221160
     tctatagcta cagactttac atcgagataa ccatggctca gctgataaga atctagttgg    221220
     tacagctaaa agaaaagcgc cgacagctaa gccatgcaca agaaagttct acatttgtta    221280
     gattagatta gattagatta gacccgagag aacccagagt agtagtcaat ggggggctca    221340
     caaataatgt gaaaaaggga gcacaatggc aggagaccag actattatct aacatctagc    221400
     gacaaacgaa gcagttcagc atgcgataat ccaataaaac aagcataact gaaaatatga    221460
     atatcagagc caatcagaca agaatctaag tccctgatga tcaagccttc aggcctttta    221520
     gaattcgtat tatatatgcc aacaatgatg acctgtaagg aacagtatta gcggctctcc    221580
     cgactttgca tttatatctt tatgaattaa ttagctccat gatcgattcg agctaaaaca    221640
     tggccgtcca cccataagcc acccgataag atcctgcaca tagtggtcaa tgtcaaccac    221700
     ggcaaataaa tacgcagagg tatatactca atgcctccat ttttaaatat acaaggaata    221760
     aactagaata agctaaagga aacggacaat acaagggtga aaagctagac cattagtcta    221820
     accataagaa caaccaaatt caagctctct ctaacaccaa gaccaacaag aaaaagaaca    221880
     accgaaccag gcagtcacac acccacaaaa gtggtcttac tcccccacaa cccttggtca    221940
     acttgatttg tcaactttaa atccatccag ctccctcttg tcttactcag acatctccat    222000
     cttctctaat cctcacaatc ccaacaccaa agctgaagcg gggtatagca caccatatta    222060
     tacccttaaa attccaaata cgatctacta gatacatatg cacacacgga ccctcctgct    222120
     ttaatctccg attaatctcc gatgcagctg agctgaacag gtaactattc aatcacgatc    222180
     ataatctcag tattatagtc tagaccaatt actactatct agtgtagcgt agtgtagtgt    222240
     acagtgtaca cgatagtccg atgtctagac cttctcttgg aggtggggtg gaaatagaga    222300
     gaatctgtgc ccctctccca cacacccaca cacacccaca attggaaaat aaaactgaca    222360
     actaagtagg ccaggcccct ctttctagtc catgagaaac agagaaggag acacaataat    222420
     tcctcaacaa accacgtagt agaaataact acccctcgac cccctcatcc ctcatccact    222480
     gtcagatttt aatgacaccc gtacctgcat catatgcaag acgggcccgt agtttattac    222540
     tagtctacag cacggcagtc acccatctag ataggtcagg agttgccggc cagcttcagg    222600
     gatgagatat tatcagatga aaaatcaagg gatcaataat tatccatccg atggagcgcg    222660
     gacacgggct ctcatttcgg taggcccgag ccgtagtgac tgtgcgtgct gcactgaggg    222720
     agggatccct gcaggcggat gataatatta ctgtctatta agtaaaaatc atggatggat    222780
     acggagtacg cagtacgtag aagcgggact cgatggggac tgtataggat cggatcaggc    222840
     catactggca tcggagttag gcgtatgcga ggcatgagtg gagtcttgac ctaaaagtaa    222900
     ttgcagtgga gccaaagacc cactccgttt acggaaggaa ttggtgacac ttaatatcgg    222960
     atgggctgag atggccgcga aagacggtcg cgtgatggtt gtgtgtggta tatcatattc    223020
     gtgatgtgtg ttctgtatac tataggtaca tgactccagc ctcagaaaaa gtatacatag    223080
     gtagtaagtt atacatgttc attactcaat tcataaccag atgactttcc cttgttgcat    223140
     taaggggaat ggaagaaaga aaaggaaaga tagagagagc gtgagaccct agacggggtt    223200
     ctggtgttcg taaaatgtgt gttgctcctt ggagtcacgg gtgagtgagg tggaggagac    223260
     gtcgctacca ggcgacgtat agaccacacc agtgttcttc aagtcgacgt ggtgcgtcgg    223320
     ggttgcgacg cgcgtgtgat tcgacgtgac ctgggagttg ttgctatggc tgggtctccg    223380
     attctcggtc catgtctcca tctcaacagt gcgcaggacc tccatacgat ccaccgtggt    223440
     gtcgccctgg tagccatact ggcgatcttc gatcattttg gaagcacgag actgcttgga    223500
     cggcccagtg gaagaccacc ccttcaactc ccggttgccg aatgaggatc catagccacg    223560
     agcggacggg agaagatggg gtaagacaaa tccgataaga ggtctcagtg caggcgcaga    223620
     ggcacagatc taaatacaga gttagccgtg aaacgagcac atgttgtgag ggtcatcata    223680
     ccagtgccaa gttgatttcg atcgatccgg cgagcaggat aggccatgcc atccaggtag    223740
     tgtcatagga ggccatcata ctcttccaga catatactgt gcgcaccgta cccgccacgt    223800
     tgacgaagat acccagaccg aagatcgaaa tcacggccat ccgctgccgg gcaggtaact    223860
     tcaggttcca gatcaagggc atcgggacca gagtgcagag gaaatcggtg aagatgttga    223920
     caacactcgc agagaatacg gctgcgccat aattgacgca atgataagga tacattggct    223980
     ccaagtccca gtatgcatgg ataggcctga tagcagcaca attagtcaat gtccgcagtg    224040
     ggtcgaggga cggaggcact cacgagcact gaaagatgct gaccaacaga aagacaatgc    224100
     agcacaaggc cacaaagatg aaggagacaa tcacgacaat gttgtagacc ctgtacagtc    224160
     ccttactacc cgttccgatg aggcgcttgc agaaccacag aaccgaaagc ttggtgatag    224220
     aacaggatag agaaaatgta atctgaaagc cgaggttgta tttggtgacg acgggaagcc    224280
     aggacaaggg tacgtcccac acatgccggt tcgcacccca gcgctcagtt gccagagaag    224340
     taaccgcaca catgccgact gcgatagcct aggaagtgtt agacaggcca gtaaccccag    224400
     catagatgca tctttagacg tacaaaagcg atgacaatga agaagtcatc aagaccaggt    224460
     gtgcaagtta tcttgaaacg tgtgtaaaga cggaggacag tcacgacgaa tgcgatggaa    224520
     ataaggacga tgttcacgat attcacggca ggcccgcgag tcaccgggtc gacgtagttg    224580
     ggcgtgggcc atgtggccag aacctcggcc ggagggagaa gcatgctggc gaattataac    224640
     agtgatagta gcgaaagtaa taggatgtaa aatgttgaaa ggtcgtggca cttgttgtat    224700
     gttgccgtat tgttgtcgcg attgtcgaaa agtgtggtca accatcagca acccccagtc    224760
     gagcagtcga gagtcgcatt ggccatcgtc acaatcaaga tcaatctgaa gtgttgtcaa    224820
     aagcgaaggt agtcagccgt ggccgactga atatgcacga gggccaccta tgttgtcggc    224880
     actatcgccg aggggaacta gagagatgat ataccacgat ggcgagtccc cacccctggc    224940
     ctagacaagt tgcgacataa atggtccctt cgctaaccat ggactaggga gtttatttct    225000
     gtgtgtcatt ttgagtttaa tggatttgtt caatttcaga tccaatatcc cggccaagcg    225060
     ggaagttaac tcctccaatg agactggaag cggaccgacc tccaccgcag accattttat    225120
     ccaaccgatg gcaagaagga gtcgcagaac cgaggattgc cggggtacca agccagcaca    225180
     ggacaatgat aggcagatcc atcgacccgt cgttcacggt cttctccaca tgccaggggg    225240
     gcgatctgag cattttgagc catttgaatg ggcttgctgg gcggaaatgt caattgggat    225300
     tagggatcta aattggaccc ggaccagaaa gtcaaaccag ttagctcgtc tgaaatttgc    225360
     gggcaggggt gcactcctgg ttcagcactc actccattcg ggggaaagga tgtgcaaaac    225420
     ttaggttgtg acttcagcga ggagagatga gggtagttcg ggaatggggg caggacgact    225480
     gcagccgagg ccactgagga agcccatgga gggaattctg gtccttcaga cagcggacgt    225540
     gagagagaaa atcagttgga gcaaaggatg cgagatccac aatctaatta caggatggga    225600
     aaagttagcg tcgagcttcg agggggggtt gccattgacc tggcacgagc ggagagagta    225660
     agagtacgta ctaactatcc aggaggagca gcaggagcag gagtctgtca gaagctccag    225720
     gacaagggca ggctgaatga ggaaagacca ccaccagcag cggtgactcc accggaatcc    225780
     cacttacttg cggcacgcca atccattctg gtgtttagtc caaacgaact aaacaacaca    225840
     atgctactgt actccatatt ctagtgtact ccgttcggtc gtggatttga ctcccagcaa    225900
     gaactcgcgc gcgagccttt ccgctttcgg gtgagcgcca gattgccccg cacgcttttt    225960
     tccctcccaa aatactccca gaaagtcttc ccctcattcg gcccagatgg ctggtctctc    226020
     caattccaac cattagtgga atctcccaga aagcatcaga gtgccatggt ggcttgtcgt    226080
     gcaccctgaa tgatcttgat ggtaccagcc ctacggaaac tccttactat ggcgacatta    226140
     gcctaatcac tttactgtat gcaccccttg catggtgcat caccagcatc gccatctcgt    226200
     agaaggatgt cctgcatgac atggggaagg gctgcacttt gcatggccca cgagtcataa    226260
     gcgggcccaa ttcggtaatg atgcgagatg cggtgggcat ccttgaaaag aagaagaaaa    226320
     aaaagaaatt cacaccgaaa aatttctgta gaattctgaa gatagaccac accgttcaac    226380
     ctgcagactc caaaccacta ttgtctccca tgtccccata tcggtgtcgg ctctgtgtgc    226440
     gccagcgggc agcaacagcc cgagttggta tctgcacggt cctggctact cctgactaga    226500
     ctattgtgcg atgatcatcc aagttccttg ggtgattgat gtcatcgttc tgtagtcttc    226560
     atcgatccag cctacactgg ccaatactgc tcggattgcc gcttgttgcc cctcggagaa    226620
     cactgatcgg aactctaacc ggcaatgcag ttcgggcaaa caatcaactg ccgactttcc    226680
     gtttcaacat atctttgtcc atattcaact gctaatagcg aatagtttag attcctttcc    226740
     tttttcatac cttaccaaac cagcgagact aaaattttcc aattaagtaa tcgatcagag    226800
     aaggattgac tgctaccaat agtccgtgat aatctcccag ctgaaggtag gtacctctcg    226860
     ccaaagtagc ttttcctggg tgatcttccc gtaacgggac cgggattcca aaaagcatca    226920
     acaccaggcc gacctgctga tgatccttac cagccatggg tagtcctcaa ggcccccgtt    226980
     cgtgatggag tcaatacttt tgtcatcacg ttccagagcg gacccggttt tccggaaaat    227040
     gataggatcg acgagattcc ttgggcacga atccaggcaa cactgactgt ccctgtccca    227100
     tggttcagtc tcgatatttc ggaattaact cgcaacaagc aactaacttc aatatcgatg    227160
     aacatctttg atatttcccc tctctgtccc agacttttct tctagacccc tttctatccg    227220
     cggatatcct tcgatgcatt cttttgccca cgttcctgtc gctcgccgtt tggcggcggt    227280
     taaagtggtt cccagcccca taaataggac tagccgcaaa ctttaacgcg aatggtgccg    227340
     gctgtccagc gttgatcgcc gcctggcacg aagagtctgg ttcgacctga agatccttga    227400
     ggtcgcccga ctgccgtgaa aatcaaattg tgcgcatcgt ggctcgggga cagagatgat    227460
     aggagctgcg tttacatctg attccaatgg ctgctgcatc atgatcctga catgaaagat    227520
     gggtccgcgc tgcctccagg tttgaaaatg agtcttgcgg gctcagctcg ccagcggcac    227580
     acagctactg acatgattca gacgctcaat ggcccactgt tcatgaagca cccttttgtt    227640
     tcagctgcaa acctacacag tactcacacc tagactcact cttaaacaaa tcacaaagtc    227700
     tgtaaaataa tttccaaaac tccttcgaaa cctagcaccc tgccatgaac aagatgagac    227760
     aggacgaaac tacagaactg ttgacttggc tgcttcggac aagcttttcc aacatgatgg    227820
     ttacagggaa tggagatcag gatattgtta cagatccatc cgcccgtctt ccgcgaccga    227880
     ccagacatcc ggcaatctgc agtatcgttc ccagtaatct gctttggaga tctaagttcc    227940
     tccttacaac cgagagcaat aatccctcga tcccgatgtt cttgtctata caaacttcaa    228000
     caaaactctc tcaaacacca aatatcagcc ttcacaatcg aatctcgcca cattgaactt    228060
     actatcaaca ttgacagcct tgtcagtaga tcccgatgct ccgaacgagg ggtagattat    228120
     gtactcttgc ctattccggt ttttgaagga gcggttctca aaattgggtc ggagcctcaa    228180
     cggtatcccg tttctggacc cgaaccttat cgggataatg ggggatatag cctgtgccct    228240
     gccaagatgt caagaccctg attatttaac aaaggagcgc cgtcttctat agtgcctatt    228300
     acttatcacc cttactcatt ctagataatg ttgcttgctt attcgaactc tgcatatggc    228360
     cacgtgcggc cagtttgata tcgatcgacc gacactattc accatgccag ttcatggcag    228420
     gctgatgtgc ggatcttgtg tgacgtggct tgctgggatg cagggcaatt agcagagcta    228480
     ttgttcatga tgccgtggtt aaatttcggc tatatgattg tcatctagct ccttggatac    228540
     tacactacac ttatccctct tcagcctagt atcatgtcac tgcagtctct gggataaacc    228600
     atgagcatga agcaaatcat gactctccaa gcagcaagaa agcatgtttc aaggatctac    228660
     gaacacactc ccgactaatc tcaagcccat tcgctatctc gtgttcatat tcctatctcc    228720
     ctcaccccca ccaggctctt aagcttcctt tagctccttg attactatcc ccaacaacct    228780
     cctccacaaa cggaaaatgt agccacccac gaaacaactc ccatcctgcg atcttcagaa    228840
     gcagttacag attcccaaag attatccctc caaacaagca cacacttcct tgtatgagct    228900
     gaaacatacc aatatagcat gtgatacata tcacagaact gccaagctgg agctgtcgat    228960
     ctcaagctag gataagtttc tctgagtcct gagctcagga atgagatatt gtggagttgg    229020
     atcgacatat cagctcagct cagctgggaa gctcctgtcg gagatgtctg tggatagctt    229080
     agcttcggcg ataaggtgtc tcttcgagta ttaggtagga aatatagctc ctggtatgac    229140
     ggacatttgc cgaggggcga gaatgggtct ttttactacg ctttccttcg ttttggcgga    229200
     aggaatcttg tctgcatgga agactacatt gcttttgctt ttggagtacg atgtagctta    229260
     ccatttctcg gactactgct atagtacctt agtatttccc ctatttactc ggatatattg    229320
     aaacatactc gagctctaca tatataccac tctttcccag ttattaatgt cttgtctttc    229380
     acattcccct ctattttctc tggatcatcc caaattgatt ctagtagcta aggttcctac    229440
     cacattaaca tgttaccatc aactgcacct cagacaggaa agtcaatgga cactatatgc    229500
     agtaatgtta gcagcggatt tcacatatca ctagaatatg atgaattctg actcaacaag    229560
     cttgctcaac tcagtctgca cattatctct aataaaccgg ttaaaatata cacggcagtt    229620
     gattatgggg tataactcct actaactgtg gattatgata tagacccaac tgccactaag    229680
     caagtagcat atatattcta ctctgtttgg attattccct aacattgatt gattgactac    229740
     taggcatgcg cagcctcggg tgtataagag agagaagaag atacggaatg agaaggttaa    229800
     gataaatact agtagaagag aaagattcat ttccgacatt cttatgattg tataatgtta    229860
     ctatagtgtt tctgccaagt aggccaaaaa gatatatcga tggctacgga gcagacgggg    229920
     tgactcatat actatcttag taacatacga tatactagtg gcatccgggt gtttatacct    229980
     aggatcatgg tatggctaca attcatgata caccccagct tggtatctac cgtatcggct    230040
     gattcattga ctcaaatcca agtggttatt acactcggga catagtatat gccaaactag    230100
     cttggtactc tgggtgacat tcaaatattt tctgaatgtc ttcaccgact gcttgttata    230160
     tccagttgta gaggggctaa accttgtgtg gacctgtcga tctcggaaat acggacttgc    230220
     agatttacgg gattgcctcc tcacccacga atcaactgct tccgctaacg atcagcatca    230280
     gaatttgctc aattctagct ggacattgat acatcaatct gaccgaggca tcttggcgta    230340
     acctagtcac gccctatcac attggctgga tatagctagt taactagatg gaagaatgcg    230400
     gtgactaagc cggctgttaa gacacccgag ctcatcagga catttgtgat gtacaatgaa    230460
     attggcctcg gcttaaagat tcgcatggta cctgtggtga ttgaaaattg aaaaacggca    230520
     ggcaagaaac tgtcgagctt ggtgacacag gacttttctc tcattcactt caaccgcatc    230580
     actcattatg ttgcgacctc ttttttctcc cgcgcagcgt agcatagcta agaaacgacc    230640
     actatgttcg cctgcaaggg cacaatttct tttcagcact ttcgcaaatg ttatcgatgg    230700
     aaagacccgg gactcttcac aaattcacca gagcatcaat ccatcaaatt gccagaagct    230760
     ttgggatgtt ccaattgcgt cgagggatga tctccaggat gctattgcat ccgcgcagaa    230820
     ggcgtttacc acctggtcag ccgtatcagg gtctgatcgt cagggttcca tcgctcaact    230880
     gagggattct cttctgtcat gcaaagaaga tatagccgag ttgcttatga aagaagcagg    230940
     caaaccagta aggctatccc ctccagacac agtgacttgt tactcaaaca ccataccaga    231000
     ggatgcaagc gaccctcgaa gttgaccacg catgtgggtt tctggattac tttggtacgt    231060
     cagatcccta ctttaagcgg accactggtt aatacgtcgt ttatagcaaa tgtcaaactt    231120
     ccatccgaag aggttattca tgaagatgcc tctcttaagc taagcttgca atacatgccc    231180
     ctcggagtta ttggggcgat tgttccctgg aactttccat tggttcttgc catggccaag    231240
     gttgcagccg ccctcgccgc aggaaatacc gtgattgtca aaccgtctcc ctacaccccc    231300
     tacagtatcc tcaaggtggc cgaattagcc atcccgattc tgccccgagg tgtattccag    231360
     gccattaacg gtgatgacat gaccgggcca gaaatgaccc tgcaccccga catcaataaa    231420
     atcagtttca cgggatcaac cagagccggc aagcatatcc tggctgcaac aagcaacaca    231480
     ttaaaagaat gcactcttga attgggcggt aacgacccgg ctatcatctt cccagatgtc    231540
     gacattcaag ccgtagccca gcaagtcgcc ttgggtgctt tcttcaacag tggacagttc    231600
     tgtcttggca gcaagcgtct ttatatccat gaggcaatct acaatgactt tcgggatgcc    231660
     ctggttgacg ttgtgaggac atggaaagtg ggacccgttg acgaagatgt catgctaggt    231720
     cctattcaga atgaaatgca attcaatgtt gtcacagata tattcaagga ctgcaaggca    231780
     aaaggataca actttgcctt agagggcggc cccagcaacg gcccaggata tatcttccat    231840
     cctaccatcg tggaccgccc acctgatgga tcaagaatcg tcacggagga acctttcggt    231900
     acgtgagccc agttatccca agtcattttc atcattaact cagttgtgtt tatttacgca    231960
     ggtcctatcg tgcctctcct gtcatggagc gacgaatcag ggctcatctc aagagtcaac    232020
     gacactaaga ctggacttgg atgctcaatc tgggccaagg atgtggaagc aagcaagagg    232080
     cttgcgccaa agattcaatc tgggagtgtc tggctgaata gctttgctaa accccatcct    232140
     cagggttact tgtccggtcg caaggaaagt ggaattggtg gtgagtgggg aatgaagggc    232200
     ttgaagtcgt attgtgcgac tcagacaata cattactaca aataattagg cttctgcagg    232260
     acccaatata actaggccgc gacatccgct ttgttggatt gtattcttcc agtaataatc    232320
     ccgatttatt aatgtgatgg ttgtcgttgt aattacggtt gctattgaga atatatattc    232380
     actgaatgaa cattggtgaa gattctatgg aagaagtctt tatagatgaa ttaatatata    232440
     aaaaacacag aataattgtc ctagaagaat tacgtagtag tctaagcgaa tttccactct    232500
     aaatagtcca tctggctatg cacgttgtgg tatggattat aatgattgct atcggctatg    232560
     aaaagactat tttcgatatg caccgtttct tcaatgagga atcactacag taacttattt    232620
     ctttcacagg ggtaatagta atactgtagc agtaattcct gatacatata agtattattc    232680
     ttcgcacatt atactaattc gctcccatcc gactagaacg tggtgacttc ggacattgaa    232740
     tgtttattct agtctagtaa tcatgcaact cggccaggct cttgattaac gttaatgacc    232800
     gaaaactgga gttctatata taaacgtata atcgacacac acaacaatag acaataacca    232860
     caatagagca cacaaactga cgaattttat ttaaaaacac ttcaacacgc cactttacac    232920
     aacttgccca agcacagccc cgttaagcgg ctctagggta ttccaccggg tagagagatg    232980
     tcacggcgga agaaccgaag aagtcgatta ccgactgatg ctaacgctcc ccaccccccg    233040
     cttggtacca aaaatagatg taggtaatag gtatagcatt ctcaaccaga agtattggta    233100
     cggtccgtaa ctggtgctat ctatagattg gaaagttggg gttcggacgg gtcatgaagt    233160
     taagtatagc cggtccagct aagagaaaat ctcggttgaa gagtggcgga atggtcgggt    233220
     ggatgtggat gcgttgttga tgattttgga tctaaggttt agaattacta cgaagtattg    233280
     tgttggaaga ataatataga gatgaaatgc ccttgtttgg accaattgta gttgacaact    233340
     tgtgacgaat agttgggcga aggctatccg aggcatgggt catcaggtgc tttggtcttc    233400
     gcgcttagtc tttgtgattg cctgagcggg cagatggtaa aacattggag aagttggctg    233460
     cagaagtatt ccctgccaaa gtgtgacacg gcgtttttgg acctccgctg ttatcaatca    233520
     ttacgatcat ggtaagattc ggccgattca agttacgctt cctgcatggt ggtaatgaaa    233580
     cccggaatac gagcagtcaa gacttgctaa tgtcggtgtc atttctcata ggtcgacaca    233640
     aaatagctta gcaattagta cagtgtagcc tcggctgcgg cataacaact tgtgaatgtc    233700
     atagaacccc ttttgatcgg accctgaagc gttcgtggtt aatgatcggt aataaacacc    233760
     cctgaaatag cacacgatga gtcagtagcg cgtaattgat agattgactg attatcagaa    233820
     aagtctttga tcttcgatcc gtgaggcaat gcggtgtctc cgcgcggaaa gcgacagggg    233880
     tatcgggttg attgcacgga ttacgccgtt cctgcagcga ggcatacacc gtagtcagga    233940
     tcacgatcct gccgcaagac agtgccgtct cctggattta tccccgaggt gagtgggagt    234000
     ctgatgcaga tgagagccat catacattgg agagtgaatg agaaaatgac ctatctccag    234060
     aagcagagca tcacggacta aaagaccttt catatctccc gaacagtcca gggtggaaat    234120
     ttgattcttt gactgggttc gctttttgtt tcagcagcga tgccgagacg gagagaaatc    234180
     gactcgtgcg gtgccacgaa ggcctggccg cgaaggagag acgaatgaag acgtgggatt    234240
     aactggggcg gaagcagccg tctgacgttt tggcccgcgt ggcgcggcca aaccgcctga    234300
     aacagggggt ctggaccgca tccattattg gccagatgca cccagtgagc ggatcgccaa    234360
     gcgttcccgg cggtgggctc ttgctattgg ctcaccacgg ctcactgtat atccccatga    234420
     agaaaaaaat aagttaaaat agcagtcaat acgcagcacc agtggctgta caggtaccgg    234480
     tacacgcagc ataccatact ggcatacggg catacgggca taccgtttag agtgtatgct    234540
     agttacaacc atggcagcag cgcgctgaac tttgttttat ggatctgccc catgtccaat    234600
     gcgtggcagt tgttggtctg ggattaataa gttcaagtcg gcactagata ttagtagata    234660
     tccccgtcag tgaactcctg acgcaccgtc ctctccatcg atcttcattt ctcgggaatt    234720
     ttcaatcgtt gctatctacc ttcgttcatc acccgttcgt tcctctattc ccgggttgat    234780
     tcttcacgtt cgttcattcc cgaaggcagg cccttctttg ttcttttaat aatcccagag    234840
     accatcactc cctcttttcg aatcccaacc caccgtctaa ttttcgagtc ccaataatgg    234900
     gtgacgaagc aagccacgat aaccacctgg cacccgccgc ggaccatgat gtgcctgctg    234960
     gcgtcggagc aaatgaactc agagagcccc cacgaggacg cttgacgcct cgtccatctt    235020
     ttctggagaa cctcgccagt tccagagaaa aacagtttat gttgggaaga cgcaactcta    235080
     gcgaaatcga tcgatatttt gtatgtcaat atctggtcat ggattgggag ggaccgtttg    235140
     gactaacggg atgatgaata gcacggaccg cgagatcttg atcgacactc caaatggccc    235200
     atcttccttc gaatgcatgg cagtatcatg ccgaaaatga ttctgccact tacctttgtc    235260
     gcagcttggg ccaccgtcat tacctgcatc tccaagtttg tccacaacag taggtttgtc    235320
     ttgatcagat tgtgactgga cgctgaccct atcttcacca gtcggcatca acgatattct    235380
     tttgacagtt accggtttcg tggtcagttt ggcgctgtcc ttccgcagtt cgacagcata    235440
     tgagaggtat gtcttatcct ttacctacag ataaacagtt gttaatctcc atagatgggc    235500
     ggatggaaga aagtactggg cactcctcaa tcagacgtct cgcaacctcg cacgtaccat    235560
     ctgggtcaac acggcagaac gtgcaggaga ggagggcaag gaggatttgc tggccaaact    235620
     gtaagacgct tcatgtcctt gtcatcataa atcatactaa caagcgtagg acggccatga    235680
     atctcattct ggcatttgcc gtttccctca aacataaact gcgattcgaa cccgatgttg    235740
     gctacgacga tctagccggt ctggttgcac acctcgacac gtttgccaaa gaagcccacg    235800
     accgccaagt ggttcagccc ccaaaaaaga cgccatggaa gtcagtcggt gaatacctgg    235860
     gtgtttcctt tgccgagtcc aacccgagaa agcttgtcaa gcggtccaag aagcccttgg    235920
     gccatcttcc tcttgagatc ttgaaccatc tctccgcata cgtcgaccgg tgcatcgcca    235980
     acaatactct caacgtcagt ctccaccaag gacaagccag tatgtacctc atccccaata    236040
     acttttcgga atataccttc taattttcac agtcaccgct ctgtctaccc tgaacgaagt    236100
     cctcaccggc accgaacgcg tcctggatac tcctcttccc gccgcataca gcatctccat    236160
     cgcccagatt gcctggatct acgtcctcgt gctgcccttc cagctgtacg actttcttga    236220
     atgggtgacc attccggctt ccgtcggtga gtattcccat ccagtcaaca gaattctctg    236280
     gtctaataat ataacagttg ccgcctacat cattcttgga ctcgccttca tcggcagcga    236340
     aattgagaac cccttcggcc aagatgtcaa cgatctccct cttgatactt actgccgcca    236400
     gctcgccgtc gagcttgata tcatcaccgc catgcccccg cccaaactgg acgagttcgg    236460
     cacgcgcgag gacaacttcg tcctcttccc tctcagcaca tccggatacc ctgaatggaa    236520
     ggaccgctcg gtcgaagaga ttcgcgccgc tctgagggcg aaggtggtgg ccaattaccc    236580
     gtccgcagcg atgtcggatg cggcaacgat gataggaagt gtgcgaagca agcagtctgt    236640
     ttagtgtggt agagaggcga tgggttaaaa gttcaaaagc aaggataaga gggtagattg    236700
     ttttgattga tgttttgggt ggtgttcaac aagcatgaga gtctggtgtt ctgtttaaac    236760
     aaaaaagagg attatatcat gtgtatctat ggttggttgg gtcggtcatt cgttactata    236820
     cttgggttgg tctttcgatg tgaatatttt gggatctatt tgatagatca tactacttgc    236880
     ttaactgggt atatgcatag ctgctatatc gtacatgaat acaatgcgac cataatgtgg    236940
     aataccacca gcaccgcaac acaatccttg ccacacccgt ccccttcagc cactgccatc    237000
     ttcgcagaca gtgaccgtca gatacagtga gaccctttct ctaccaaaaa gcaaaacctc    237060
     tatacgcact ctagcccgat cgccgggacg gcactcccca ttagactgtg tccgcgacca    237120
     ttgagctata tactccatca tccagcaaca acccccacca aaccatatcg acagaaattc    237180
     tccatatcac ggaacaaaca cctccccccc acccccattt accagcgccc ccaaataatt    237240
     ccccttcgca cacaccctcc acgccacact gctcccccct gccgcatcac caccaccatt    237300
     tgtattcgta cccgtactcc ctccaatcca cgaactcagc gccgctacaa cagccgccgc    237360
     atcgtcgcgc ggtacgcgtg cccatactgt gcttcctgat ccccctgttt tccctccttc    237420
     ggtggatgac gacgacgacg gcggcggaga aaccttaaga atatcaaggg gtatagtagt    237480
     ccccattaac ccgaggaact gcgatagtgc ggcggagaga tatgttcggg ctgtgagggg    237540
     gtcgaggggt gatgtggagg tggaaggagg gttggttact ctattagtta agttagttag    237600
     agttctggtt aatgagtata caaggagaag ggtagggtag ggatagggga cgtacaattg    237660
     gagtttcagg tatgtccatg ttggtgtgcg cgaggtgaag tggatggttt tgggggagga    237720
     gtcggatgtg gtggtggtgg gagatttgcg ttttgatgtt gtggttgttg acattgtggg    237780
     tattattgta aggggtgtga agtgggtaga taggaggtga gttgaaggag gtaggtaggg    237840
     attgagttgg attgaattgg aggatatgcg atgcgatgcg atgcgatgcg atgcgggcgg    237900
     agattgttgt tgaacttggg aagaaaagaa aaatccccgt gatgtgatgt cacggccggc    237960
     ggtgcgcgat tgcgggagcg gtacaacaat cactgaatat gaaaatagat ataaagtagg    238020
     catttatttg cttaaccaat taattaattg aaatatattt acatatacag ttaaccaaaa    238080
     ccattatttt tgcattacag ccccctctaa tatcccccgc gcccttcgta aatactcatc    238140
     ttcgctctgc ttcccgataa ccagctccga aatagcaagt gtcttttctc gggactttaa    238200
     tccacggata acttctacgt tggatttggg gacttggaag atctggattt attattgtta    238260
     ttaaatattt caaataggat tgcagagaaa tctggtaatt cttgaatgag agatgggtgt    238320
     gctaacctgc gccaaaacac gcgacacggc tgcattcgcc tcgcccttcc taggcactgc    238380
     ggcgacgcat acatctaccc tgtcggttcc gatggcggtt atgccttccc ggttgcttga    238440
     ggcgtttggc ttcacgtggc aggatatttg gagggtgtag agagggttgt tgggccggga    238500
     tttggtggtc gcggtttgga ttaggcggag gaggggggat gtggacattg tgttggttta    238560
     gttagagaag gtatgatggc gtggatggaa ctatgttggg attgaagata ggcctcaatc    238620
     atgaagtgat agtggatagt tagagtagat gtaggttgtc tggtggatgt ggatgatgga    238680
     tgcgggttag aagtactata tctgggaccg attattggct gtgagatgcg ggatgtatat    238740
     ggctccgaat aggatcattt agtgcacaac taattactct acagtactca tgatactatg    238800
     ttgtgatatg cactgatagc catattattg taagcagatt atttattact atggtaggat    238860
     gggttactat tactatagtc tgcctgtaag aatggccact gtctatccta aggcatcaag    238920
     aaccgcggct gagcgatgag ttacagctac aatgcaataa cttcagttca tgcgggtcca    238980
     cactcagtgt tactccataa caataccaga gagtcaatgg tctgttcctt aacataccaa    239040
     gttgtgcctc gctgctggct gccgccctgc ttcaccaact tgctcacctc cagcctcttg    239100
     tgagggcatt aacagcgaac atcccagcct gcagtacaga acaaagacaa tccccatgtt    239160
     tagtcacaat acctcaccca gccgctatat tcaatatcca ttgagctatg aaagcaacaa    239220
     taggggccca cccaagaaca aaggtccatg tattgatacc tttgttacta cggggccccg    239280
     ggtttcaggg tggaccctat cactgaggca gatccagcct ccgggattct gattggtcga    239340
     gtcagatcta taaggctcag tgactgctat attgatggct ggtgtactga ggtacgctgt    239400
     catgaccaga gagaagtata gcgggggtag ctgtgatatt ggcgatggtt gcttaacgat    239460
     gctgattgtc aacttcagta gatattaagc tttgcgggat tgcgtatcca aagacaattg    239520
     gaatataggc atgattagat tcgttggata gagcggtagc cgctcaatct ctcatcttcg    239580
     gtagagatca aaacgatcgt cggagccgca gaaacggcta tccaaaggca tcatctagga    239640
     atcttcgaag agcgcacaag agtataccaa gtgaattcct ctcctccaaa tcgaacaatg    239700
     agattctgct catggaccat accctatgta gagctctatg ccagcccctc tattaattgt    239760
     atgttgataa atagacaatg gtccccccga acacagacgt ctctgtcgaa cgtcctcctc    239820
     ttgcgagatc ttcaagttca actgcttcat ctgcttcgtg aacagtctct ctgtggtttc    239880
     gtactcttcg tcgttcatat tccttcgtgg atagtagcaa tcgtcaactg agtgccagtt    239940
     tcaagcttca tttctctcat acaatctttc ggaaaggctt ctcttctcta aatcgtttcc    240000
     agtcgtgata atcgacatac ccatctcaag atggccatct tttcttccga aagcaccaac    240060
     gctttccaga acatgttgac ccaggactat gcaatgagtt agtatacatc cgcagtcggg    240120
     gtcaagaaac taacaataac cagtgcaagt ttctcatcaa gaatccattc aatcttccta    240180
     ccgtgaggcg tgccaagccc aagccgactc gggcgacttt acttctttcc atcctgatca    240240
     gcaagactgg tcatgggata agctgcccga catcctctat cagctcaagc ccaccggccc    240300
     taagagcaag attgagccgc cgactatgcc ctaccccatc aacggaaagt tcctgcgcga    240360
     catccccacc ttgcccgacc acattgcttc cgacgttgac gagttccgcg tggaagcctg    240420
     gatgcgcctg gatagacgga tccgcctcag cgatatcgtc gaccgcatga accctgagtt    240480
     ccgcattgcc cccaacgcac tgcagcagcg cggcggacgt ttcagacagg cgttcggtat    240540
     gttggcctgg gattcaggca ataagctgag tcgcgagctt gaatccaagt tgatgcagac    240600
     tttaatggag catggcattg atcctaacct taataccact cggggactta ctcccggcct    240660
     gatcattccg gccctgggtg aagctggcgg acggatccct ctcccaccta cctactcctt    240720
     ggagaagcgc aagaagcgga agcgctgtat gcgggctact ggacccaaga ggcccaggaa    240780
     gatgcccaaa gtccaagagc agatgcttgt cgatacagca aaagaagctc tgcgggtgtt    240840
     ccagaatgtc ggaccagcgc catctcagaa tggattcggc agcgaaattc ctaccacctc    240900
     tgagaccacc cagattatga tgcccggtga aagtgtgttc gccgttgaga tggccgctcc    240960
     cgccacgatt cccgtcccga ttacggccat tgttcctgac gtgaacgaat cgaaggtcga    241020
     cgaggactgg ccaatgtctg atgcggtcca ggtcaatgag cccgagcctc tatacaagct    241080
     tgttcccgcc gagcagcact tggatagaat gacggggcca ctgcccgtgt tccggggtga    241140
     ggtcccggac atggaattgc ctggggccgt atgccctatg gacctcgaca tgactctggg    241200
     tgctaagaac ccgtggagcg atgggtaccg ggtcctggag acggttggtc attggacaaa    241260
     gatcgagcca aagtcaacca atggcctaaa gccaggaaag actggcgatg aaacactctt    241320
     caacccatat gaagagatgt cactcccgac tcccatcaag gccaagggcc acaaagcgga    241380
     catcaaggca atgcagccaa ccggtgggct gttcttgatg aaacagcccc tggtcctgga    241440
     tgcattgccg agccctatcc aggtcgctct gttcaaccat tgcttccggg agttgaatgt    241500
     cggggagcgt tattttttca atctgccatt ctttggcccg tgaacaagct tcacaatatc    241560
     ggtcttgact tggagcggtt cgatctcatt gtatctgcgc ttggctaatc ctttcaaagt    241620
     caatctgtct atctatcttt cttttatttt cctgtcacat tttctttttc ttttttcttt    241680
     tctttttctt tctttcttgt ttctgtttcc tgtttcaatc cttaatatgg agttttctgg    241740
     tcttattcaa cagcgaagga gagagaggtt aagataaggt tgggcgccaa gatggttgcc    241800
     gcggttggtt tggctccatt tgaatcttta tttgttcttg tagtatttgt cgcgcgcaga    241860
     cggaaagacg tggtttatga aacgaatacc ctcgatgtac tgttacttga tgtttaggca    241920
     gtcagccaga taattgatac ctttcatgca aaacacgctt ccgatcggac tagcctcaca    241980
     actgcttcag atgacgctgt ctgacagctt cgatcacgga ggaaatgtga acctggaagc    242040
     ttcctgccga gtttaatatt attatagaga tgatcccacg tcagattcgc atcgtgtcac    242100
     ccatgtgata tatccaaaag gtctgagaga tcggcgggtt ccgcatacac gcctatatca    242160
     gactcgtgct aagtggattg cacgggtatc gccattactg agactattca tgcagaagag    242220
     agcccgcaga ttgcctcaaa ttgtccgtca gaccttctcc acttcgtctt cgtttccacc    242280
     tcatctctac ttttatactt attttgctga gtgaccagat tagtcatcct cttcttggtg    242340
     ggggtggtct ccgaccgcct tggctgccgg cagaaacagg cataatcatc atctccgcct    242400
     tattagtcgc gttgttctgg tagcgcctcg cttcgttttt gcgcgttgcc tgcgcgtgtc    242460
     tttgttttga gaaaactgct tatccagaga atatatcttt tttgctcatt ttttgttgct    242520
     gtctagttca gcgatcattt gtgtggctgg tgaagtgacc aagaaacgga catgccatat    242580
     ccgtcctgcc gttttgagat attctcaggc accggaaatg gtctttaaga gtgcttgagt    242640
     agtttggaat ttccaccacc gctgatatcc aaagccagcc tgactggccc attgaaatgg    242700
     agcctggcgg agaccctcta gattggacgg tcgatgaagt ggtgcaattc ctatgtcgaa    242760
     atccgcagac accatggtct cggtcatcat cgcgtgctcc aagaccggac cctatcacct    242820
     ttgaagctac gcttcgggag aatgaaatca ccggcgaggt gctgatgcat gatgtagaca    242880
     aagagacact acgggaggac cttggcgtga gagctcttgg ccatcgtagc tctatactca    242940
     tggcaatacg ctatatccag cgaaagtctc tcaagttcca ggaatccagg aatctaggca    243000
     ctttgtctga agaccacatc gactacgcga acccggttgt cccccgacta gtctccccag    243060
     tgtaccatcc gcctccatct cacaatttga caccacaacg agggcttcac gaaagtgccc    243120
     gtcttcagac ttcttcaccc aaggcctcgc cgcaagagcc ttccgggaat gtccccaaag    243180
     ctgattctga acgtagagct ggttctgtgg agcatcacaa gccaagcgag gctgcaagtc    243240
     gcccaggtat tttacagaga aatgagagaa acgcctggtc accttcagaa caaccacctg    243300
     aaagacgcat tcggcctggc gaagatttgg ttgtcgatgc ccatggcaag aaacgacgaa    243360
     agctaaatct tagtgccatg actcaggacg agactggccc tgatgtttca agacagacaa    243420
     acagacctaa aagtcccaca gagtggtacc tgggtccaga aaagctcaat gtttccagac    243480
     ttttctatac atctgacccg gactccgacc cagcagaaca tgaccagacc ttctcaatga    243540
     ccgcctccag acttccagtt ggccggcgca gattcgtgaa ccagaggctt atctatttcc    243600
     acaagcagcg gcccgtgaag ctaagctcca cgcagtcagc attggttcct tatcgagaat    243660
     tgaccaagca aaaaagtaag ccatcgaaga aggaagtagt cataggccat agcaacccaa    243720
     ggccttgcac cttgtatact gtgcataatg gcagagtcac agtcactaga gacgaactac    243780
     agaggtggcc gcaattagtt cagtcggagg aggccgatag cgggggcgca aaggaccatg    243840
     atccctttgc ctacctgtta caaaaatacc ccgcacaaaa tgatgatgat gatggccttg    243900
     atactcttcc cctctatgga gactcaggat cggagggtga gttcgatgat gacatatggc    243960
     aggaaattga ggatgaacgc cgggaaccat tgccacggca aacaaccctc acatctgctg    244020
     agattaaatc tatcattgca agttgcattt cagaatatga gaacaactgg ctgcaagatg    244080
     gaaggacaag agaggagcca aaggcacgaa gaatttggct atcttctagg agaggtaaaa    244140
     ccaccaatga acaaatcaag actatcaccc gcgacgttag tcttctagaa cggcgtctag    244200
     gtgtattcac aaaagcaata gaggaaagtg aatacgcatc acggaaagag ctacaattac    244260
     aatgccgaag tttggagaac accgtcatca acatccagaa gcaaaagtgg cttatatccg    244320
     ttcttgaact cgagcagtgt ccgccgaaga tggcttaccc tacgaggcct ttgcctccca    244380
     tacggcaaag cattgacgag gatggagagt cgcttggctc ggaaaccgat catggcgctg    244440
     ttgatgacga ctctcttgac gatttcattg aggatgacgt tttccgcaaa agccctaccc    244500
     cttcgtcgga cgacgatgat atcattagtc cttctggaaa aaggcgaaaa ttcaggacta    244560
     cagcacatcc tttcgttgag tccagttccc cctcccctcc gccacttcct gaaggaccaa    244620
     tagagactat tgacctgact ggcgatgatc cactgcctga agaggatgac tttaccgttg    244680
     agacgccccc attgaaccca gcgcgacaga cgccgcaatc tgaacacgtc ttgtcaagag    244740
     aaatctctcc tgcaccaaag cttcctccta aagtgtatgt cgagataccg aatgtcgtga    244800
     taccgaaaac cgagataccg acaccatcga aacaagatgg catcgcacag tcagttgcaa    244860
     gttccgcaag gcctcatcta gacagtttag aggacctgcc cgaaataaac gattttaaca    244920
     aactcaaggg aatcggttgg aggctcttgg aggagcgtta tgaccggtgc agactcctgg    244980
     caaagttgat agcatcactc gcagatgaag aacgacagag attgactagg atggttccga    245040
     catatgacat aaaaagcctg caaagcctca caaacactgc tttgaaaaga ctgtggaaaa    245100
     gcaaggaaac aatatcaggg ctgacacctg atgaggctag tttcgccatg cgcacggcat    245160
     cactctttat ttcatggata aattgcgctc attatcacgt gaagggcttc ccaaaaaccc    245220
     atgtttggga ggcaaaagaa cgtgtctcgg atttccccga gttttacaag gaactctcct    245280
     gccgcttgga tgcgtatcaa acctgggata taaaccggca acagaccgcc gcgactgttt    245340
     ctgactcacc ccacaagaaa aggaaacggg aagtgaagga aagtcaagct gcaaaaatga    245400
     atcaagaaat cgccaaactt cgtgttgctc atcaagagaa gttgcggcag aagcttgaac    245460
     gcaaactgga aagcatgggt gtcagcaata ccgatgccac tcgccaggct gtcagttttg    245520
     gcgatcctgt catctacttg gaccctcata tcggacagcg tgtcaagcct catcaattgc    245580
     atggcatcca atttatgtgg cgagagctga ctgaggatgg tggaaaacat cagggctgtc    245640
     tcctagctca tacaatgggc ttgggtaaaa cgatgcaggt catctccctc cttgttacaa    245700
     tagctaatgc ggctgcttct aagaaccctt ggataaagaa gcaaatccca gacaacctcc    245760
     ttcgatccca gaccctcatt ctttgcccgt cgtcactgat cgagaactgg tacgaagagt    245820
     tcattatgtg gacccctaag gattcagcca tcggacctgt gaacaaagtg accagctcgg    245880
     cttctctcgc ggaaaggctg aacactgtgg ctctttggaa tgatgaaggc ggagtacttc    245940
     ttatcagcta tgacatattt cggacatggg tctataataa agaaacaatc aggagaggca    246000
     agcctctctc ggaagaggag catgagaaca ttaagaagtg gcttctagaa ggagctaaca    246060
     tcattgttgc tgatgaagcc cataagatga agaacccagc ttctgcaatt actcttgcgg    246120
     ccatgcagtt ccgctctcag agccgcattg cattgactgg ctctcctctt gcgaacaacc    246180
     ttgtggatta ctttaccatg gtcaactgga ttgcgggagg ttatctagga gagttcacag    246240
     agttcaaggc taactttgta gagcctattg aggaaggtct gtacgtggat agcacatata    246300
     gcgagcggcg gcggtctctt gtgaagcttc aggtcctgaa caaaattctt gaaccaaaga    246360
     tcaaccgggc tgatatctct gtccttgagg gcagcttgcc tcccaaggtc gaattcgtca    246420
     ttactgttcc attaacggat gtgcaaaagt ctgcatacga tctatacgtg cagtcgattc    246480
     tagagggcag ccaagatttt agcaggatga agctactgtc ttggctagcc gttctgggtc    246540
     tgtgttgcaa tcacccagct tgtttcagag ataagcttct cagcagagcc agcgatgctc    246600
     agaagcttga tagaatgata gacggcgccg cgatcgaacc agcccctggt gacgagccta    246660
     tcacgcagct gggcctggac gttgagggtc tcgtttcaaa acaagagcag cttttctcta    246720
     ctgttcctga tatgagcgcc gcaacactgt catgtcgagc cgaaattctg aacaggatca    246780
     tcgcagagtc tgtccgggct ggagataaag tgcttgtgtt ttcacacagc atacctacgc    246840
     tcaactacgt cgagaatgat attctcaagg catttggttg gaaatattgc cgtctagatg    246900
     gaagcactcc aatggccagc cgacaagctg ctaccaagca gttcaatcaa ggctctgcag    246960
     aggatgtata cctaatttcc acccgtgctg gcggcctagg cctaaacatc ttcggtgcta    247020
     accgtgtcat cattttcgac ttcacattca atcccgtctg ggaggaacag gctgtcggac    247080
     gtgcctatcg cttaggtcaa aagaagcccg tcttcgtcta ccgattcatt gcaggcggaa    247140
     ctttcgaaga ggtcatgtac aacaaagccg tcttcaaaac ccagcttgct ttccgtgtcg    247200
     tcgacaaaaa aaacccaatt cgcctagcca ccaagtccct cggagagtat ctcttcccag    247260
     cgaagcaaac accgcagcaa gacgtcacag agtgtctcgg aaaggatcca gaagtcctag    247320
     acaagatcat ccgcgcagac gctcacgccg atgaaaacca aagactaatt cgaaagatca    247380
     aactcacaga gctgtttcaa aaggacgaca acgacaagtt gaccgaggat gagaaaaatg    247440
     ctgctcagca gcaactcgat gatgagcggc tcaagcggac tgattacgaa gcctaccaga    247500
     ggatgatcat tgaaaggcaa agaatggcct tagcacaggg caccgggcct tatggcacaa    247560
     ctccagcaat gcaccctggc caactgccgc ctcagctacc tccacagcct tttgcgcctc    247620
     agccacctgc acctgcaccc cagcttacca tcccagctag tgcacacaat gttggccctc    247680
     cggctctggc tccagacacg agcatcacgc aacaagctcc gcaaactccc gtagcgatcc    247740
     ctggcctgac cttgaccagt ccggaccagg ctcatgctct gagcactcct gtgacgccag    247800
     gaaacaacac taattccagt ctccttactc acaacacctc tgctacagct gcatcagcac    247860
     aaacttacaa cggcggtggc agcactaccg agggctcaag cgcgataaga gatcgatcag    247920
     agtcacctga atctttgcag gatcataata agccaagctg caggcctcag tgagaatacc    247980
     tctatttttt ctttgcacat catatcagtt ctttagccca aatcacagca gaagactacc    248040
     atcccgcttc atgtcgccgg tctactttct aaacttacct ccacattttc attccgtcaa    248100
     agctactttg tccttcccta ttttaccatt tccttattcc acagtacata ccttgcatcc    248160
     ccgtgaatac cctcttccaa cgaaagatga cacaagatac cttccattct tgctcctatt    248220
     tggcgttcct tcgagattgt attagcgaaa tgcacttctg ctgctacggc ggcggcaagc    248280
     tcactcttca ttttcttttt gttatctttg atctcacttc actctttgtg tctcgtacat    248340
     agaattaatg tgattgaaga atatgaatca tgatgctact agtagtaact ttaattagga    248400
     gtattgtctt tggttggtac tatggggtga tggttaagta gtagtggtag taatggatta    248460
     ttcgtaggag tggaaggtga gttcagaaaa gagttagtga tgagtccacg agtgagcgtg    248520
     agctaatgat gtgtgagatg tatctccatt caggttacgc ttctatcatg taaaaataga    248580
     gtagatggag atctgaagag gtagtaaaat cccgaaagaa atatagctca catagcactc    248640
     agtcttgaag aagcaggtaa gtaaattgca tgaagaaatc tacttcaaca acttctccaa    248700
     atctgccacc ctcgtcgctc tatcatccac ctttttcctc gtcgctgtct ccctgaacgc    248760
     ctcgagcatc aacttccgct tattctcctg aatagccagc acacgatcct caatactatc    248820
     ctccataaca agtctccaca cagtagtttc gcgtgtctga cccagccggt atacacgatc    248880
     gacagcttgg tcttcgatgg cgggagccca ccagctatcg cacaggatag cctggttagc    248940
     tgccacgagg ttcaagccaa cgctgcagac gctcaagcta gcgaggagga cagtgcatga    249000
     tggatcggtg gagaatcgca gggtggagtt atcacgactg atggaggaca ttttgccgtc    249060
     gatgcgggcg aagccgatgc cgtggcggaa aaggtggggt tcgatgaggt cgaggaagga    249120
     ggtccattgg ctgaagatga cggttttggt cccttgtgct tggccctttg ctgtgaggat    249180
     cttgatcaag gcttcgattt tgctgctggg attgtcgggg tcggcgtcga cagtgtcggt    249240
     gctttcgccc atttcgacgg cgggagagac cagggtggta gtgtcttgaa tttcggcgcg    249300
     gcacatggga catttatgtt ggcgttcgat gacttgttcg atgcaaggtc ggtcgaaggc    249360
     gtgtgcgcag gcggtgatta cgggctgttc gagattgtcg agacaaatgg ggcaggtgtc    249420
     ttggctttcg atgcggattt ggagcatctc ttggagggct ttgatgtttt cgggtgtaag    249480
     ggggacgact ttgttgttct cgaggaggtc ggcgagcttg tctagtcggt tcttgcagag    249540
     ggcccagtgg ttgcagactt gccggagacg gagaattact tcgagaaggt gggagtagtt    249600
     ggtgttagat ttgtctttga atttgaagtc caggagcatg cccttggcct cggatctgcg    249660
     gggtgtcagt taggatcaag gaagttggtc gggatacgta ctggaacatg tcgtatttct    249720
     cttgctcgtg ggtgtggaac ttgatgcgca ggatgcgtga agtgaggggc ggcaagcgca    249780
     agttcacaaa gttcatgtcc tttctgcgac gtaggcagat agtagtcatc agggcttgga    249840
     gtagcaggcg ggaatcaggg tctccggaca atagaggccg gatcaggaca ctgttgaaga    249900
     cggccaaatc ctcgaggcca ccggtgagtc tcaaaaagcg cacctgcgag tagaggtcct    249960
     tgagtgtgtt gacaatgggc gttcctgtaa gtgtccatcg tgagcccgcc ctcaggttgc    250020
     aagctgccag ggcacccttt gaccgtggat tgcggatggt atgcccttca tcaagaacga    250080
     cacgacgcca atggatggaa aagagaccct tcttaggagg tgccttggca ttcgggctgt    250140
     actccatggc cagtgcaccg tagctcgtaa caacgacatc atactggtca aggttgcttg    250200
     cttccttctt cccttgccca tggtatataa gcaccttcgg agctttgtcg ctatgagtat    250260
     gaacaagcgc ctggtttcgc caattgctca tcacaccaac cggggccacg atcagtgtgg    250320
     ttctggagga ctccggagtc ttgggctgag aattgaacct tattagggaa aggatctgaa    250380
     tagtctttcc caatcccata tcatcagcca gtataccacc gctcgcaaga ggcggagcct    250440
     gcgtcataga gtaattggta gcaatattgg tgtacttgtt accattcttc ttccagagct    250500
     gcacgacatc acccccatcg ccaggaagac tcggattctc cttagcaatc atccaagcaa    250560
     gcccctggcg ctgatacgga agaagttctg tcgccaaagc agccggagac tccgccatcg    250620
     gcatattttc caaatcggat tccttcatgc caaagtcctc cgcgacatgg ccgatatcgc    250680
     gtggattaaa agtgctgctc tggccaatga gttcctccag attctcacct tcaaccagcc    250740
     cttccccagt gaagagattc gaatagccca atgcattctc tccctggaac tgcttccctt    250800
     tgcccttggc aagcgatctc gccaacttcg ccgcctcctt ccttgccttc tcccgttcct    250860
     tctctagttt cttctcattg cgctcattct gcttgaaccc tccaagaggc aaattatcca    250920
     tttccatccg actctttagc gcctgtctcg cctccgtgtg actagtccca aacagcttga    250980
     gggaaattgg gcaatcaaaa gcgccaatca caccggtcaa aacaccatca acaacaagag    251040
     acctatcatc ctacaccaac cccagaaaac cacgtcaaac agagccccaa accaattcaa    251100
     actacacatt acaatctaag aaaatattac tcaccaaata cttcgccaac ttagccgcca    251160
     ccgtccgcgg aatatggcca atctgctgcc ccatgacatt atccacgcgg atagcattcg    251220
     aatcatacgg gttccccggg tcgcgcacaa tacgaacatg ctccccgatc gtagcatgtc    251280
     cgcgatagta ccgcacgccg acgatcttgg ctttcaggtc cccataatga atgtatgtgg    251340
     aagcatcatc gccagcatct tggcttcctt ggatgagatc tgttgcttgg gcgtcgtctt    251400
     cgtcctcgcc tgattggcta aggggcacga aggtcgtgtc ttggccgaag cgttggccat    251460
     tgatggtggt gcggggagtg ggatgatgtc gtgtgttgtt ggtggcttcg tcggtggtga    251520
     gatcgacctg ctcgaagccg cgcttccctg gggtgcgacc catgatgggg gatggtggtg    251580
     tagatggtga gatgaaggac gaaagttgat agatagaatc ggggatgtca ctgataagtt    251640
     tactcgataa gaaagcggag aaacgcgcta aatcgcggcc ccatgtgact tgggtggata    251700
     ctactccata cttaaaagtg acagttgttt caattcattt ctcgtagatg atattgagag    251760
     gaagatctat tctattctct gcatttacct cgttattctg cagcgtaagt cttagtgctg    251820
     atctaccatt ctatatacga gaacgctagc tatgcaacta accgcacact aatttaaatc    251880
     ccgatgccaa gagggtctga ggttcgacac ccacaataca tatacagaag cgactgttca    251940
     atctttgaaa gactcacgag tattcactcg gtcaacgtca tacggattcc cttcgtacac    252000
     agactctgcc ttcacagagc ccggtcgccg cgacccttgc gacgctatcg agtgggtccg    252060
     agcagtgtct tcggctgcca cggcagggag atcaccgagt cgcgacttct ccccgagcgt    252120
     agatgaagag gcctgaaccg gcgacacttc tgtctctttc tccgcagctt cttctttctc    252180
     cggctccggc tgacgattgt ctcgcgtgct ttgctccatc agcctcctca taaaggcatc    252240
     cgactgcgct gaatatttgc accgagttcg gatcgccggg ccatatttat aaaatagaaa    252300
     aggaaatggc acgcacgcga gcgccaggaa tgcgggaatg ctggaggccc agtgaacccc    252360
     caggttgtgg tacatgtagg tcgtgaagag cgggaagacg gcgccaaaga tcgagcgcag    252420
     aactgaattg gcggccagca ccgaggctgc gaagatggtg taggcatcaa taaggtagtt    252480
     cattaagctg aggaagacca gcaccattcc gaacccgaaa ggcacacagg ccgcgatact    252540
     cgccatgaag tggatcgaag ggtaattggt ccaagcgaac cagaagaggc ccaaggggat    252600
     catcaccgag gccatcagac atggagggag acgcgcttct ggaggtgcaa atcctttgtg    252660
     agcttcatca gtcctttcat accgcttatt atcccagatg ctgtacagga ctgctatgtt    252720
     catgcctacc atgaccccca ggaatgatag acccgagacg ccctggttcc aaccgcgtag    252780
     ctcctcgtac acaattggga atgctgcgaa catcatgtat aacgtcccat agataattgc    252840
     catgtatatg gataatagga agacgatcgg ctcgcggaac agaagaagcc acggccgcga    252900
     cagggctgtc ttgaagacgg tggaataggg caccttcccc ttctccgcct ccgtcttgct    252960
     tcgatgaatc tttcccgtca ccttggtcag cttctttgcg cgctgctgta acaacaccgg    253020
     ggcgtaggtc tccggcacca ccagactacc gatgatccag agaagaccgg aaaaagcagc    253080
     caagaagccc attacccact tccaccccgc gttcatcccc aggaagcctc cgcaaaccgg    253140
     gccgatggtt ggacccataa acggtgccgc tgcgaagata ctcatggcca acccccgctg    253200
     cttcgcggga aacagatccg ccaccactcc tccggcgttt gtcaagggcg acgatccgaa    253260
     cgcgcccgcg aagaagcgta ggacgataag ggtctcgatg ttcttggagc cggtgatgcc    253320
     ggcgttgaac gccgccagcc cacaatagct gacaaagaag aggtattgac ggccccagag    253380
     ctcgctcatg ggggcccaga gcagagggcc gatagcgaag cccagcacga agagcgaaat    253440
     gccgagcgtg gctacctcag tgcccacatg aaaactttcc attatttgct cgactcctcc    253500
     actgtacgct gacgagacca atgacacagc gaggtgtggc ccaagccacg gttatagtat    253560
     acagccattt gcgccaggcg gggaaattca tgggattgcg aggatcgtta ggaatccagg    253620
     tgacgaggta tgggtcgtct tccgtgccag agccctccca tggataatcg aggatttctt    253680
     gggtaagcac gccctggtcg agcagaaggc gccagtaaga aattcgggtg ggcatggccg    253740
     gctccccagc agcggggggg ttgtcaccag ccatacttgg tggttgtttt cgtttgcaag    253800
     gaaaatggcg cccagagcac ggtggacgaa ggacacagac cacagataaa aagaatcact    253860
     acccttaagc agggaagact cgagattatg tatcttgggg gccaactggg accaaccctg    253920
     tagtcatggc cactgactat tagtaccgga aagaagcaaa ctgacctgca aaatacaccg    253980
     ggggcgctag ccgttgagga ggattttgca gcctctaata acgagggagc tgacgataga    254040
     gcagctgatc ccagattgcg aaacccaata accgactccg atattgggct ccccatatgg    254100
     gctacgggag agcacgagcg cagtgcatct tccaatcatc atgcggaggt gagccccaga    254160
     taatggagag caccagattg agacgagcat gacaacattg aatgggccgg cgaattagtg    254220
     ggaagagcgg gttgtgtggg attcttgtgc ataagagctg gtcgcataaa agatactcat    254280
     ttcggcgatc gattcctggt tcggaggccc aaacatgggt ggttcaggca tgtggttggt    254340
     gggaatggca tcattgcaca aagatgcacg ctttgaatgc ataagacgga gttggaatac    254400
     gagaggaacc gaagccacgc ggggaggcgg ctttagccga ccgataaaca gatgaacggc    254460
     atttgtctga aggatgaaga gatccatcgt cctgccaatt cactatgctg atggactgaa    254520
     tcaacgggta gttgagtaca ctggctgatc atttcgctta tctgtgcatt gtgaattatg    254580
     aaggataata cggaacaacg agccatggga tggtgagatt aaaggagggt ccatgatctc    254640
     tcatttcttg tctctacccc agatagagag accctctttt acatttcgtt cggggtctcc    254700
     aacaactcca gacgctagat ccactcattc agtcatggat ccattgattc tctagctgaa    254760
     gtttagctgt tcgctcgacg gtttcaggat cggtttccct cccaagcaag gggatgctta    254820
     cttgctctca ttgaattatc acataaaacc gtgtcatgtt tgctaccaca ttgtgtggac    254880
     tcccccatgc attctttgta caacattcac agcgttaatg ctgtactaag aaaaacccat    254940
     catttctcag aatcttcacc atttcagcag cacgctgaga atctccaagc ttttatatta    255000
     aatatctctg cgtcggacac atcagtcagt gcctcccaac tgaaaattgg cacaccgcta    255060
     ttgcttgttc gaactggcga gatatactcc gaccgcaact ctaccaggga ttcaccggat    255120
     catgatgctg ttccagtttc agtaatgacg ccacaggcag ggtcgacact tggagttggc    255180
     tgatgataac caatttctga caggatcttc ctggcttcaa accccctgga caaacaacgt    255240
     gcggaatggt taccgaacca gcatctttcc gtgtcgaagc aaccgtcgca ctccaaaaac    255300
     gaaaataggc tcgaaactac gccgcagcta gttatacttt gaacaatgga tgccaggcct    255360
     ctatcgtcaa tcccgatcga tagttctgca gatcggatat gtaatatgcg agggcatttg    255420
     tgaccgtcaa caaatgaaca actcaaggga aaaagcgaat gcggccaggg ccggcccgta    255480
     ggtcagcgtg gcgatccctt gccttgacgc atcgcgatga cttcgtcgcc acccgatgga    255540
     gtatcctaat ttgaacctca tggttttctt atagactacc caaccttatc cttatagatt    255600
     cacttcgttt tattcgagtc ctccctccct ttcctattct tatcgttagg ccccaccatc    255660
     cttccgatgg ccgcctctca accgcctttt tcataccgcc gccttatcca cgacaatcag    255720
     gcccagttcg agtcccttgt tcaaaatggc gatgtaaagc ccgtgctctt atggcatctg    255780
     atgttacccc tcgtgctgtc cattctagcg ctccttgtcc cgcagcaaag aggtggccgc    255840
     tatgtccgtc ccctggtgct ggcgtgcgtc ataggcatca ccagcaatgt cctccaacat    255900
     cgacgcatgc tcacaggagg caatggctac atgggcggcc ttattcccgt ctggagcacc    255960
     atctggtccg cgacgattct tctcttccgc gatgttgagc gcgacttcaa acgcatcgag    256020
     cgccacccat tgtcatctac catgactatc tcaaacggcg atgccgccct caacggccat    256080
     gctaaagaat caaaatgcat ggtcactacc cacaacagca gcgccgaacc tgtctcatgg    256140
     caaccatatc cgcagacgct atcccaccgt ctcaactggg tcataagtgt agccaccagc    256200
     atgcgtgggc ctgaatggaa ctggcgcatc tccaccatgg gcgccttacc ggcctcagtc    256260
     caggcgcagc tcaacaactc ctcagagcat cacagcgaag aagaaaaagc aaccacaacc    256320
     acaaacacca acccagaacc tatcaccatg cgcactcgtc tccgtgccac actcaccctc    256380
     ttcatccaat cctacctcct cctcgacctg atcaagctcc tcatgatccg cgaccaatac    256440
     ttcatgggca gcgtatctcc tcctgcacct ccccccttcc ccttccacta tctaatcccc    256500
     tacccgatcc tcatccacat ctaccgctgt ctagtaacag gcaccggcgt cctcgccgcc    256560
     ctcaactacg tgacctgcct caaccccctc atcttcggcg gcctctccct cgccttcccc    256620
     aacgccgcca aatccctcac ctccgtcccc ctctccgctc cctacctcta ccccccagcc    256680
     ttcggcccct tcttcacctc catcctcgac cacagccttg ccggctgctg gagcctctgg    256740
     tggcaccagc tcttccgcta cggcttcatc tccgccgccc actggctcct ctctctcctt    256800
     ccctcccgtc tatcaacttc ccgctccgtc cgccgtgtac tcactgcctt cgtcgcattc    256860
     tctctcagcg gcttggttca tgcctccggc agctacgtcc agaaccgcga gacgtatccc    256920
     tttgcaggcc cgttccgctt ctttgttctc caggcggtgg gggttctcct tcagggtgtt    256980
     atttctccgc tgtggttatg gatgccgcgg ccggcgaggc gggcttgtaa tgccgtgttt    257040
     gcagtgactt ggctgttggg gtcggcggga tcgctggtag aagacttttc aaggggtgga    257100
     ttgtggttca cggagccgtt gccggtgagt ttgttaaggg gtttgggggt tggtgtggat    257160
     gatggggata aggggtggtg gtggtggagt gggaagtggt tcgggaggtg ggatggtggt    257220
     ggggggttct gggatagggg ggtgaggttt tattgatgtt tacttatatt tttggtattt    257280
     tgggactttt ggcgagttgg tgtatacact atttagtcta tatagattta ggatagatca    257340
     tagatggtga gagtaaatga tagatagtag agttggatct gtctgtgtct ggcgtcttat    257400
     cttatctgcg aacttataca tatagtgcag gtttgtgttg gattcaaatg aagcattgac    257460
     gatggcgttt gtttggatct actgccatgt tgagagagtc tttccaagat taatctattt    257520
     atgaactttt gaacaagcgc tagagctaga cttttgaggt ttatatcgta tatggtacat    257580
     gcatatgccc tctaactttt cgtttactcc tcatcctcgt cctcatcatc tgtgtccggg    257640
     tcgacattca gagagggcat ttcatcatcg ctctcatcct cagctgctcc cgccgcggcc    257700
     gaggcagatg gcttagcaat agaagactga gcgggctttg gcgtctgcac cggagccggc    257760
     ccggcgatgg acgacgtagg gacagagata gcagccgtgc cggtgaaagt cgccggagat    257820
     gctgcgtcca gaggcggctg ggtcaccgca gcagcagcct ttggttcgaa ccgggccttt    257880
     ttgctctgcg agccggggct actcgtcgtc gtcgtcgctg atgggacagc agatgatgcc    257940
     gccggctgct cgacttcatc ggcgtagctg cgtttgcttg gcggcgaggg aatatctttc    258000
     tccacgtcca tcatgtcatg gtgttggagg gtgggggtgg gagtgggctt aaggaacccg    258060
     gttgctgtag atgtgggaac ggcggtggct gcagcgtctt catcttcgtc ttcgtcgtct    258120
     tccatgggca cgtagccgtt ggttgtgggg ccgctcatca ccacaggcat gcgcgggcgg    258180
     atgaggcatt ccacttccgt ttcggcggga tagctgcgcg ccaggaaggg gagaatgctg    258240
     gtgccgacac cacggccttg catagctggg aatgggttga ggacgctggc gagcatagcg    258300
     ttcttgtccg aggtcaggat gagggtgcgg tcgacctcgg cgcgaagggc cggtgacatg    258360
     aactcggacg gtgtgtgcgt cagcgcggcg gcgaggagct cggaagcagc gcgtgtgagg    258420
     tcagggaagg acgaggagga gctggtctga cggacttgtt tcaggccggg gttcaggaag    258480
     gagtcggcgt tgacggtggc ttggctggac ttgttcttcg acttggggtc cggcttctca    258540
     gtggctgcgc cctggttgcc ggtgggaggc aggaggtcgt ggcagcattt gcggatcata    258600
     gaggcgaggg aggacacgct ctgcttggtc atggaggggc cgatgcgggt gagcagggcg    258660
     cagaccagat catacacggc ggtgcggaca tcccggctga attgctccgc acggaaaacc    258720
     cacagcgcct gctccaggat gttctgtgcc acggggatgg cgctggtttc gagagccttg    258780
     accaggtgaa gaaggagctt catgcacgcg atgtggatgc gagggagttc ggtgagcagc    258840
     tgctctcgct ccgcgcggcc aatctggggg ttggcttgga tgtcgctgcc accggaggga    258900
     tacaccacca tgttcagtcg agacgtcaga tccaggatcg ctccaaccgg aatagtcacg    258960
     gtagaagcag tagcggtgcc gacgaatcca gagagcatgc gcaagagcac aaccagccgg    259020
     ttgacaccgg aattcagacc ctgccagccc tcaagcccca aagcgtcagg gccgttgccc    259080
     acttcttggc tgtagttctg cggttgcgac atctgtcgta gcgacgggtc aacggactcc    259140
     cattgttcca caatggccct cagcacgtaa gacgacgccg cgtgaacaga ggtgatggtc    259200
     atgcgacaag cgctcttcca ttcatcgccg ccggtgttct tcggggcgca gttgtggagg    259260
     gagatgaata gctgctgagc gatttccaat acatgttccg ggaaagtggg cgacgtggat    259320
     ccgatgatga cctgaagaat actgtgaatc tgcgcggtga acggccggaa gatagtcggg    259380
     tgccttgcga tcagttcatt gacggcttgg agtacaactt cgacgaaggg agtattcggc    259440
     ttgagtctcc ggacgggttc agaagatggc ttgacggaga tcagattcaa ggcagaggta    259500
     atgaagcctg gcagagacgg agtggtgatc tcgcgaacga gggtcggata ctggtaggtc    259560
     aggtggaaga tgcgagttaa ggtgataatg cacattttct tcgtggaaac ggggtccgat    259620
     ttctattcgc agcagttcag tgagcatctg ccatgcagta ttgtcttcaa ttgagcatct    259680
     tacagccaaa atgctgatca atccgcgaac aaacggttcg ctcgagcgta gaatctccca    259740
     ctggccagcc tcgaccagcg ccttcacaag caccaccgcg gtccagcgac cttcgtacgt    259800
     gcggtcctgc agcaaactcc ccaagcgagt aatgagctta tgaatctgaa cggcattgtc    259860
     agagtccgtc ttgcccgact tttggctctg gggagttgac agcagctccc cgcaattgct    259920
     aatggaggat gcgaggcatg atgcgagatg cggtagttgc ttcacaggca cgttggtcaa    259980
     ccggtggttg acggcgtgga gggacataga catgtaggcc atcttcacga gggcagaatt    260040
     gcacaagcga ccgcggggaa gcgattgacg ggtctggcgc aagattgagt gatgctaaac    260100
     atccaaattt ctggaaattt ttggcttcga cgctcggacc acatgaagcc tcgggcaata    260160
     atacgagaca ttacgtacgt tacggcgggt ctccccttaa gatggtctcc gccgtcaacg    260220
     ggccatatta tcttgattct ctgctgcctc gagtgggcat tcgtccctgt tatggacgct    260280
     gcttctttct ctttcctccg attgtaatca ttgatccctc cgtctctgtc tgacctctct    260340
     caatcatgac tgtaagtggt ggcttctcat tcccccctgg gaacatctca atcgctacct    260400
     tgtgaagctt cccccctcaa tctgccacca catgccttcc gctgaccgag gcaccgatta    260460
     ccactcacgc agggtcgaga ctctgataag gggcatcgct atgttacggc cctggacaat    260520
     gcgcgttgcc agaataaatg ggaagaagtg ccagagttga ttcgaaaagt gaccaaacat    260580
     gctccgcaga gaacatgtaa tgccaacttg cctttccccg gaaatactgg cctgccagca    260640
     gatgaactaa tgaggatgcc acaggtctcc tcgaagtagc cagcgctgaa tatcagctgg    260700
     cctcacatct tcaaacgcat ccctccaccc cccgcccttc ctccgccgcc ggtcttcatg    260760
     acctgattcc gtcactttta tccaccgtca accgggcaga aggatcaaag caagaagttt    260820
     tccaggcgca ggtctgcttg ggatgggtac attggactgt caatgagcta ggcttggcgg    260880
     ctgctcggtt tcctcaggac tttgaagaag ccgtgagcga gctcgagcag gcaggggaag    260940
     agctctctcc atggaccaag acgtgtctcg tcaaggcatg ttatctcaag ggtgtgtatg    261000
     ctccaccgtg aagatgggat ttgcatctgc taatccatgc taggttcggc acagcgcatg    261060
     acctccgatc cagaaggcgc cctggagacc cttcattcgc ttacgccatg ggtgaacatt    261120
     caactccaat cctctaccaa cagcccacag tttctctact ggtctgagaa attattgggt    261180
     caaggtgcct cactggcgtg cgaggaagcc agcaaagacc ttgccgctgc taatgctcaa    261240
     acgatagcca cgacgctagg gttcttcaga ctgtgggcgt ctcatccttc agtcaagcag    261300
     atgactttac cccaaggcat gcttatggac agcactaccg agccggtttc gaaatcacca    261360
     acatggaagt cgtactacaa tttgctatca aggatcctgc aacagggcct gccgtattgc    261420
     cctcctgcaa atgggcctga acgcccgcag ctcgccagtg aaatccggcg cgttgagtcg    261480
     ctttgtgaag ctagcattct gcgcgaaaca aaattcccca cggctgactc gagcaacccg    261540
     gaagttgagg cttgggttga acaagtcatc cagaactggg aggtgctttg cggtgccggt    261600
     tggacagatg aagagcttgg ggagggtggc cagaatgctg tcggcaggaa cgttcttgat    261660
     gtaagttcca cgccgaggga ctgagagatg gaaagcaact tgctgatgac tatagatcct    261720
     ttaccgcgct gctaccaaga cataccattc acatctgatt ttgcggcgtc tgttccacgt    261780
     gcattgtgca ctcgcagact acgaccttgc tctgagggcg cttgactcat atatcgaaat    261840
     tgtcacgagt gccaaagagc gagcagcaaa aggggctgaa tcgggagatc tggagaatga    261900
     tggcatcctt ttgcgcaccg tgtcggaggg tgttacgatg ttgagttgct ttggttcgga    261960
     gaaagaggcc gagaaagcaa aggatctcac ttctctcctg aaggaatttt ccgagaagca    262020
     tgtgcaagat gatgaagagc aaggcataac tctcattgcg cctgaaactg cttcaacctg    262080
     ctcccaggcc gttgctccgt cggacatcgc tgcagcttac agaggaattg gtatcgggct    262140
     tgctaactgg gcttattgga ctcctgtgaa cgaggatcgc gacgacatcc gggcagaagc    262200
     gatcgactat ctggaaagaa gtctagcccc ggagcttgaa gacgatgcca actgctcctc    262260
     actatatacg ctggctgttc tattggcaga gaaccgtgat ctggacggtg ccattgatta    262320
     cgtcaaatcg gccctgacat ctgacgcaca gcataagaca ggtcaagccg attttgctcg    262380
     ggagagagat ctggtgcccc tgtggcatct gcttgctctt cttctcagcg cgaagcagga    262440
     cttcgacatt gccgagcgct cgtgtgaagc cgcatttgag cagttccctg caacggtgac    262500
     gtcactcgcc catagcgaca gacgacccca gaagcagaac cagactgctc aagaccagat    262560
     cgcgggcatc acccatgagc ttatcgataa gctacgagtc cgcgagaagg aacgtatcat    262620
     tgagaccagg atgacccagt tggcatttgt ggaacttgtc gagggtccgg gggctgctgt    262680
     caatcatagc gaccagctcc tcagtctgtt cgccacgctt ttccgctctc tgaacctgga    262740
     aggtagcgag aaggccaata ccaagaccga gaacgagcac cttgtacccc cgaaaagctc    262800
     tgctggaact gtgaagagcc tccgcggcag cttctttgga cgccacaagg gaccccgcgc    262860
     ccctgaccga agggcagaat tcggacagga gcccaagaca gacaattcag cctatacgga    262920
     ttcagcaccg gcgatacagg tcacagatgg ggagaagtcc gggcttaacg aggggacaga    262980
     ctcacgtcag gcccgtaaaa ggagcaatac tctgaggaag ggagatgatg cccataatgc    263040
     caactcaagc catgtcaacg gcgatagcgg gactcaggct gggcctgaag ccggcaaccc    263100
     tgtcccagac atggttggac tagctgtgtc ggacgcagcg gcccagccgc agagcgcaaa    263160
     gcagccactg ggacctatgg ctcacaatat gaagcacaac caaccacccg ctccagccgg    263220
     gcattccaag cagccaccgg agcaggatat ccgactacct acatcgtacg ccttcgactc    263280
     tcccaccagg gcagtgacca aggttccacc tactcaagcc caaaagcatg gcctgtgcat    263340
     cctcatcaag gtttggctac tcatcgctgg tctctatcgt cgagcctcgt ctttcgagga    263400
     cgcacatgag gcatgcgaag aggcagccaa gcaggtgacg cgcttcgaag ctcttgtggc    263460
     gtcacaagag acctctgcta gagcgtttag ggagcgcgga tggggtgtcc ctaagagcac    263520
     tgatgaacta tgggcagacg tctatgccga gcgcggtctc cagtccattg accagactcg    263580
     cccgcatgaa gctatggaac acttcgagac ggcgcttctc cattatgcgg accatccgaa    263640
     ggcaactatt ggtttatcaa atctgctact cgatgtttgg gaggagaaga tgcctttgca    263700
     gccaccaaag ccacgtcttg atgccggtgt gtcgacgcta tcgctgtctt cgagcgatca    263760
     aagcaaaccg tcatccgaag acaacgcgaa gcggtcaagt caagaagaaa agccgcaggc    263820
     taaaatcgtt ccggattcgg acgaagagcc ccgactcctg aaccgcatcg cggcccgcga    263880
     gcgtgccttt ggcctgctgt ccgggttgac caagcgtggc agtgcgtggg acaactccga    263940
     ggcgtggtat gcactttccc gcgcgtacga ggcggagaat cagatccaaa agctgaggga    264000
     tgtcctgtgg tggtgtatcg agctcgaaga tcggcgaccc atccgacact ggtccaatat    264060
     cggctctggt atatacgttc tctgattatt gtagctatat cgtcaaggga gctgttttgt    264120
     ggcatttgat ttggcatttg gttgctgtga tacctcggtg atatcctcat gtgcataatt    264180
     agactacgga ctactgtata gaattggcag gtcaatgggg atactaattg tgacaatcgc    264240
     gatggttcaa acggaaagta ggacatctta tttatttaca catcttcgaa catggtctga    264300
     tttctaggcc aacgctctac cgacgtctac cggggcgccg caacgggagt ccaggcggag    264360
     tacttggggc gggtactgta ctcgttagct tttggtattt agactagcaa tcgactagaa    264420
     aactcacgta gagtaggtct tgaaagcagc acggctgagg gtcaggttgg gcctgtgctc    264480
     aggcagctcc cagctgcgga caccggtctg catgatcttg tcggcagtgg ggggagcatc    264540
     caccatgtag gagatccaag cgtgcctagc aaagtcagca cgacgcatat ggcaatcaac    264600
     tgcgaagaat ctcaccagcc aggctcaagc tgcgaggggt cgtattcctt ttccttgtag    264660
     tcgacccagc gggtacggac tgcgcatggt cagcgacaat tatggaccca agatcagcat    264720
     cacccacgag gaagctcctc ctccatgttc tcgaagtact tgttgccgta acggtcaaca    264780
     ccgatcaagg taccggcctt ggtatcacct agaatcacat ggcgttagtc ttaactgcca    264840
     tgaccacctg ccaacagtct actcaccaat gtactattgc agcaaatagc acgtctcgtc    264900
     agtatccatt tcactcctcc acaagcttct cctttcccag catccgaaag catacctgca    264960
     tttggtggcc ataatcctgt gaggggatac agttagcaac tcatccgtga tgcctccgga    265020
     agaaccgtaa aagatctcac cttgatgcca atccgtctca gattgcgcag cgtcctaaga    265080
     atggtcgaca tcttgtgtgc agagcagcga aaggggcagc aatggctgga actgagaaca    265140
     ggtcgggttc gacttcgact cttgcgtcgc tcgctttccg cccggaggtc gaagccgtcc    265200
     cgatccggtc tagcgcgggt cgctgtttgt cgggtttgca gcatccgctc gtccatcgat    265260
     tcaatatttc tacacttcca ccattactct ggcaatcgca ctttattccc tgagggtctg    265320
     tcgcttcttc gaggttatct agggagggat catgttcgga cgaattgggg gtaataccct    265380
     gcgatgtgct gcacgcagac cagctgcccg aagagtccta ctatacgagc gcaaattctc    265440
     ggccaacact tgccatgcca gttccagctc gcctgcgacc tcagctgtgt cgccgttagg    265500
     gagcatcacg accgagttgg atcgcatttc gccgtgcttc gaggtgccgg cgtcgcggat    265560
     tacaatcttg aactccccgg ctagcttcta caacacgctc aaggtacggg gatatctcgg    265620
     actttaaccg tcgtggattg cggctaattc gagcatgtgc cattctacag gacaaaatca    265680
     agaaggctcg caaacgtatc tacctctcaa cgttgtacat cggcaagacg gagcatgacc    265740
     tgatcgagac gttggaccac gctctcgcgg ccaaccccga gctcaaggtc tccatcctca    265800
     cggacgctct acgaggaacg cgcgaaacgc ccaacccttc atgtgcgtcg ctattggctt    265860
     ctctggttga gaaacacggt gcggatagag tggaaatccg catgttccac accccgaatt    265920
     tgaccgggtt gaagaagaaa tgggtgcctc gtcggatcaa cgagggctgg ggtctccagc    265980
     acatgaagct atacggcttt gacgaggaaa tcattctgtc agggtatgtt cgatgctccg    266040
     gcgatactac atggacgcta acagaacccc agagcaaatc tctccagcga ctacttcacg    266100
     aaccgcctgg accgatacca cgtcttccac tccaaggagc tgaccgacta ctacgccggc    266160
     atccacaatg cagtatgcag tctcagcttc caagtcctcc ccgactctca aaacgccgca    266220
     ggctacctcc tcaactggcc cgcatctaac ggtgcgcctt cacctctcga cgatccggag    266280
     gacttcatca cctattcatc caccgtcctg agccctctca tccagccctc actgaagcaa    266340
     tccactctgt cccccaaatc ccccgaccaa acctacatct accccgtcgc tcaatttacc    266400
     tccctcttca aatccaacga cacctcgacc gaattccccg ccgtcaccac catcctccgt    266460
     ctcttgtcca cctcgcccgc cttctccggc gcccgctggc tcttcacagc cggctacttc    266520
     aacatccacc ctgtcctctc ctctctcctt atcgccagca cctccacctc ccacaccgac    266580
     tccaccaccc gaggcaccgt cctaaccgcc tccccctggg ccaacggctt ctacggctct    266640
     cccggtatct ctggcatgct gccggcagca tacacgcacc tgtccgcgcg gtttcttgat    266700
     cgcgtcgccg acgcccagcg caccaactcc atccagctga aagaatggcg ccgcggcact    266760
     gtcggcgagc ccggtggctg gacttaccat gctaagggcc tctggattac cctccccaag    266820
     gaggaacatc ccagtctgac cttcgtgggt agcagtaact acacgaagcg cagctatagt    266880
     ctggatctgg aggtgggagc gctcgttgtc acgggcgatg cagagctgaa gcgtcagttg    266940
     ggcgccgaga cggagcggct gcaggaggat gcgaaggcca tttcacgaga ggatttgagg    267000
     aggacggaga ggagggttag ttggagggta aggttggcga tgtggattgt tgagaaggtg    267060
     ggaggggcgt tatagtatag gtacctatat gggttatgtg tgatgcgatg tatttgatag    267120
     atagatagta taccccgtgt attatatcga atgtacagta tgggatagag tctacatcta    267180
     caccgggtaa ttcaagagta atgatcaagt agtgtgaacc cgaaactttt atatgataaa    267240
     atagtagtgg tctatcacca ggcaagcaat gcaatcatct cacacacaca tgcacaccgt    267300
     aacgccaatc ccgcattttt attcccacca aatgatagat aaattggtat cgttgcaatc    267360
     attcaagcat acccatcact cacattccac tcactcactc actcaggtga ggaatatcca    267420
     ctacgccctg cccgacacct tcccagtaac cctagcaggg cccaatccct gccgaacctc    267480
     atccagcatg cgaatgccaa tcgcctcatt accgttcttt ccgcgcttcg cctttgcgcc    267540
     cttccgctta gcctgggaac tcgtcttgtc atcccaccca gcaaggaaat catccatgat    267600
     gttgttgaag ttgtgggaag gacgaacggc atcaccgttc gcgtcaacga gactcggtgc    267660
     ctgagacgag gcagtcgaaa tgcccgagac accagtcata ccggtcatac cggtcattcc    267720
     actgaccatg gacatgttgt cgtcgaactc atcctcctcg tcgagggagt agagggcttc    267780
     gacgcgctcg aagcggtcgt cgaggagacg gtggccttct gtacgggcga gggaggacga    267840
     agtcatggag taggcggagg ggttggtgag ggcgcccttg cgcttcttgc ggcggatggg    267900
     ggtgcctccg acggtgaaca cggtcgaggc gagggtgctg ccctgatggg aggggacgac    267960
     gctgggagga ccggcgggga cgccggctgt tttgccagac ttggcgtcct tcttgaactt    268020
     ggcgaattcg cgcatccagc cttggtcttc ggggtgcatg tcgggcgcgg gctcgttgtg    268080
     ttcgggaagc tcgccgggct tatcctcctg ctctgaggct tggtagcggg cctttgcggc    268140
     cgtggtgtcc atctgcacgg gggccttttc tgtcgcatcg gattcccatc catcgtcttc    268200
     ttcctcgaca tcgtcgaaga tggtatcctc ccaatcaccc tggtccattt cctctgcccg    268260
     cgtagtcaac tggccgaaga cgtcctcctc gtcatcttca tccacgtact cctcgtcctc    268320
     cagcgcctcc aaggcttcgc gcaaccgcgg gtccatatcc ggctggaaac ccgcaatagc    268380
     atcgggcacg ttctgctggt cctggtaggt gggtttgcgc acgtaggaag acgccgtcga    268440
     gcgcatgtca tagctgtaga cgctttcggt gccaccaaac tcgcttcgcc catcatccag    268500
     cgatacctgt ttcaaagcat cctccagctt caatcctttg cccttgtcct tgcccttcgt    268560
     cttggcttcg acgaagtaag cgtcgccggc gccggtgccc agctcgcgca agtgctgcat    268620
     gtagtcgtat tgcgagtcat cgtagaaaat gccgtagttg gcggcttcac cttcgttttt    268680
     gcgcgcggca tcgccgaagg tttgattcag ctcggcgaga ctttggccgc ggtgcttgga    268740
     ggcggaggaa gattcactgg gggtgatggg aggaccgtag acagggtgca ggacgcggtc    268800
     gtcagcagag ggatcgtgaa tgagagggtc atgttgggaa cggtggaaga gttggtaggt    268860
     agttgcggtt ttcttgtcgc tgagagtggg ttagttgggt acatagattt gagtaggtga    268920
     atgtggaggg gcaacctaca tccactgctt ccggggaggc attttgggcg gtaaccggtt    268980
     atccgggaga gatactcagg gagaaaagtg agaagggagg ggatatagtt gtgatggtga    269040
     gaatgaagct caaagatgaa gattaaatgt tggactgaat ttcggcagaa aaatcgcggt    269100
     cgtgggatgg tcacgtgccg cttatcgcga aaggtcctca ccaccaccac tgctgatatt    269160
     attggatttc attgtatcga gagggtttat aattttattt acttccttct atatcacttt    269220
     tatatctcct cattccttgt agtttgcctg aatgactgca agaaagtgct gagtcagcct    269280
     tatcttatcc gcgcggggtt caacgaaaat tgcccgattg ggtttttatc aaacctttct    269340
     taataatctt cttttctctt cttctcttct tcatcttcca ccatccctgg tgtctcttcc    269400
     tctcattacc ccccaggtac agagacaacc gtcaccatgg tgctcgccaa atccaagaac    269460
     tccgtcgggc tgggcaacag cctgatgaac gaccgtttcg gcaaaggcaa ggcctcctcc    269520
     atgaaaaagg cctcgcacaa tgccggcatt gcccgcaaga acgaaaaggg cgagacctac    269580
     atcaccaacg ctcccaccga agctgcttgg gtgaagatgc gcagtattac cgagcaggct    269640
     gccctcgatg agttcctcag taccgccgaa ctggccggca ccgatttcac cgccgagaag    269700
     atgaacaacg tcaagatcat ccacaccgac cagaagaacc cctacctgct gtccgctgcc    269760
     gaagagaagt ccgccgtgaa gaagcacaag cagaacaaga accgtctgac cgttccccgt    269820
     cggcccaagt gggaccagtc caccacccgt cagcaactgg agctgatgga gcgcgagagt    269880
     ttcctgaatt ggcgtcgtgg cctggccgag ttgcaggaga accaggatct gttgatgact    269940
     cctttcgagc gcaacttgga ggtctggcgc cagctgtggc gtgttattga acgttccgat    270000
     ttggtagtcc agattgtcga tgcccgtaac ccgctgctct accgctctga ggatttggaa    270060
     agctacgtca aggagatcga ccccaagaag caaaacctgc tgcttgtcaa caaggccgac    270120
     atgctgactg aggcccaacg tgccatgtgg gctgaccact ttgagcgcca gaacatcagc    270180
     ttccgtttct tctccgccca tctggccaag gagcgcaacg aacgcctcca gcagggtctc    270240
     gattcggagg acgaaagcga agaggacatt cctgaggagg agcagtcggc tgagggtgcc    270300
     aagtctctgg acattaagga cggcgaagag cctcaagaag agcacgacgg tggtcttgaa    270360
     ctcaacccca gcgccagctc cagctcttcc cgacgcacag agattcttga tgtcgaagaa    270420
     ctggaagagc tcttcctttc caataccccc gaaactcttc ccgacaacga ctcgcccgag    270480
     gggccggtca agaagaagac gaccatcggt ctggtcggat accccaacgt cggtaaatcc    270540
     agcacgatca acgccctgct cggtgccaag aaggtctccg tttccgccac ccccggtaag    270600
     accaagcact tccagactct ttacctgtct cccgagatca tgctttgcga ttgtcccggt    270660
     ctcgtcttcc ccaactttgc caccaccaag gctgagctgg tcgtcaacgg tgtgctcccc    270720
     atcgaccagc agcgcgagtt taccggcccg gccgccctcg tcgcccaacg cattcccaag    270780
     cactttgtcg agaacgtcta cggcgtgaag atcaacaccc gccccatcga agaaggagga    270840
     actggcatcc ccacttccca cgaacttctt cgcgcctatg cccgcgcccg tggcttcgcc    270900
     accaccggcc agggtcagcc cgacgagtcg cgcgcggctc gttacatcct caaggactac    270960
     gtcaacggca agctcctctt ctgccacccg ccgcccacgc ccgaaggctc cgaccccatt    271020
     gaccctattg aattcaacaa agacctctac gacatggccc acctgccggc ccggcgacaa    271080
     gcgcaactcg ccaaaatgct ccagaacgag gaggtcacag acccggaact gctcgctctc    271140
     ctcaagccgg tcgagaaggg tgcgcgatcc cgcaacctcg actcgggttt cttcggcccc    271200
     ggcgccaaga cctctaccgg ccgtctcacc cttcctttca atgcccagta cacggagcag    271260
     ggccaggaga tgcgcaagca gctgacaggt cgtaaggagc gcatgatggt tgctttggag    271320
     cgcggagtcg atgtatcgga ggtgaagagc ggttcgtcga agaagcattt caaggcgaat    271380
     aagcggcggg ctaagaaggt gcgcaagaat gcggcggatg aggattatta gcagctgctc    271440
     gcgggcgagt ctatatccag gttttctatt tttttgttcg tttgataagg tttggatggg    271500
     gaaagtttag gttgcattac acgatgacta tgggattagt tatggcgtac ttaaacttga    271560
     tttagtacgt ggacagggag ggatagaggc aaggagggag atgatgacgt ttcgtatatc    271620
     catttatgtt atttagagca gtcctatatc gggacggtgc atgatgaata tgattcatga    271680
     gattttgcat gcaaatcaac atactatcct ataccaccct cacccacatc atccacccat    271740
     aaaatcaaga acttcttaca accgactcct tccaccagca gtaacaccca acaacttctc    271800
     cgtctcctcc gcctgccact tcaacttcct cctcacctcc tccttccgac tcttattctc    271860
     cctcctgccc atctgcaaca aatgcacctc atcgggccca tccgcaatcc tcaacgtccg    271920
     cacccaagcc cacatatacg ccaacggcgt atcctgacac acgcccatag cgccatacgc    271980
     ctgcaccgca cgatcaataa ccccgcacgc catactcggc accatgacct tcgcctgcgc    272040
     aatctccttc aacgcactct tcgcatcccc ttgatcgatc ttaatcgccg cgttcaacac    272100
     aatcaaccgc gcagcatcaa tctcaatccg tgacttggct acccactcca gaatcacgcc    272160
     gtgcgaggag aggctctgtc cgaagggctt cttgcgttcg tcgttgatgc gcgcaatcat    272220
     ccattcgagg gccttttcgg ccgctccgat ggtgcgcatg gcgtggtgga tgcggccggg    272280
     gccgagtcgg ccttggatga tttcgaagcc gcggccttcg ccgaggacga tgttggagac    272340
     gggcacgcgc acgttcttga atgtgatgtg gccgtggccg tgcggcgcgt cgtcgtaccc    272400
     gtagacggta agcatgcggt ggacggtgat gccgggggtg ttgtgtgctg ggacgaggat    272460
     cacggattgt tgcttgtagg ggtctgggtt cgtggggtct gtcttgccca ttaccaggta    272520
     gatggcgcag cgggggtctc cagcgccgga ggaccaccat ttctatacca gcattagtat    272580
     atatatatca tgtatactcg gagagtatat agtaatgcag agaaggtaag aagtgaaaga    272640
     gagggggaga gtgagacata cagatccatt caaaacccac tcatcgccct ccctcttaat    272700
     atccaactga atattagtag catcactgct cgcgacctcc ggctccgtca tgaggaaggc    272760
     agaccggatc ttgccctcaa gcagtggctc caaccactgc tttttctgct gctcgttgcc    272820
     gtacttcgcc aggacttcca tgttgcctgt gtccggggcg gcgttgttcg tcgcctctga    272880
     tgcaatcgtg ctcttgccca ggtactctgc catcagtccg tactcgaggt tgctgaaccc    272940
     ggctccctgc gcgaagtggt tcttgggcag gaacatgttc cagagacctt gttcgcgcgc    273000
     cttctgtttc aaggtctcca tgatggctgg gtaggtcgac cagcgttggg agccggtgcc    273060
     cagttgggcg cggaagatgg cttcagaggg gatacattct ttttcgacga attgttcgac    273120
     ctatacatta ttaatattgt gtttggttgg gggtggtgaa tggggggtgt gggggatgta    273180
     gctgtgggaa ggaggtatgg ggaggtaata cttggtcaag ggtacgcttg gcccggtcgc    273240
     tgacgaaggg ttgagcgatg acggggatgc gggtggaggc tgacatgata gactactgtg    273300
     gatactagaa ttaattgatt ggaagtatga tgatatgatt aaaagagaaa atggatgtga    273360
     aatagggagg atggggttat aagctgagga agtaatgcgg agtatcgagg ttgcggagaa    273420
     gcagccgacc gaacctcggc tgatcggccg atgagtcagc aacagcacat tcacgcattg    273480
     cattcattaa ccatccatag ttatcaatat gaagaagtta tcaatcaagt gattgatgtg    273540
     acaatagagc agtaagaagt aaaggcgtaa gaaaagaaaa agaaaagcat aaagcatggc    273600
     cgaatcccat atcgagccct gattttctca taaacccaat caatccaaac cgaaccaaca    273660
     aacaccacaa ccgacccaga gcaaaccaat gcaaattaag aaaaacaaca gaagcaatca    273720
     atcaccccgg ttactggatc atcaacaatc ggagtactgc gaccggcgca aacaccgaaa    273780
     gatgtatcct tttccacccg gagacgatct aatcaatcat gcctcggtgt tttctttctg    273840
     ggccgacgac tgctgttcga aattcttctt gccgagcttg gcgaagaggg actggggttt    273900
     gccggcacta cacacaccac aacattagca tcaattaaat tcacattgta tacaaggagg    273960
     taggggcata cttcttaaac cgcttgccct tcaaatcact caacttcttg gagcacggac    274020
     tcatgatatc atccgaggga gagacgtagc ttgcttggtt cctttacaac agtcaatatc    274080
     cgtacacaca tacacatcta cagggagatg gtggtactca cttatcgcca ttctccaact    274140
     ttccctgcag cacctgacga tgatattcca tcgagttgat cttggcgggg gcggccttga    274200
     gctcgttcaa cttgtccgtg tcttggacga ggtgggtgtt ggtgcggtcg gtgagggggt    274260
     gggagtccat tttgatttat ttcttttggt ttcagaagac ttttctgatg agagaggtat    274320
     ttgatgtttt tgagactgga gagactgaga ggtagtagta gacttgcagt gtggaggaaa    274380
     gtcagtggaa ggcagtggga gggaagagga taagaatcga aggcaagaaa aacccgtcga    274440
     ttgttgtcat ggcaaccacc accattacca ctgcccgaag atgtcattca ttcattgccc    274500
     attacctgaa ttaaccaccg aaggtatcta actaagaaaa tgtccattca ataatcactg    274560
     ttaatggtca tgggtatata catcatctca tcatgtcgcg tagctgtact ccgtactcct    274620
     ctacaatatg tgtacataca aacatacata ttccctgcat ctctcctgca ctctatccgg    274680
     ttgtcaccag ctgctgccgt gaccagcagc aatacattta cacttccccc aggaatgaca    274740
     gccggctagc cactcagcca gataagctcg tctgcagctg ttggcctgga aacacgcggc    274800
     cgagtcatcg ccaccgcgct gaatcctgca gccagactgc aacctggtct gtcatgtcgg    274860
     gttccacatg ccacgaccat cccccatcac tactaggcct cggtcaccgc ggcattccgt    274920
     ccgtgagaca cgggtgaatc gcccgagcta gatgattcct caatggactc ctcgcctccc    274980
     ttgaggtcag gcggactact gcgcgatcgg actggtggcg ccacctccgg cagtgccagc    275040
     gagttccccc tctggttctc cgcttcctcc gacgagctca tcacgtccga gactggcgtc    275100
     ggtggagagt atgccagcgt gggactaatc ggtccatctt cctgggaatc ctcagacagg    275160
     ttgcgtcggt gaccgcccgc gcgccgaccc gacgatgtcg ggctgacgga cggcgatcca    275220
     aacggaggtg acgacgaccg cagactgtac gaccgcgaca ccatgttctg catgctgggc    275280
     aactcgatgt agctgctgac ggcaccacgt gaaaagagca ccagtccaaa gcagaagagg    275340
     atcatgatgc tctggatgac ggccacccgc ttctggaaga ccagttcgtc ggcgaggacg    275400
     cccagctgcg cgctcagcga atgcacctct tgatggtact ggatgcgctg gtgctcaaac    275460
     tcaagcgcca cgctcttcca aacgttatcg tactgctcgc ggaattgctt caattcatga    275520
     agtaccgtca cgttcagctg ctccaggaac gtggaagtct tggccagctg ccgtttctca    275580
     actttattga atgcgtcgcg caatatccgc gactgctctt cgatgtagag taaggataga    275640
     ctggagttag attccagcat ttgtagtcgc ttattcacag acttgaagaa tgactcttgc    275700
     gtagtcgggt tcgcagaagg aggctgtgtc gctgttgacc gcgtcgtctc cgcggcgacg    275760
     ctttgctcct ccttagtgaa gccagtagac cggctatcgg cttcaccttg tgatgtagtc    275820
     tctggaccag ccgtggtagc agacgaaggg gccgagtcaa cattcgggct aacagtcatt    275880
     ttctgctccc ctgcctcctt gaccggagct tcgtttccaa gaggcgcagc gtcgtcgccc    275940
     ttgggaggcg tagcatcagt agctgacggg cgattgagag acgcctgtgt cccttcatcc    276000
     ccagcagctg gcgagtcatg aatactacag gtccaaggaa ccccccaaag ctgcatcatg    276060
     accgcctcat caacaaccgg tccggggtta gggcaagtct ccggcgtctg ctcgtccacc    276120
     ttctgctcaa tcgggcctgc tgccgctgca gcatccaccg tagggatcgt ctctatctca    276180
     gcagccaccg gcgcaggctc aagctcttca tcggccacca catcgtctgt ccgactaacc    276240
     tcaccatcat gtttatactc ctccaacatc gtcgtcccat gcacgcgaat caaactgagc    276300
     ggacaaaaga actcattccc ataatgcgtg agaaactcaa tcttgacata ccgcgcccag    276360
     ataagaggat tctccacggc aaacgcctga acctcccgcg tattcctcgc ctcgtagaca    276420
     cccagctcgc gccactggtc caatttcgcc ggataccgat ccgatacgct gacgcgaaag    276480
     gtatggaaga tggagctaaa aaactcatag ttggccaaca ccaccgtatc gaccaggata    276540
     tcatcgcaca gctccagaat caagaacttg ttgttagccc gacactcgtt gagcatatag    276600
     ctatctttat tctcgatcaa caccgaggac gaccccgtac actccggatt cgtcttcagc    276660
     accgtcgcgg cgcaatcaaa cgatgcatag ttgaaccttt ctttacacgt ggtgcccgca    276720
     tctttcgacc gcgatacacc cccagccggc ggcacaccat gcgccaggga atcaacatcc    276780
     ccagcagaac ccgcctctcc accagtaacc ccagtcgaca cacgcgcacc ccaagatgtc    276840
     ggcttcgccg cctcaggcgt atcagcccca aagccaccaa aatccaactc aatttcgaca    276900
     tcctcgccca gcgaatccaa cgcattattt atccccgtcg gacgccgccg cccttccttc    276960
     ccagcagcag cagcagcagc accgcgcccg ccgacattct ccgccgactg gccaaccttc    277020
     gccagattct gcttcttcca atcctcgaat gacaggaaat tcgcattatc gagcggcgac    277080
     tcggtatcaa gctcgtgatc gggccgtgcg ctgctctcgg acgaagccat ggaaacagac    277140
     acagcggaga gcgtctcctc gggcgctttc agcaacggtt gttgttctgc ggggatagga    277200
     gtagccggct ccgcttccca tcgcgtctca ggacactgag gccactggat gaactcggcc    277260
     tcagcgactt gccagcgcgg ggcgggacat atcgtctgac tggggtctgc ggttgtgccg    277320
     tcaatccagg tggagattag agtcatccag ggaatccatt gtgaggctgt ccagctggtc    277380
     attttgaccg tgtcgcaatg cgactttttc tctttctggc tgtcttccgg acaagtagca    277440
     ggtaagatag gataagaggt cgatatgatt atgtatttct ggcaaaattc attgcgctat    277500
     gtaccgtagg gactgatgtg tgtgtgtatg ggtatgtaaa atgctattat agaccgaggg    277560
     gagacggagc gaagagagtt caagttggtt ggttagttag ctccttatca gtagttaccg    277620
     gcgcgcccct tcaggggatc gtaagtagtc agacggatca gcaagaaggc ccaaggataa    277680
     aagggtgtaa caactcccga gaaagtaaaa gaggtcagca aagtaggtag gacacgtcgc    277740
     gcaagaggcc acacgccaga aacaccgcct ctttgctcac cgggtgtgag atggcgttgt    277800
     cgcgcgagga tagattgagg gtgtctggct gtctttctcc attctttccc gcggcggtct    277860
     ggaacggagg cctgccaccg ccttctctcc cgccactggg actaaccact aaccactagt    277920
     actaggctat acttatacta gactatctgg gtagttgatg ggacaaacct acggtgtaga    277980
     gcccgtgagt cacaccagga cagctggcaa tctacattga cctgacttac aatgaagatg    278040
     gggagatacc cagtctacaa tatacactac gcaggcaaat taaaagtcaa tccacatcga    278100
     atcatagtag attcctctgg ctatccccag tatcctcgta tcactctcac cataccagct    278160
     agttacagta caaagaaacc agtcctgcgc ctggtcggca cagtcgcctc aagatgtgga    278220
     tgaatggcca tagtagtctt gcttttccat gactttcttt ttttttcatt gttatcttcg    278280
     tagattcctg gtggcctccg ggccacccgc catcgtcctc cgcctgcctc gtcgtccagg    278340
     cccccgtcaa gttgaaccat tttctttttg ggtaagaaaa gttgaaagga tgacattgtg    278400
     caaagaatgg aaagggtgaa gagaagaaga gaaacaaaat cacatcctcc acagaacaat    278460
     ccctcccaaa tccagcagat gagtcacttt tcgaccgccc atccccatgc ttgctccttc    278520
     gaagagtgct atattataca ggataggaat caaaacacta gcacctccga cgtgagaggc    278580
     ttgccgaata caaacaatct atcgtaacgg tagagaagaa gaggggataa taaaatattg    278640
     aatataaggc tgccggatgc acccaacgcg ggtgcatcta agccgagtgg agagacgctt    278700
     caaaatcgat caaaaaaaag agaaaagaag aaaacaagcc ggagaagttt ggttgtcggt    278760
     agataaagtt gtttggaatt tgccactctt gtcagcgtaa tttggtcggt acaacgaaca    278820
     ggaatcggat tagagcagag cgggaacgaa ggcaggaggc atggttctta aaggtggaga    278880
     tcatgccagc caccaacgag gtcgagatcc tcatcgatac tgccatcgta gtgatgagga    278940
     accttcacgt tggcagcctt cggtgactcc caggcatcgc gacgccgtcc cttctcctgg    279000
     aaggggcgtc ggcggcgatc gtggaaggaa gactcctcct tcttggcggc ccaagagcca    279060
     tagtcgaagc cggaagatcc caagccccag tccttcctcc aactcatgtt gagagggaac    279120
     ttcttgcgtc cgagtgaagc ctcaggagac ttgtagttcc tcctccggtc acccagggca    279180
     gcccatttgt ccatgttgga gttcttcgga ggactgtccg gagtgcgagg gggagtcttg    279240
     aggccagtgg gggccgtagg aatattccaa gacttcccgg gggtctcatc ggatggcacc    279300
     gaaggcttgg gttgctgagc gcgaacgttg agcatagaag gagtcacaga atcccgaagg    279360
     cccgtcagcg ggccgcagag ctcaggaacg ttgccctcga cagggctgct gctttcgtgg    279420
     ctccagctac gggagttctg ctcgcgccgc tgctggaaag ccaggtcttc ggtctcggat    279480
     tcctcctcct catcccacag atcactccag ctcttggaga tctgctcgtc cttcttctta    279540
     ccaaagacca tggaaagaga aggcaaaggc ttggtggtgg gaagtgatcc ggtgatgggc    279600
     accggatccg acggtggggg gaaacgcagc tcactcttgc ggaaagcagt cggccggaac    279660
     gaatctccaa gagcagattc cagaacagat gccatggagg gagtgccctg gtgaacggag    279720
     aaccacgatg tgccagcagt ctccgaagga gggaagagat cctccgaata gctctcgttg    279780
     tcgggaatgg ccgacagctg ccgaatctgc tgaggggggc tggcctggag ggctttggcc    279840
     catgggaaag aatcgccctg gttgatgtgc gggctctgga tggaaggtgt tcggagaggc    279900
     tcgcggttgg cacttgcggg aacgacctcg cggtcatcgg tgcagaactc atccaatgct    279960
     tcgtcatcgg tagtaaagga gacagtccgc ataatggaat cacgaatacc agaaagggaa    280020
     cgcttctcgg ggtcgatagc caaagcaaat ctcaggatct caaaggtatc ctgggacatg    280080
     ttggggaaaa tgtcgaagag tgattggcgg tcgcggacat agtccgcgaa gaggatatcg    280140
     gattcggtgg gagtagcgaa tgggttccgc gcgaagagaa cgttgagcag gcaaatacca    280200
     accgcccaga tatcggcctt ggcaggagag tagccagagc tcgaagggtc gtactgctcc    280260
     ggagccatgt agcggtcact tccaacgcat gcctcatgac tccaggtatc ccgggtcgcc    280320
     aaacccaagt cacccagctt catggatcca tcctgcatca agaagatgtt ctctggcttg    280380
     atatcacgat ggtacatgcc attggcgtgc atgaactcga cagcgctgac cagctgcaac    280440
     atgaaatcac gcacgtgctc cgtctccaag gggccacggt tgagcctgat ggcctcatac    280500
     agatcgccgt tggaacagta ctccaaaacg aggtacatgt gagcatctgt ttcgaacgaa    280560
     tggatgaggt tgacgatgtt ggggtggtac gcaaggcgtc ggtggcagtc gagctcttcg    280620
     aaacgagcat catacggcga ggcaccaccc ttggtcaggc acttgatagc aacgtcctgg    280680
     ccggtcttgt tgtcggtagc aaggaagacc atgccaaatg aaccatggtt cagaggggcg    280740
     acggtgcgaa agcgcccatc aaggagctga ccctccacaa agctgttctt caggcactcc    280800
     atatctgata tatactcgaa ctagacgata ttctcccaga gatgttcgtt ccagtggttt    280860
     atagcaggcg atggatgtca caaggcggat gcaagaataa ttcaaacagc cagacaacca    280920
     agacggtcaa atgccaagca gatctcgaca ccgagaatag aagtagaaag atgaagagcg    280980
     agaataaagt agaaagaaga caagaaaaca accggcttgt tgagtcacag tttcatataa    281040
     ataccgggaa gagaggatat ggagacaaac gaaaagaaaa taatgacgac gagtaggcgc    281100
     gaagcgcagt gcagataccc ttaggagaag ggtgattgac gacggctagg aaatagaaaa    281160
     gactgttatg agtgcatctg tatatcgttt caccagtgta gaggcgcgaa gcccgaggaa    281220
     cggaagtatg tcgagagaaa gaatgtgtcg aagtgaatga ctatgtccgg caatgggaca    281280
     ccaaatggaa ggaccaaggg agaacaacgc tgcgtaatat cgtgacttga acaccaaatg    281340
     tataaacaaa caaggctcgt aactgaaaag gccttcgaac accaggctga agggccggag    281400
     aggggtcgtg actcaaaggg gaggggaagt gatcgaggac gggaccgacg gctataaggt    281460
     cataagtcgc ccgatgatat atagtccgga gatttgagaa gaggaactat ataggaggta    281520
     tagcggggct ttggacaact ggtatgatgg atcttcaggc ccgtaggtga acgagatgaa    281580
     gaaccgaata ccagcacccg gcccaggttg cgcggcggac ggatggacaa ctaagcagaa    281640
     gttgacctca cagtagacgc agaaccctca acacgtatct ctgcaattga aacgtagcac    281700
     gcggctttga gacggttggt ttgagggaag gactcgtggg tctgaggaac tctcgacgtg    281760
     gttggcttga gatgagtcac gcagggtgtt cggaaggcca ggcaggaaga cagcggcgag    281820
     gcagattaga ccgtagagga caggacaagt acactgttct gaagtagatc tggtggggaa    281880
     gactttggca atgtgaccta atcagaggat tgcaggcagt actatatcgt gtcgcgatag    281940
     aggtggtgag gcgaagagga agatgatggg gtggcgatag ttgatgattg ggttgggttg    282000
     gcaggctgat tggggaagcg cggatgtagg aaggagcaat ggattggtag ctgggacgct    282060
     ggaacgaaga gatgaaggat ggaggatagg aaggaaaagg gggaagcgaa gagtaggaga    282120
     gagaagagag aaaggannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    282180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnntcca    282240
     tactagtaag tatttcctca tattcctagg cacggctagt cggatggggg gcgacactcg    282300
     gaaccttggg ggagggaaag ggaaacaaac ccactcaacc tgcagcgatg gcgagaaagt    282360
     gggcgaacga gcgagaacct cctacgtcgc cttggttcca gggtgggtgg cctgctggcc    282420
     aatcacgggt gtttattacg gtattcatgc atactccaga ctccccaatc gggccaagtg    282480
     cctgtgagga tggtacccgg caacccccat ttcccttgtg gtcagtggta acaatactgt    282540
     acgtgcgatc ttccggccga cccacttgac tggtggcagg tcgagaaaaa gaggccgcat    282600
     ccggccatcg actccacacc ctctttctgc gcccccctga atgactgttt tcccttccct    282660
     tcccttttcc tctcgccaga agaatccgcg cggcggtgat tcagcattgc ctgtcctggc    282720
     aagtatccat acccgcagcg tcatggaaaa gccgaccctt ttggcggtac caactttggt    282780
     tgacttggtt gactcaatta agtcgtgtct ccgaatttcc cccctctctt ttctctctcc    282840
     aaattatggt catccagtta cagggcatca gagtcaatca ataatacaat agtaataata    282900
     atcataataa taaaaataaa aattcccagt tatttacgga tattactatc tatggatggt    282960
     tgagcacgga aatcactgcc tccgagaagc cgttaatggg ctccaagtaa tgtttcagta    283020
     gcgttccagt cattgattac gaaggcgtta ttctcctggc tgcctatcaa tcacctcagc    283080
     agccagaaca ttcctccact tttctgctgt ctccctttga gtcatcccct gccattgttg    283140
     ccgggtcgtc tcaattccat tactgctttt tctaaatagt gatactgtca tttggcattt    283200
     taatgacgag atttgttgca gttctaaaat gacgggctgg gaggcaggtg tcatttgaat    283260
     gcgtcaattc cccgaggcat ttttcttttc attatttttt gttttttagc ttgttgggga    283320
     aatgtattat gtagtaggtg ccgcaaaccc ccagactcag gtacatgtaa cctgtcctga    283380
     ttgcggccag cttgccaaca ccaacggctg ctgactgtaa ttaatcaatc actaactttg    283440
     aactaattta tgtaaattgt tgatgaccat tagataaaca aaagttaata tactctgtat    283500
     attcattaat cttcaattgg tgcagtagaa caaaagttca agttaagcgc cggtttagag    283560
     ttacctccca agcaaagacg gcgtgagtag actacagcct gagcagggga catggaagat    283620
     acgccctggg caccaaggca gcaccaagtc aaccggctaa gctaagttcc tgcaggtccc    283680
     ggcagggtct cccccctctt cccccccatc cgagcgagct atgctatctc cctatcttca    283740
     tcgtcactta tcatcatcca tcttgccatg ttccctgata gatggataca atcaaaatct    283800
     tccgggtgat aaccccatga ctctcccccc aagtcaaacc ttacaaacaa ttgacaatga    283860
     aggaataatg cattcgaggt ataactaact atttccgttg agcccagttc gtcaaataac    283920
     acaacaaggg ggcggcggtt ttcgtaatac ccatcatcat cataaccatc gtcttcatca    283980
     tcaatgcgat ggtaaggtaa tgatcaccga ctggcccgct ctccttcccc tcttccctcc    284040
     ccaaccagac cagatcagat cgatcctaaa tccatccatc taacagtaaa acgggaaaag    284100
     agcaccaccc caccagaaat cggtgacgat ggagacacac ttgaacacgc gatgattgca    284160
     cctagactac gtatcgctat catgtttcca ttttcagagc atttccactc tccccagtcc    284220
     tcggccgatg caggcggcgg gaacaaatcc aatcaagagt ggcacttggc attatgacta    284280
     agtaaagtaa agtaaagtaa agtaacgaat acggatccat actggtctag tccctatccg    284340
     gggggtgcct ggagttggcg ggcgaccacc tgagtgacgc tacagtggat ccctcagaac    284400
     ccaatcacac ggaagccccg ttggccacta tttccaggct gcatgacgcc agccccaagc    284460
     aagcaacgac tggcgcgaag tcgtggccaa taattgacca tacgtttggg tcggctgttc    284520
     tgaaaaaagg cccgggagga tgatcccgga ccttcgtcaa ctgtgacaca gtagactagt    284580
     agggagtaat atggggaaag aagctgttgt cggtagatac ggatattgct gcgcgccgat    284640
     catcagagga gactactact tactacttag actagagcct aggttccgag agttagccgt    284700
     agatacagag tactactgaa gatactcagg tatcaccgat catacgagag atatgatatg    284760
     actggatact tttctcttac tttttatccg catggacaag taagaaagta agaaaaaata    284820
     tctacccgac gaggtagtaa accaagtaag ccagtaagta cctaaaatca atctgagtaa    284880
     gagttagtaa gtacctaaaa tgctcagcac cgcttcaggt accttttccc aacccaagag    284940
     ttggtaccta aggttcagtg taagaaaggc agttgagtca gttcacaact gcaaagtttg    285000
     gtgtgtgtgg ttcggtccag gccagccaga taacccaggg aaaccaaccc ctttgaatca    285060
     atcaatcaat caacaacaac gtcaattgtt gttgcacaaa acctgcgtga tccacgttga    285120
     tcctgtttac cgcgcgggat ttccttcaac tcgcccatca tctgtaacag gatttgcggg    285180
     gttaaacggg agggagggag attacgtctc agacagacag acagactcct gggccaactt    285240
     ttaatctggc aatcgtatcg tactatcgat cggggtggag actttgtttt ttgtttttct    285300
     tttttctttt tttgctttgg atgtatggag taatgagtga acatatgaca ggaggtatgt    285360
     agcagagtat gttaatctgc tcagggttcg tttcgggttg tactatcggc aagatcatag    285420
     ttatcctccg ttatggtact tttacttctt agttactatc taataactac tgtgtacagc    285480
     cagtaggtag ttgtggataa ggtgtggaca attggaacga ggtgaatgga tggaaatatc    285540
     cctcttccta catacataca taacggagat acaggctcgg agactaaatg aggaaattga    285600
     gtaaagataa taaaaagtta aaataaataa acaaataact ataatcaata acatggtgcc    285660
     tgctaagtgc gactcaaaca gccaacacaa aaacactggc aaagcaacgg caagcactgg    285720
     cagcgccccg tggctggcaa ctttctttcc ggggctgcat gagcaaagcg atgctggcgg    285780
     tgaaggacga aggtgcatta gtgccagact gaccgcctcc cgagcaagtg tcgggaaggt    285840
     ttcgtccttg cagctggcaa agagttgcgt gtctcgatca tgcaggcttg cctgtctccg    285900
     acacgccgat gggcagcagc agtaggcagg cagccaaggg acgatgaggt ggtcaccctc    285960
     aaaagaaaga gtacaacgaa aaaccaagga cctcaggcat acgtggatgg gcctttcctt    286020
     ctgactaagg aattcttttc ccattaagtt cccgctattc attctgccag gtggctgttt    286080
     tgcacgcatc acgcgataag cccccgagca agacttgcca ggccaccaca ccaccaccaa    286140
     caccaccacc tcatcatcca tcatccatca tccttctcgg ttcctttgga tctctgatgg    286200
     tggctgacac agctcttcgt atgagagaat agtttaaatc ttccatgaga ttccatctgg    286260
     ttccatttct gccccaggaa tccgaatgac ctatatccca gcccagccca gtccagtccc    286320
     atacttactg tacaaagtat ttacttttag cctctcaggt gatccaggtc acctggctct    286380
     ctcctctctc tcccttctct cacgccatcc ccaaggtttc ccgctaacat tcatttctcc    286440
     catggaaccg ggatagcgtg acccagtgga agaaatggat aatcctgact gcctggaact    286500
     tgccaaattt ctcaacaatg actaggttca tggaaacccc gggtgctgaa ccttagatac    286560
     tgcctgctct ggtctgttct ccccttatcg ggatgattat ctgccgaatg gaacagggcg    286620
     gtgctgatgg ctggaacacc ctatcgtggt tgttctgggc gggcgcggtg tgtatcggtg    286680
     gaacctggga taaggagcca gtcagggagg agaagaaggt tggaaacggt tatctagtac    286740
     caggatttgg gatggaggat gttgcaccat tggagatgat agtctcatca ttatgtagaa    286800
     tggtatctat ccttatctct atgcttgtgg tctacttagt tactacagta gtatacagac    286860
     atctacagat acagacacag acacaatcat aaacaaaata gtatgagacc agtcagtccc    286920
     agacaggaca tatctcattt ccaccagata gattacaaga aatcataata tatatccata    286980
     tatccgtagt accaagtact cccgtatcac tcctatcggc agataaccca ctggcatccg    287040
     atcaatcaaa tcaccatcca ccatccacca tcattgccat catcatcatc atcaaacccc    287100
     aactacccca aacccaacca gcattgaaca cagcataacc catcccatcc ataatccatg    287160
     agcacgcgac acaagagaac atcaccccat acggaagtga ttcgatcgcc accacctctc    287220
     ccagcctatc ccaacctccc cccagacaga taatcaaata gataaaacag ataaacctac    287280
     tagtggcacc tttaccccgc acgatcaaca aaagtgccac aagtccaatt cgcaatctta    287340
     ctacttacta tctattacta gtagctaaag accagccact taattagact ttctgtcatc    287400
     gctatcagtt gccattctat ccattgaaca gaataggaaa ggggaaaaaa aagcaattcc    287460
     gatttgtgag aggagatgtg aaactctcct ccgactaatg ggatttaagg tcgttgttcc    287520
     gcgcttagag gggaaatggg attggatact actaccttgt tctactacta gctaatacta    287580
     gttactgttt taaactattt actaggataa ctagttagtg aaagagaaag aaccgttcaa    287640
     cgaacaaaac agaaacgaaa tggaatggga tgggatggat ggaattaccc cagattcaag    287700
     aactactact tactgcattt cgggataaag ttcggaggac gacgaaactt gaactcctta    287760
     cttcctaccg tctggatctg aaccacaacc agaactgggg nnnnnnnnnn nnnnnnnnnn    287820
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    287880
     nnnnnnnnnn nnnnnnnnnn tgccatctac tattcagtat gaaagatact ttactattat    287940
     tctcaaatcc cagtctgttt ctgactctgt ttcacccatc tcaacaacca cttaccccag    288000
     aatccaacat cccacacaca caaccacgca acataaccaa gaaaagcagg aaatgcaaga    288060
     taatcccgca caagacgcat catgttatgg agtatggagt cagtatcatg tatggggtgg    288120
     gtgcttgctt gcttgcttgc ttgcttgctt gcttgcttgc ttgcttgctt gctgcacacc    288180
     cctcctacgc actccccttc ttatcccttc ccttcttgtc tcagacatga gatggatcag    288240
     accagacagg acaagtagag caagacatgg gctgtatgta gtatgtaagt atgtagtatg    288300
     tatgtgtatg tctgtatgtg agttatcgta catactacag atggatcata tgtactatca    288360
     cggaacacga catggaggat atgtgagtac tccaggatac tagtacttgg atatgtatgt    288420
     gtttgatgta tgtggaggtg gaggtagcta tatctactat gtaagcatat tgctgttgta    288480
     ctacctacta ctactgaagc accagtgtct aaatacaaat actgaccata ttatataatg    288540
     ctattcactc acaaatataa ataccggtat actattgttt accatgactg tcttgtttat    288600
     atagttatat atatatatat agatgtactt atgtaaagaa gtaatataaa ccacaaacat    288660
     atatctccca tcccatctat accccaacaa agcaagcaaa gtaggcaaat aacaaggatc    288720
     ctccctcccc ggcgcttggg tgcagcaaca ctcaccacca ccaccaccac caccatgcac    288780
     ctccacctcc acctccacca caacccagca gcgcagcgca gcacagcact cgtcacgaaa    288840
     cgcactgcag gtgaagtgga gtctcattgg tagcagcaca ctggccgact atatgcagag    288900
     tggttagagg gtgtgctgca agctgcaccc gcacagccct gtcggatgca gctaggccag    288960
     cagctagctg ggcaggcgat acgccgagca agcacacacc cacacccaca cgagcagtca    289020
     cacacagacg cccactggat atatggggat cagcaaggtg tgtatgtgtg tgtgtgtcgg    289080
     tgctttttgc agaagagacc agagacaagc tggaagacag ggggtggggt tggttggcta    289140
     gctgtatctt gctctgctcg actcgactcg gctctagaac acgagggctg cactactagc    289200
     tgctattact aaacatgggt aggtaggatg gttctgcaac aagtacgttg ggagtactgc    289260
     tacgctcatt ggtgctccac tatgttcatg atgttgatat tgcagcttca tataccggga    289320
     aataaataga aagcatgagg tatgattcgt tcgaacgctg ataaatgcaa ggcgccaccg    289380
     tacgacaggg acagacggta agtaggtaag tagctaacgg ctgagaggct gcctagtaaa    289440
     acaggccaaa gaaaaaaaaa aaagaggaca tgcatgcatt ggatgaggaa cgtgctctcc    289500
     acgctcagag caactacaat gcccagtcat cgggcccgtt caattccgca acaaatggct    289560
     tgtcgatctg cttgattgca tgatcaccgc agagaacact gggagacgtg ttagtaaact    289620
     gtagagcgaa ctttgaatga agcagactta ccaggcttct gcaatcagcc cgtccagttc    289680
     ccgcacaatc tcttctcgtc gcgccgctcc caatgtcccc ttgtttagct gcgcttgtag    289740
     gtcgcggatg tacttcttct tgccaccggc accgtcgagg acctccttgc ctaggcagtc    289800
     gctgtggaag gcatgctggc acgggaagac gaaaaattgc cggctgagca ccggcaagga    289860
     gcagagccag cacttctctc cgggttcgac aattgcatat cgcgtgtcca gcgccgcaat    289920
     ctccgtccgg atctgacgcg ccgtgtgcgc cgagttatcc atctcttgtc gcaacgcatc    289980
     gatgtgccgc gagtaatcct cgagcgcact gcagatctcg tctttaaagt cgtcaatgac    290040
     aacaaagtct gggaagaacg ggatcagatc ctcgatgcgg agcagttcgc atcggcgaag    290100
     gaactcgatc gcgtccttga tgcccgtgcc aggctggcgg atcttcttct ccgctacaag    290160
     aagccaaagc ttcttccgga gcttgtcgtt cccctccggt cggtccgcca caatcgctgc    290220
     cagttcgata tcttcatgct gcagagccag ctccaccgcc tggagatact gtcccatagc    290280
     gctgtaaatg tggacgcacg attgcacgcg ctggtgttgg atacaaagac ggagagcaaa    290340
     gtctgcatcg tacggcggcg gagatgacgg ctgtgactgc aggtaggtga ggagtccggc    290400
     ttccgaggac gagggacttg aggcgtggat cgagatcagg gtgttgtgga ccgccgcgga    290460
     cggcttcggg tggttgacaa tgatgaaatt caagtaccgc accgcctggt tctgccccag    290520
     gggaacgttt acggtcttgt tgtagttcag caacgcagga atcagcttct ccggctcgag    290580
     gttggtctgc cgcatcaaga tgtcgactag tccggcagca gcatgggtca tgagaacgct    290640
     actatacttg tagaacacat cgggttcact ctgtcgttgc agaacattga gtgcctccga    290700
     ccatttctct cgctggatcc agtaggacag cacatagttg tggtcattga ccgccgtggc    290760
     aaagaatagc aattcctcct ctcgcccatg gctactgatg agatcatatg cagtcttctt    290820
     gtccaagtcg gaccgatatt tggtgacaaa atcttggaac tcagcccgga cacttccgag    290880
     ttcgtccttg acttcttccg tgctcgtgcc ctccgccaat tctgctttgg tggcgatgtt    290940
     gtcatcaagc gagttcaact tcgtcatgaa aacttcgaca agccagctgg caaccattat    291000
     ccgttgcatt gacgaggact tcttatacgt agaaagctgg ccaagaaggt actttcgcag    291060
     ggcatcatgc tcgccccggt tgatcagagt cagacagacc tcttcgaagc ctttgctgct    291120
     cttgccccaa accttggccg cctccaaata ccgaccctta ctggcgagga agtctcccga    291180
     ggcggtggaa acagcatctt tttgcgctgt agtacgggcg tactgcagag cttcgtcaaa    291240
     catctccttc tgcagaaata ccttccaaac gtctctatct tcgtcctcga ctgcaatttc    291300
     gaagatttcc tggctggtaa acagccagta agtgtgctgc atcgcatccg ttaggaggcc    291360
     caaagcactc tgtcctggtt caagaacggc ttcatcgtac acaatttcat cattcatacg    291420
     gttcacagca acaactctgc cttcgacaag ggctaaaatg tgccactggg acaacgtcat    291480
     ggcagttatt gggtcttgta tgagcttctt gcctccgcgc gcagattcac tagccgggaa    291540
     caaagaccgc ggcagcatgt tcgagctttc aaagggttga gtgagtttct gcggcgcgta    291600
     tggaagttgc ccgtggtaga taccttgcga actgagccat gcgaactcat tctccggctg    291660
     accagtcgca ttctgacctt ctggaacaat aggcgagata gccagtgtcg acggcgcggc    291720
     gctagaaggc ttctgaatct catgggttac aggcgcctcg cgttgaaata gatcagcgta    291780
     gacaagactt cctccttccc tcccgtacct cccagtacgt cctgagaagc acagcagctt    291840
     tccatgggtc gctattagca ctcgtctgaa ctcgggcttc gtaggtatta tctccgccca    291900
     gatccctgtg acaggcgacg cttccggtgt cttgtagatg gcctgcgcat atctctcttc    291960
     acggcggtag aactcggtag acggctcaat gtaggcctcc cagatctggc catccgtcgt    292020
     gcccaaaagt atctctcttg tcgaagccgt aggcaaagag gggttccacg cgacactttc    292080
     tatcggaaca cctttcagtc gcgacagtgg cttaggttgc cgagattggg tatggaggta    292140
     gtagttctcg ccaagggtgg tggtgatgat caaatgggac gcggacgggt ccaggaacat    292200
     gcgacgtata acgcctatct ccgatgactt tttggggaga tcgatatcta aaatatgcaa    292260
     gtcagcatgg caccgggagt ctatcaaccc tccatgatct ccgtcattgg gtgacgaacc    292320
     atcgatatcc tccggggtat ctagatctat tcggagaatg cgtccagtcg acaaagccag    292380
     aatcaaaaca ttattagcga cctgcgctgc gacaaagtcc gcagccagtg ggaactgcaa    292440
     ctgcacacgt cggacatcga acatggacag agcggcgtcc ggaggctcgg cgaggttgct    292500
     gggagcaaca taaccgctgg acgtctccag cgccatgatg cgccaattgt aaataatggc    292560
     cctatttcat tgctcgaccg cacaagaagc ctgagtggag ctgcccggac gaggtataac    292620
     agccaggcga gctggagatg ggtgatgatg aagatggggg tagctcgccc gaagcggagc    292680
     tactgatgcc ttggcgcata tatgcctgag gcagaaacac tctatgccag atactgcttg    292740
     cgttgccatt cgatgtatcc tttctactat atatctaccc cattgaaaag gaaacagaga    292800
     actttgaatc ttcatgttaa ttttgttcgt catcataagc atgcttgcaa actattacta    292860
     ctctataagc tcgctatgca gtctactgaa cgccgatgca aaccctcaac cgaaagactg    292920
     agctgaaggc acaaaacatg caacatgccc gggtatcaag cccttgtctt tcaaattata    292980
     cagcctgtgc tcatagcaaa cgaatgcaag gtaagcggaa acgcatgtga aatcgaacat    293040
     tcggatcgtc atcaccatca catcatcaca tcacgacaca ctcccggtcg agcttccgtc    293100
     caatcttctc ccgagatttg tccttcagct tgtctctaac tcgctcggag tccctagtcc    293160
     gtcgggggct tttgtccttg cgctcaccgc ttggaggact gaatttctcc gtcggtccca    293220
     gttctttttc cgttaactca tccacctcgc cttcagagac tccatcgttg gtgaacttct    293280
     ctcgactgcg tcgcccggta aatcgtgaaa aggtcgtgct aattctgctc tcgcttgcct    293340
     ggctccctgc acgactgcct ggattgctcc ttgtatgcct cgaactgcgt cgagagaatg    293400
     agaacgaggc cctgccatca tcatctcttg gagtaagtct cggcgaagtc ggcgcgtatg    293460
     actgcatcga ggtcggatca aaaacttcag agaatgccac actctgcttt ctgctgttgt    293520
     gatccatagg ggcaggatct gcaccgtcag gcccggtgat ttcgaaacta ggccgacctg    293580
     aagcgtatcc ctccgcgcga gcaccaccga tatcttccac agataggttt tgtggtttct    293640
     gcaccatatt ggcattctct gtatcccgaa aatccattga cagctcagag gaaggcggtt    293700
     tgtcgaacag attggctgcc gcagcatcct cattgatagg caagatctgg tagaataaga    293760
     ggtacggcga ctcgtgtttc aaagcctgct cgatgtcgac tagcgttact cgctcttttg    293820
     ccaggtcatc aaaccgcatc caatatcttg aggcgtcaga agtggttgcc tcctggtctg    293880
     aaccatgaga actggctgga ggcgcgccag cactggtacc cctgacaatt gatatgtagt    293940
     gcccggaatc gactgaggta cctcgatggc agaccattgc ctgcaaagac agcttgaaat    294000
     ttccgtagat agggccttct tcctccatac tatcatcctg aataaaatgg ggcaacccga    294060
     tctcggtcgg aatatctatg aatgtgttga gccgtactgc tttccctgtg ggtgtcatgg    294120
     aatagcgctt gagacacatg ccaaggattg gtcgcttcga agaaaagtgc gcggcgacct    294180
     gggcgtcatt tgtcggggtg ttgtccgtat accatgctat actcacgtca gcacttcctt    294240
     aacgcacata ccaagtagaa cttacgtatg agactgaaga actgccaggc gggcatcatg    294300
     acctccttcc tgtacgagcc tctcctttga gagctcatcg taccgtcctg agcattttca    294360
     tcgccaggga taaatcgttc ctgaacgatg ctgctccgtc ggtatggagg gggggccgag    294420
     tcgaccactt ccgtcagcga ggccactggt gtgacatcgt ctagcggaga atatgactgg    294480
     cttgaagctg gtgacaaggg tgagccgacc tcaatggtct caacatgtgt cgtacagcct    294540
     ttggctatgg aatccattga tttgactgaa cccacagtgt aacgccgctc cagatgccgc    294600
     ttgacctcga ccctattgtt gaagtatgac tccaagcagt cttccagagt aacggtctcg    294660
     ccatcagctg gctcaggtat cgcaacttct agcagtctct cattgacaaa tttatgatcg    294720
     ccggttacat cctcttttcc ggtatggtat atgtccatct tcagtgtgag aagaggtaat    294780
     tccagcttct ccgtgatgaa cgtgaacgct tcagacgtat cctgttggcg aagcttggcc    294840
     gcatcttccc agccgcattc agcaagggcg tcctgcagat gtttggtctt caacggagca    294900
     gagagttagc ttcaatccaa aagacgagtt ccgggagata cgcacaaggt ccgttgtaat    294960
     aagcctcccc gaccgcagca tgttgaccca gagtcgcaac agcaccgaca atttccggcg    295020
     gggctcatca ttgaaagact tgtagagaat tgcctcgaag caatccaatc gggcgaacat    295080
     ggcaaagagt agtgcatcta ggtagcaagt gacgccttca cggttgaccg ctccaagaag    295140
     cttcgtggtt ggcgtgtatc ctcttattat cccctcgatc gcatcctcaa gaatcatgag    295200
     catctcgaat gccttgtcta catccccttt ggcgtgctct gactgcaggg cataactgat    295260
     gtgttcggtc cgtaagccag tgataccgag ctgtgcgaca cgttgctcta agaccttgat    295320
     ctactgcctg tcagcgccat cgaataacgc acgtccccat ttgtattcac cttcttctga    295380
     ttttcattgg tatccccggt aggaagttta tcggaggaga aaaacccacg aaaatggggg    295440
     cgcgaaagga ggtttgatgc ctagatgagg aggcgcatta gcatgaccat agtcacccag    295500
     cggaatccca ccatacctct tctttggcat ttttcttctc acgtctggtg agaaacctat    295560
     ggatgccact catcctcaac agcgcatgtg tcctagccag acgacgggcg agacagacga    295620
     atgtgcgaag aagtggggag tgcgagatgc atcgatgagt gggggatcta tataaatcct    295680
     tgctcaggct ccagaattcc gatggagcac gcgaagagat ctctggtgga gtcacaacac    295740
     atatcagacg gtgatatcac tcagggttga tttttcccga atttatcttt tttctctctt    295800
     ctgacttttt tggtcgcgat ggtctcctcg cgatgtccaa ttagcaaagc ccgacgtata    295860
     ctaggcacta ggcaccaggt gcgatcagtg acatcacatg taacggcaca agatcttagt    295920
     tgtaaaacaa tggatagaaa ggcaaagaag ggagtctgct cgaggcaacc agggtattgc    295980
     tgatgtggat gaaagagccg cccatcagaa gaccttcgca gccgatctca gcgcattgac    296040
     gataagcttg ttggtggcgg ggatgacgaa gttgatcaca tgtggatccc cgcctgtgga    296100
     gggccccttt ggctgcctga tttcttccct gccagatccc ccaggcacca gtaagcccag    296160
     gtcccggaca ccacgtgatg ctgtcccgaa agagtcgatg ctcgccggtc cgcgaaacaa    296220
     tttttgggaa ttcagtctcg accagtctac agtaaacccc atcccctgtg gacctcaatg    296280
     gctgccagtg aaccctccag atacctggca aggtcattgc cacgggcctt ggtgccctct    296340
     tcgcgggctc cggccttttg ctggcgtcgc aatgcctccg atcaagcgtc gacgagatct    296400
     ccgtccgccg acatcaacga gctggagtcg accactctat ccacccctct gtcgcaggac    296460
     acggtgaagt ccttcaatcc tctcgaaaga gccagagcac gcaagacgca actaccccgg    296520
     agtcggtacg ttttctcctg gagtcaaacc ctaggcttca cttcaacatc ctccatccga    296580
     caatcatccg tcctccccaa ctgacacgaa acaaccagtt atcaattccg ctcccccaaa    296640
     tacgaccgtg gtcctcttca ccctcaccgg cctcccccgc cctctgatcc ctcctctcga    296700
     cttttcgtcc ccggcccctt ctcccttccc cgtgtcgcac agacctggca atcaaccgtc    296760
     gcaccggacc tcctcaccct cctctacgtc cacaaccccc cgggatttaa gcccccgccg    296820
     aaggctcctc gtctccgttc atgggacgac agctccccgt accacaagaa ccgatctctg    296880
     cgtggccctc gtggtggtga cgttctccgc ctcctccgca agcctatcac cttcaacaac    296940
     atccccaaga tcgagcgcat cactctccac agttacgtca agcaggctgc cacgaacgac    297000
     tcgtcatggc tgcacgttgc tggtatggcc ctgcaagccg tgaccaacgt caaggttgag    297060
     actttcaagt ccaagactag cgttgcccag tggcacattg cccccggtcg tgataccgtt    297120
     gccgctaagg ccgagctgcg cggtgagaac atgctgcatt tcttcggaaa gctggtcgat    297180
     gttgtcatgc ccagactcaa ggattggcag ggtgtgaagg gtagcagtgg tgatagcagt    297240
     ggtaacatca ctttcggtct tgaacctgag gagatggctc tgttcccgga gattgaggtg    297300
     aactatgata tgtaagttgc cccattgcca agtgtacaac gctttacgtg cacatacatg    297360
     tgcacacagt gccaagtatg atcagaagat ctaatcgaaa taaaacaggt acccccccaa    297420
     aatgatcccc ggttgccaca tcaccatcca caccagcgcc aacaccgaca aggacgcccg    297480
     tcttctgctc agcgccatgg gtgttccttt ctacggcaag cttgtcaact gaagaagaaa    297540
     catgacagtt tatgtgtacg gaattgtcat tgggcaatca atagacggat tttgtctttc    297600
     ttccctccgc accatcacct cactcacacc tttgttgttt tgagcaacct ttttcctttg    297660
     aatatgtaac atgaaaggat agtacctata tctgtggtgt tattagtatt attattgttc    297720
     ttgttgttag aatcatttat gtaaaatacg ctctgttttg gtatcattaa atttcaaatg    297780
     cacatttccc gattccagct cggtaatttg taacatagat aaacataaca gttgcaagat    297840
     acggtcaaga aaaatttgtt tcgtggacgt gaacgatcgt cagattaatt ggtctatcag    297900
     ttggatatag ttaaatacta cagagatttt agaaataaaa tatcgcctcc cctctcccag    297960
     gggtagcaac gcatgacata ttcaccattg cccacaatcg cagcttcaaa ggaagcttat    298020
     tatatgtaag atatcacggc acaccgcagc tctgtacaag aattgaattg actctcatca    298080
     tggcttgtca acaagccaaa gatagaagat cagtagggag gttgcgaggg aggagaggcc    298140
     agccgttata tgattgtgct tttgggtgca aggtagaaag aagcaaggca gataaagaca    298200
     atatatgtgg tatgagggat gcggaaacat ggaaatgaca gaaacgcacg cgaatccagg    298260
     gggtattcaa ctctccacac aaatcaatcg attaagcatt cgggaagaaa ttcgtcgtca    298320
     acgtattagg tattgtccgg atgggagggt ccggttttga tgcgattttc atgcaagagg    298380
     attggccaaa aatttgcact tgagaagttc gtcggcgctc ggtctctttt cgtaatcaac    298440
     ttggaaggtc atgtccaaga atgccacggc ttcgtcgctc gcgtgttcgg gagcgggagg    298500
     cctggctttc tctttgccga tagcgtagat tgcttgcagt tgactgcagg aggggaaggg    298560
     atgcgcgccg gtgaacatct cgacaacaag acatcccaga ctccaaatgt cggccttctt    298620
     ggtgtggatt gtctgttgaa ccacttcagg ggccatccag taaacgctac cctgcatgga    298680
     gactcggtgt gcgtggccac ctccaccact agcccgcgca ccaagaagag tcgaggcctc    298740
     tacccgttta gagataccga aatcggagat cttgatgccg cccttgttgt caacaaggat    298800
     gttggcgccc ttgatatcac gatggatgat atcacggctg tggagataag agagaccggc    298860
     aaggatttgc ctcacgaagt tcttgatcag aggctcttgg aacgtgttgt actgcttgag    298920
     catggtagca atggaccctc ctggcacgta ctccaagaaa atgttcaagt actggtcgtc    298980
     agcagcagtg cccaagtact gcacaatgtt cgggtgatgg aacccttgca aaagttcaat    299040
     ctcatgcttg agggcggtaa ccatgctatt cttccgcttg tcaaattcgg tgcccttggt    299100
     tgcagacgga atctcaactt gtttcacagc cataagctct ccagtaatgg catgaagagc    299160
     gaggaaaaca cttccgaagg aaccctctcc aattagggat cccttcatcc aattcttggg    299220
     cgcaaagttg tttccagcca agaagtcatt gagaccatca tcttcctctt ccccatcttc    299280
     tgccacgagg atgctcaatc gttcattaag tgaacctcca tccgttgcag caacacttgc    299340
     gttctcatcc acaaggctct ggcgcgacgt ggtggggtca tccgagccac tatcgaaaga    299400
     aacatatgat ttgcgattag gctcgatggg cgactcttcc tggagaggct gaagggagct    299460
     agaagcaatc gaatctctgt acgtagcgga aggaaggttg aacttggaaa ctgagagcgg    299520
     ccgctgaccg cgagcaggct gtggcccagc attaagccag gtatctgcaa tgctaggaat    299580
     cgggggcgca tctctcaagc tagacgcata acttgtatta ctgacgacac tcaaacggct    299640
     tgcggcccgg ctcaggcgct gagatctgcg aacggacatg cgcatggtct tttcgatttc    299700
     ctcccgctgg tgactaggga agtaggacgt gatctcgtgg atgatcatct cgcttggagg    299760
     acgggcaccg aagaaggacc gcaacttgcc cacctggcgc tccacattca tgggcggtcg    299820
     catatcgtgc tcactaggtg tctggttgtg tctggaagag acgggtgaca tgggctgtct    299880
     gatattatgc cagggctccc cagtcagctg ctggatcttg agctggttgc gaacatttga    299940
     actgctcaga gcattcatat gcgctaattg gctttcatct accgccagtt gagaagcacg    300000
     acgaagctca tcgggatcgg gttccccagc atggattttg cgaaggataa gacgaccccg    300060
     ctcggacctg tgagtactct cacacacctc catgagctct tggtctgtca gtcttctaca    300120
     gttggcagga tttggctcca ggccatccaa aacgtagaag caataattgc ggtattgatg    300180
     ttccgggagc tgtagtttct tcagcacgca gagaacgacc tcatcggcat ccctgcagtg    300240
     tttgatgtcc agcatcttag tttgcccccc tgtgtagatc actctgatga cgggcgagtt    300300
     catcggtaat tgtcccatag tcaagccatc caaactaggg ttttgcctca aatgcgaccc    300360
     agatcgttcg ctgggcgttc ccggttttcg gctggtcatc gagctaccgg aggacggatg    300420
     gctgaagtag ctttgcccct gttccatacg ccccatttcc atcgggctat tagcgacata    300480
     ctgctgagga cgcagaggcg attcgggccg tgatgacggc ctgttagcgg aatagttgag    300540
     agcattagtc tcggctgctc gagacgagcg gcgagttgta gaagttgcag aagtctgccg    300600
     gagattggag gggcgtgatg gctccgatga agtgtttgtg taggatacgg cttccagtgt    300660
     agccagttga ttctggccta tggttagttt caattcaatt tactagttgg gtattcaact    300720
     taccagattc ctcgacttgc cgttaaggac tgacttgttc ctgagttgct tgatggcaac    300780
     aaatatccgc acacgatcgc caatcttctt gattcccatc tcctgcagga ttttctgatc    300840
     gcattcgatg aggttattac cattaaagtt attcgctgga gctgatcagc atttgttgcc    300900
     agagtaattg acctggataa cggtggcgct tagtaccttt gaacaatgcc tcgtattggc    300960
     cgcagtttat gctatgaagc caggcaataa cctgcttctc atcccaagat cttgtaaccc    301020
     tcagtatttt gcgactttgt catcggacat ggataaagcc aaaacttacc gtacagcatc    301080
     aagcccgtcg tacgcgtcag aaaagcttga ctcagtggga ctagtgaaca tcatcccctt    301140
     ctgtgaatct ccaatcgcgg tgggcttctg cgaggaccca gtgtagtagg aagttgtagg    301200
     ggtctgggtt gcagacacac ccaacgggtt gtaggttgct tttgcaagca tggctgcgag    301260
     atatcgagaa cgcggacggg gttttccttg ggtatattat atcccctgct gtagccctgc    301320
     gaatttggcg gcaaactctg ggataaatac cgtaaaggct gggctatcgc cacttagtgt    301380
     gtataacctt gacgtcttcg aaacaccgac tcggagggaa agcgggactc ggcagagaga    301440
     tgttgggaag ttcaatgcat ggtccagaac tacacctctg agattgtcgc gtaactgtca    301500
     gtccctcatg cggcggccaa ctgaagacaa agaccggggt tggggtatcc gtgggggcgc    301560
     ctgtggaggg acaacatgat gacttacagt tcaggctgaa tcgatatcac aggcgtatcc    301620
     aagcgaaaga ggagacggta tgcggtaggg cgtctgtgct gctttcaaag acctgatcct    301680
     cctttgtgcc gctctgacca aggtctgggc tgcactaggg gttgaagatg tcgatctgac    301740
     gttatcgctg gatcgaggtt caacccaccg ggtggttgga ggggaaggag acaggcgctt    301800
     gaggctgatg ctgaggctgg ggaggtggtg aaatgctttg tgctgttctg gaggaatgga    301860
     ggaatgggag ggcgaccgga ggggaaatgg aaggaggggg agggactgat caactggagg    301920
     ataagaaaaa aaaggccagt gttggtggtg gtggtggtgt ggtagtggta gattagtttt    301980
     gaaaggcaaa gtgacaggac aagaacagcc tcccttggta tctagcgcgg tcagtccgga    302040
     ggctaatgaa tggattgaat cctctttgct tacagaccga actggatctg acggagcctg    302100
     ttaggccgat cggtcgggga cgatgggctc ctccggcatg cgtcctttgg agtcgcgggt    302160
     tcactctcaa acacgccgcc gcggctgatt tgtcaagggg cccgatctga aacaatgaac    302220
     tcaagaggcc cctccgacta tcccttcccg tccagaggtt attcccttcc tcttcccccc    302280
     cattctttct gctattctta ggcggttgag ccgtcctggt gggcatgttc catggtttgt    302340
     gcctgggtga tgcttggttc ttcccaagaa cctggtcccg gtagtgctcg ggggtttgtt    302400
     tattctcttc cctttggatg atggactaga tagtttgagt cacggctggc gcgttgggag    302460
     gtccttcaaa tgagacagct ttcgtgttca tcggttgaga aactgctgcg atttggttgg    302520
     tgttcactga tccttccatt gggctgccac ccggccttcc cttagtgtca ggcttcccat    302580
     gtctctgacc cgccttgtta acgttaacta ctaaatatct ttgatagtta gatatagtat    302640
     ctgaaatacc aactatctct tctcacacca ctcactgtca ctacatatta tgctgattac    302700
     tgtggcattg caccagtcct gtatcccgtg tctaggccac tcaaactcta attagctcat    302760
     ccgaacctta ctctctacag gctagtcagt ggcgttgcac cctaatctgt ctctgacagg    302820
     aataccatca atgctgcggg tctgcttact gatgatggaa taatacggag gtggtctcct    302880
     taagcgtctg actggagagt aaatccataa tttggactga ctctcttcag aggtggatcg    302940
     tgcagtccga atgcgtcatc tatccctgag gattcagtcc taccttatcc gaagtcttag    303000
     aaaggaccca ttcagccttg actagaaatc ttggaatctg gcgagctagc ccgatatttg    303060
     ctcaatggca gcttctcctc taatcacaca ctttgtaaaa ctatcatgag gagggaggag    303120
     agcttaccac tctactctct gagaagaagc cataagaagg ggcgtcccag taagcgcgga    303180
     tacggtacca aaacttatac gaagagattc caaggtacta tctatattgt gcattcttcg    303240
     gggcagaaaa gagtcagtaa tagaggctac cagcctatct atcgtatggg tagtattcct    303300
     ttcatatggc cattacgagg attactggtc tatagactcg ttccactcgc aagtctagct    303360
     tgagtcaaca ggcgcttcca agctcgttca aaaggtgtac cctatatctg ctagcatact    303420
     ccatccacga ccctgagctt ttatttcatg cagcaaagcg tgtaaatcga tgtagataga    303480
     tcgtggcccc atttcggtac caagttctgg gtttggtggg gttggacggt tcatgctgaa    303540
     ccatccggcc atctgcgtcc cgtctatttc caatttcggc tgctgcgatt caggaccgct    303600
     ccgctctatt cacaatcgga tactggtcga cagatgggat gagttaaaga tagctcaagg    303660
     gggtaggaga gattaccgag cagatacctt ggcgctcagg caggaacagc ttcacttcag    303720
     ctatgtactg atcaggtaga ctactattag tagtagtcca taggggaaac acacgttcct    303780
     acccgatatg ctttggcgtc cgctcaagct gaaacattgg ctttcgacag gaagagtcac    303840
     taggggcaag aaatattgtg ccccttaaag cccctggcta agaaaataat aaagcgtttt    303900
     aatgccgaat accgcatgtc tatactacct ccctctttgt agtactagta tgcaacgtat    303960
     gtcattgatt cggtccttga ctgagagagt agtatgcaga gcagagaaag ttgggggggg    304020
     gggggggggg gggtatttgg cagctgatga aaacgttgtg aaatgaggaa agataagcac    304080
     cgtgactgca gacggccggt ctaattgagt tcgggctgga cacgaagttg tacatgatat    304140
     atatctccga ggagcgggtg cctgtcgggt acagcaagta cattcatgtg actgtagaaa    304200
     gtattaatgt agctaatgct gacatattca atttgtatac aactacatta tcttccccct    304260
     tttcatattt gaatccaggg tgctgctgta accccaactg actccccatg gaaatgcggg    304320
     cctctgtgag gagatgttcg tgatatcgac gcccaaagta aacatctccg caccggtggg    304380
     gatggcggag tcaactttcg tccaagggat gcagcaatca tgcgtagaga cctgaccggc    304440
     gcacaatgca gcaatatcgc ccgcacttcc cttcttgacg ttcaatcttt ggagaccgac    304500
     cggggattgt cgcggggaaa gtgacctaaa tcgacagggg gagagaagga aaagaggaag    304560
     gaacgactgg cctccacacg tagaatagaa taaatgagtg gtagggcttc ttttggcgga    304620
     agccagcggg agggcaccac gtgactctaa ctcgcaaaac cccctcatgt tgaccccaca    304680
     gtttttcttc cccgctcgcc tgtaatccca tctaaggaca tggtccaatt ccaaggcaat    304740
     tcgccatgga ggacgacaga ggcaccccgg gaaaagtgag gaagaaaagc actcccgctc    304800
     atcgcaagtc cttgtcttgt gaatattgca gtcgctcgtt tgcgcgcctg gaacacctcc    304860
     agcgccatct ccgcacccgt tgagtaaccc tgaagccttt cccggctgcc tgtggccttc    304920
     ccacacacgc gagactgacg tgtgccatct agataccaag gagaagcctt tctcatgtga    304980
     tatttgctcc aaatctttcg caaggaggta agttactgcc cgcgttgcat cgcagccgcc    305040
     ccgcgctaag atggggggaa atttcatagt gatctgctcg tacgacatga gcggctagtc    305100
     catccaactg agaccgcagc caaccgggag catcgtgctc aaaacagcca cgatgttcct    305160
     cagacccaac ctcctataat acagcccact caccatgagt cccgcatgct agagcttgcc    305220
     gacgctgtcc ctattcacac ccaacccgtg ccgccgcctc ctcccgaggt gcaggtgcag    305280
     cctcccccga ttgtggaaac gactcacttc aacccttcct ggggatatga tttgaacctc    305340
     ctttctcacg ctgcaagcca tgttgccctg gagggtgagc aggagagtct cgaatcgatc    305400
     cgcaagtctt cacagcacgt gggcacctcg cagccgcttc cccacgtccc agagagagcg    305460
     ataaccgata attatggcgt cgaaccctct attctggatc ttgctgactt aggggacccc    305520
     gttcaagatt tcacagtttt cctggagagc gtaggactgt cgtccgactg ggactctggc    305580
     gtattctcca cagttgaaga tccgattctg ccgacgactc ttccaatgga ctcaaagcca    305640
     cccatccgtg aaatggcgag gcttggtccc gagctcatga gtgacccgcg gactgcagct    305700
     gatgaacagc cgtcgttttc taattttgga tcacgactac cgtccttgca acctgaacct    305760
     catgatgtag atgaccgtct cgggtttggt gatgaaggac ctcgccctgc ctgggatata    305820
     tcaaatgcag accgtcaagt ctttctgtcg aaactcgatg agtttgctta tattcttccc    305880
     aaaaacttca ttccgccttc gagacacgca ctgtctcgat tctttgccgg ctatattaac    305940
     ggcttaaacg agcaccttcc tttcattcat gtgcctacac tctctgttgc aaaatgctca    306000
     cctgagctta ctcttgcgtt ggcggctgcg gggtctcact atcgatttga aaataatcgt    306060
     gggatagagc tatttcacgc agccaaggcc atccttcttc agcgtctcca ccgccgagac    306120
     agtaagcaag tggcttgtcc gacttggaac tttctgtcac cggcatctgg atttcacaac    306180
     tctcgcgggt cgtccgctgc ttcaaaccat accagtagcc cgtttcagca gcagcatcct    306240
     actttatacc cagcggatcc ttctggatat gcacccgaag attcggatgc tcacatggaa    306300
     gtgattcgaa cttttcttct gcttacagtg tttgcttcgt gggaacggca cccagagttg    306360
     ttacgagaaa tgctctccct tcagagcacg ctggcgagac tcgtgagaga gcatggtctc    306420
     gtcgagccac ctcctagtcc cgacccgaac aactgggagg attggatacg acgggaaggt    306480
     aaccggcgga ccaaatttat tgtttactgc ttcttcaatc tccactccat catgtacaac    306540
     atacctcctc tcattcttaa cgctgaactg aagctaaaca tgccctgttc gcacgacgtc    306600
     tggaaggctt caaatccggc tcagtggcgc cgtgtcctcc gcacgaggca tggcccagaa    306660
     gtctcctttc aggaggcttt cgccaggctt ttcttcaagt ccagtacttc cagcgcttca    306720
     gcgccaatat cccctcttgg gaactatatc ctcatacacg ctattatcca gcaaatattt    306780
     ttcgcacgcc agctctgcct ctccgcccca agtatgcatg ggaccagctt acgtcaagaa    306840
     gacctatccg ctttggacaa ttctctgagt gcttggaagg cgctatggaa acgcacaccc    306900
     gaatccagca ttgatcctca aaacccggca ggtccgatag cattcacatc tactgccctt    306960
     cttgggcttg cttatatccg attgcacgtt gacttgggcc cttgtcgtcg tcttatcacg    307020
     caagatccca tgcaaatcgc aagagctctg ggtgaatctc caccagtagc acgaagccct    307080
     cgtctgatca tggctctttt gcattcggcc catgccctct caattccagt ccgcctaggt    307140
     attgacttcg tggcccgaac ccattcgttc ttctggagca tccagcactc gctgtgtagc    307200
     ttggagtgtg ctttcctcct tagccgttgg ctgctgtcca taccagtaac ccaggccgag    307260
     cagagactgt cagagcacga gcgaaagcta cttctgtgga tcaagagtat gatggatgaa    307320
     accgacatgg ctgttgatcc ccctggggca cccgacctgg actttattgc caatccttat    307380
     aaagcgaagc agctgagtgt tgctatcgtg cgtgtttggg cacgaacctt taaaggaaac    307440
     acaagctggg cgattgtgga tctagttgga tcgagtctcg atacatatgc tgattttcta    307500
     gagacgcaga tgtaactgtc cacctcgctc taagttcggc tggcgcctcg ttattcgagg    307560
     ccacgccacc cttccaagca ataatccatt tctcacagcg ctggggagcc agcactgtct    307620
     gtggttcttt tccgtctcgg ttgcgtgatt tgatcaaatg gctgaactgc cttgattgct    307680
     aatgacaatt tggttttctg ttattcttag gtagttgctg gtgttgttgt atacccatgt    307740
     cttcacggat atgacatctt tatttccata gttcttttcc gtgtacataa actgtttatg    307800
     ttttcttttc ttgtgggggt ggggagcggc tcctgtgtat cgccatcatc tcggttggct    307860
     aatgatgtcg ccttctactc tgctgggagt ctacaaaagg caagggactg accatcaact    307920
     tccctacttc cattagcttt catggattga tcttttcggc cacgagaccg ctctctaatc    307980
     gaatgaaccg ggtattaata aaagcgttgc gtgttgcaag aagcgggtat caagaataca    308040
     tgcagtccat ctatagtagc cgtaacccac tacttttcac caaaacaaac ccattgtcat    308100
     ccaattcaca catcttaaat cccccaaaaa gagaagaatc aagacttctg cttcccccga    308160
     ctcctcacca cactagccgg aacaaaccgc aacgcggaca tagacctctc cagctccgca    308220
     atcccctcat caccagcagg agcggcagcg gcatcttgtc gggtagtagc ttgggggcct    308280
     ttctgagcac tcgcaccaga atcagcctgg gatatggaag tctggcgata ccttaaccgc    308340
     ccttccttcg gtgaagtagg accaggggca gctgatgata accgccgacg atgatcatgc    308400
     ggcgttctta gtaaagaggt ctgtttgtcg atgccgtcgt ttacaatgta gaaattgtat    308460
     gtctggatac atccattagt cttagtctta gtaagtaatg aaggaatata tggcagtata    308520
     ccttatgaaa catatgctta tcaatcaaat gcattctgcg tttctggggc gtagagcata    308580
     cgcgttcgca gtcttcgacg aagcatgcat actataccca tcgttagaac catacacttc    308640
     acaagctaac atgaaagatc aaatgtggga tagatacata cagttttctc ccccctctcc    308700
     ctccttgtcg ccactaacgc atcatggttc tcttcaatat ggagattcag aaacctctcc    308760
     gtcgggaaat tcttcccgca ctgcgaacac cgattgacgt gcgcctggcg gtaatgcacc    308820
     tcgtagtctt cgtaggaagt aaacgatatt gtttcccgat ggggcggtag ggagcaatgc    308880
     atgacttctt gattgggggt ggtggtggct gtgggatcta gggaggggat tttgggacgg    308940
     tttgataggg aagaagaggg tgaggagtgt ggtgatggtg agggtgatgg agatggggat    309000
     gtgctgcgtg agcgtttgga catttttctt tggtcttttg tatggagtgg tgatgttgct    309060
     ggttgtggat gatggtgaag tgtttgggag actgtgatag gtcagggttg tattagttgg    309120
     ttggatgggc tgcagcagtg tgcagattga ggtagtgtgg ttggtttgtc tggatgggtt    309180
     agttgggttt tccactggtt gtttggaagg tggggagata tctattgctt acaatatatt    309240
     taaagtatga tgtagatatt tacagactgc gatagtgtta ttgttatact agtataagaa    309300
     tggatggaat atggaggaat gcccagcgaa tatttggtga gccactaggc tggattagtt    309360
     ctagattgga ggtgggatac ttttttagcg gatgtcatag cttccgcgat tagtggagga    309420
     tggatgatgg aaagtccgga tggcgggttg agtacctttg tgatggagat tgccagatga    309480
     cttgccaatt atagatggct acagcagtag ttagacaata gacgggaaaa attcaaaaga    309540
     gtagagggtc tcataagaaa ttaaattgaa atatgcatta tgcagacaca ctgctaatag    309600
     taatagggat cttctctgca atgagtatct gcagtgtgga tcctcaggtt cccctccagc    309660
     tgaaaagtaa cataatatcg aagtatatcc cggaactact aaaataccgc atagtcaaca    309720
     tccgtgtatc tatcacaagt tcatgatttg caaatctgca tctggtattg gcgtctcgta    309780
     ctgtaaggaa gttactgagg aggacggttc ggtgcctgag ccggagcacc agccacaacc    309840
     catccagcca atcacacatc tgagaatctc tcactagcca caaaaaagac cgccgggcaa    309900
     agcatcccga gccattcaac catttttcgg acgagcgtcg aaaagttccc gtgatatggg    309960
     attttctctc caacgagcgg cggccgcgaa cccctccgtt gttcgtcttc gcgcttcggg    310020
     gtccatcctc attgctgcat ccacatcctt cttcttccct tcactaccag tggctgtcac    310080
     tccggagtcc tgaccgccct ccacgccctc gttcgctttt ttgtatatac tagtcttact    310140
     gactgatggc tcgttcactg ttcctgtcgc ccgcagactc ccagccagcc atagccatct    310200
     gacgggcgaa tgtcaccgtt agactgacac gggtgtgatc tttcttggtc ctgagcatgg    310260
     cgtccgcgtt ccaaactacg tggcagtcag tatccccctc tctccgcttc ctcgctgaca    310320
     ctacttctct tacaattatt cttcttgttc ccccaaaccg tgtgtggacc cgtgtctcta    310380
     atgccaaatc ccgcatcata cagaaccgcg ctcgaagttg aaaaggagct cctcaagagc    310440
     cttgccgaga aagagcctac gtttgctgaa atatcccatt atctttcgga gttagttgct    310500
     cccctcctgc cgtcttgcgg tgctttgggt ttgcgcgcag aatcatctga ccgtctctgt    310560
     cctcccttcc ttgccgtcgc agattccgct ctacttgcca gaatgctatc cttcaagact    310620
     tcgagactgc ccgctccgta gatgttgaac ctcgcctctg ggatgcgcat cttaagatca    310680
     acacccgatt ccgcaaattg ctctctcgcg tgagtgtcgc atcagcaccc tgctcgttcg    310740
     caggccgcca gtgtctaatt cgtgatttac gttatagttc cgggaggaaa gcggaaagaa    310800
     gaaaaagccg gtagagaggc ggaagctcga gaaacattac ctcgagttta tcaaatcaag    310860
     tcaacgattc tatcgagctt acatccaaca actgtcctcc cactttggtg gcatcccgga    310920
     gctggaaaag gtcgcgcgga aattcaattc tgacagtgag cattgtcatc cccgtttctt    310980
     cctgggcttt cgttgagcaa agccatgttt ctttctcaga tctatccgcg gagcctccga    311040
     tccgaacttc cgaagccctc agaacgcaca tccttcaatc atgccattcg accctcatcc    311100
     gtctcggtga tctctcgcgc taccgcgaga ccgaactggt cagcaagaac cgcaattggg    311160
     gtccagccat aggttactac gacctggcta cattgattta cccagcctcc ggtgcccctc    311220
     ataaccaatt ggcggtcatt gctctggccg acgggaacca tctaagggcc acttaccatc    311280
     tgtatagagc gttggctgct caagagccac acccttcagc caagggtaac cttgagattg    311340
     aattcaggaa ggtcatgaat gcgtgggtca aacgagagtt gatccgaccc gaagacgctg    311400
     gcattcccgg aaggtcattg gccccttggt ttgtatacct tcacgcacag tgttacagag    311460
     ggattgattt ccctgaacat gacgagcttg aaagtgaagt tctgaaccaa cttgccgtgg    311520
     atctgaagga acgctccttg gaaggtactt tacagaagtt ctgcctgatc aacatcgctg    311580
     ctgaggaatt ttcgcggact cacacgagtg gtaagttttt cgactctctc cttagtagag    311640
     gcgtgcgttg aaccaaatta ttagaggatt ccacatccaa tgcccgctcg ttctttcagc    311700
     ggatcaacgt gaagaccttc tttacattgc tccagatcct cctggccgaa gtagaacggt    311760
     ttgcggttga ggatccaagc aacaaagacg ccaaaaccgg acctgataag gttactgttg    311820
     tcgcacgacg tgtccttccg gcgcttcgga attacagctc ttggctcctt acggccagca    311880
     gcctattggt gtcctatcaa ggagagaagg acagtcctct agctgtccag ataatcgagt    311940
     tctggaaaat ttacgccaac actttaaccc ttcttgcgtc gacgttcgat gtagtgaatt    312000
     tgcctgagat tgactatttg ctggaagagg acgaagagac cttgtgcttt gcgcccttgg    312060
     ccaaagaggc aacttcccgg aggtatctta gctcgaatgg ccagcagaag ccccgaatga    312120
     acgatcctgg ggtagaaagg aatcacccca atatggagat gctctaccgg atccgcgaat    312180
     ttgttattga tggcttggat ctcgtcgtga gcaaggtatg gatactacgt gcttgttgtt    312240
     atcctcaatc gctgtgctaa ccactgcctg cttcagaaaa tacccattgc cctggtggac    312300
     gacgaagaca agaaaacatt catttaccag gaagaagggc tcccttcgca attcttcgcc    312360
     agtccctcgg gccatcacca tacgatctca tctgctagta tcgaacggga cgacattcaa    312420
     aaggcagcac ctgatcccag ccacaacatt gacactagga gtgtctttgg tgggtcacag    312480
     gccgcctctg catcaatgtc tgctagcatg catcggattg tggaaggtgt ggaaagatta    312540
     gttgaatctg acacctacga gaatgccccg gccgtaccag agcagctggc ttttgcacgg    312600
     agcagcaatc aacagcgacc atccagccag ttcttcgatt cgagcatgga ttcaatcttc    312660
     caagaggatc ttcttcccag gcagacccct gctgctcccc ccggactcgt accccctgtg    312720
     actggttctg cacctctcgt ccgagtgtcg tcttcccact cttacacccc ccgaccagcc    312780
     cttcccggta ttccaagcat ttggaacaca gctctgtcgc cggaactcgg tgacgcgcct    312840
     tcgccgcgga ctccgccagg tctgggacaa cactacccgg cttccatgct gcctggaaac    312900
     atcaccagcc ccaaccatca tctaccgact caggatatga tcgctaatga gctcatgctc    312960
     cggcagagca tgataaacca agcctcgagg cacagtccgc tcaatggacc tagcaccata    313020
     ccctcctcct ggatgccctc gcccagctct acgtcgcacc accgcctttc tggattctca    313080
     tgggaccgaa ccttagtaga taccgctgca aacacccctg gttccttagg agtgtccagc    313140
     caacccatgt ccagcggcct aagtaatgca tcgtgggcca ataatgcatt tatcgccagc    313200
     agcttcccgt ccggaacagg gttccctagt tccggtttca ccaacagtcg taaatccgcc    313260
     acgcaatacg gtgccatcgg gcagacccct ccttgcggcc atggaggctg atctcgaaga    313320
     ctgtaccact caaccaggtt ctgtgggtgg gtcagtgtgg ctactcatat ttcagcacct    313380
     ctttcgcagt gacatgagca ggattgagga agcatgcgac tacctagctg tttgtccaaa    313440
     ggactgagtg accaacccta tccatctact tccgaactct taatcctgtt gtggtcggat    313500
     caggctggta aaggaaggtc tggtgggaaa gaagaggaga aacggtcatt gctatgcaga    313560
     ccctctgtca ctcgttacca cagctcaggt tccgacaatg gcgtgaccag actaccatag    313620
     gattggatca tgctcgtcca tccatagccg ttaccggcgg gttatcgaag aatgggaagg    313680
     cttgttgatg agatttgact ctgcctggga tacgatgatg acgatgatga taatgatctc    313740
     aaggtcttaa cgtttgtgcg ctgatgatga aggcgaaggg ggtgaagaga atgattaaat    313800
     tgcatgcagc tagctagctt tttatgtatg aggccacggc gtggatgaac tgtgcacacg    313860
     caagcgttac aagaagaaac cgaattcata ttcatcttta tctatcttat tccttctcag    313920
     ttcttcatca tgttatgact tatttctatc tcatgttctc cccttatcct ttcccggcct    313980
     catacagaat gctacatcaa tactacgata ttacttacga tattcctgga ttctctaccc    314040
     tgaagcaagc aaatcctaga atgaatccag tcacgggaat ggatttgact ctgttttcgt    314100
     acgttatata tatacaactc agatattgaa ttcttcatta aatcgttgtt gagaacgtca    314160
     tcatctgcaa ctctgcgata tctatccatc gtaaatgtaa aacccaaagg gaaagcgtga    314220
     tagcaaggat ccgcatacat gaaccgttga tgaaaacagc atagtctaag acgttaagtc    314280
     aaggacgtga ggggtataga aggttgaatc tttagagaag aagagggaaa aaagaaaatt    314340
     tttgtagatg agagaaaaag gtatcagcta tggctccacg attccaaagg tgagtttggt    314400
     ggagatgctt aggagcggtt gatgggggtg taggcctgct tggggaaggg gaaactagat    314460
     gtcggacatt agggttagtg gctgctagat atgtgtataa tcaagaaatg gggttggttc    314520
     ggggacttac gaggcaccca gctcctggat gctgagggaa gcgagccact ggcccatgtc    314580
     gatgctgtcc tcgagggact tgccttggac gataccggcg cagaaaccac cgcagaaggc    314640
     gtcactgtgt ggtggttaga ttttgattcc cgtgatttag gttgtatagg aggttggtaa    314700
     cttacccggc accgttggtg tcgttgatgc tgctcttggg gatctcgcgg acggggatct    314760
     ccttgacctc gacctcgccg ttgggcttaa cggtggcagc gacggtgggg agggtgccct    314820
     gggtcacgat ggcgacacgg ggacggttgg tgttcttctt ggggagctga gccagcttct    314880
     tggcgatctc gacgacatcg tcggtgcccc agctgtggct ctcggagaaa gcacgagcct    314940
     cggtctcgtt acagaaggtg tagtcggtgt aggggaggac actgtccagc tggtccttga    315000
     agaactgggc aatgaaggga gcagagaggt tgagcatgaa gacctgtaat taagtcctgg    315060
     tcagtatgct gtcaatgaaa ccatttggag ttgcccatac cttgttctta gcagcagctt    315120
     cctcaccgag ggcctggatg gcaggaacac agacggtaag gtggaaacca ccaacgtagt    315180
     agaactgggc cttctcaacg agagaccaga cgtgaggctg cttcaagtgc tcgatcttgt    315240
     actcgttggc ggcagcaagg tgggtgcaca tgctgcggtt gtggccggtg atgatgacac    315300
     cgcacttgcc ggtgggctgg gcatcatcga cacggtattc ggtgtgaaca ccggcctgct    315360
     cgcaagcctc cttcaggatc tcggcatact tgtcacggcc gacacatcca atgtagcaga    315420
     cggagttggc gggaagagcg tactagttcg acttcacatt aacatccgtc cgtgtgtacc    315480
     ttggtaggaa gggatcgggg tcatctaagt acctgggcac cacgggcagt attctgggca    315540
     gcaccaccgg cgatcagctt aacatcgttc ttggcgaaga gctcgtcata aagacccatg    315600
     tgctggtcct cagcaaggat agcatcgttg tccttcagac catacttctg cagaagggcg    315660
     gcatcactag tgacaatgtt agaatacttg aaatagggtc taatcataaa gtagagtttc    315720
     cggaagaagt gacataccca acagcctgga tgtctatagg aagcaattca gaatgccgta    315780
     tgtcagctca ttgaacaatg taagatccgg ggatagtaag cagcataaga aagaggcaga    315840
     gaggggaaat ctcacgcacc gaggaggggg ttctccaggc acagaagagg gtaaccttga    315900
     ggagcagcca ttgtgaaggg tagagtggga gaaaatgggg gagaaaacag gtagagggta    315960
     tagaaaaagc aagggaggat atagagaggg agaagaaagg aagagagagg agggagagag    316020
     cagcgagata taccaagtca aggaggggca gccatgcaga atccaaaaaa ggcgggagta    316080
     atggctgccc cccgctgatt ggccgcagga accaacgagt tactccgtgc ccggactatc    316140
     ccatcattcc tccctacttg ctttagtcta tactctcaat cttactatct acaagtttta    316200
     agtccctccg gtgtcaaaac ccgcgggtcc gaaatccttc cgttcacaca gatacctaca    316260
     tccattctta taaaatacca cccatcatga ccgaccccgc cctccaaatc cccgaagtca    316320
     tccaaaccgc ctccatcaac ccggcgccgt ccccggaaca cgacgtcaac ccgcccaccg    316380
     cagcctccga gaagcagccc atcgtggaag acgatgtcgc ctccgaagca ggcagtatcc    316440
     cctccgatgt cgtcgatcct caccgcatga tcaagcccgt ctcgcgacga caccatctgc    316500
     ccccattgcc cgatctgcgc ttcgaacaga gctatctcgc cagcttgcgg ggagctgata    316560
     cctggggccg agtagcttgg attaccatca gagaccaggt aggacaccag tctgcccctg    316620
     caatacacta ctggcacaag tcaactggaa gcaaaagagt cctcaaaact gacacgaatt    316680
     gtctatatag gtcctcctcc ctctaatcca gggcaccgtc tggactctcg ctctctctgg    316740
     ctggcgattc tggaaccgca acgcgtccct cagtggccag acactcggaa gcaagatccg    316800
     gagatggtgg tacgaggtga acaactggaa gctgcctcct ttgcgatcgg ccagggatcc    316860
     tcacatggcg gcgaaggtgg aagacgtgag tgcatccatc ccattatcca ttcgcgtcgc    316920
     cctatcttcc tttttccccc caacccttga gatatctttc tattttcatt tcaattggtt    316980
     attcctctaa gccgagatat tcggtcacat atgccaatga gacggacact gacatttgcg    317040
     gagtttttgc agttctacac ggcccagttc tcgaatgccg gtgctgacta ggttgtcttt    317100
     tttgagttga tttgtatggt tgtcaaaggt attgatgtga ctgtgggtgt ctagtaaagt    317160
     ctgcatttgg ggagtttagc gtacggcgtt tatcctttcg aaccagtgag ctttgattga    317220
     ttgattgata ttaagctttc gtatatagcc tggggctttc attttctaca cgctatttct    317280
     ggtgtctaga gccgagggat acggaacttc tattgtttca tcccaatctt gcaatttaag    317340
     tactgtacat agcgcatagc agccccggca agaggtccgt ccatctggta tgacaggtta    317400
     tgtcttggag tcctcatctc tctaatacct aatcgatcca cagcatggtc atgctatata    317460
     gtagtatagc agtcacgggg aaagcactcc ataccacaca catcgcattt ctaataacag    317520
     cacaattttt tttgccgcaa agttgaaccc gacaaattcc acccacgaac agaacgcctc    317580
     gaagaaaaat gtgagcgagt cttgtctcaa gtctgagaag aaaggtattc cgatggataa    317640
     ctctatcaag accggggaac cggccactga gggattccga ccaatggtac tgtgttatag    317700
     tatatgtctc ttgcctaatt ctttttctta agccgtttgc gtcttcgtct cagtcgcagt    317760
     cggctgcgac acatcaacac tagtagaagt gctagccgca gcatcaggta gagactttgc    317820
     gaccacgtct ggttgggagc tctgtgccgt agcggattgc ccgttcagcg cgggtggtgg    317880
     ttgtccttgc agtgcatctt cggcaccagt cgccgtgacc ggtttagcca catcctcctt    317940
     gctcttcgga tcttgctgta agggttcctc tgctggccca ttggggctac ttggggcctt    318000
     gtccttattg tacctgagtt gtaccacaag gcttggtggt tctccgttca tcactgcttc    318060
     atccccactc agctcctctt cgtcgtcccc ctcgaaatcg ttgtcctctt cttcctcgcc    318120
     ttcgcctcct tgccactcat ttccgctgga ttgtcctgct tctgaacctt cgtccatttc    318180
     atcgtcctcg tattctgtat atccatttgc tcgagttgtc cgaccccttg agggtctacc    318240
     ctcgtcgcca gcgtcgccgt cctcgcgttg tccactcaac aacgtctcac cgtaaaggcc    318300
     gcctgcgcgg gaccgtattt gcctaccact agctgtgaat ctagggccgg ctggttctgg    318360
     gggtgtggag atccccgagg tgttgcgcgt tgagcgccgc gtggaaggaa ggccatcaga    318420
     gaagatgtcc tcgtcatcgg agtaggtgta tttcagtttc tttccgcgtg tacggccttc    318480
     atatagagag aagccaggct ccggccgagc gaatgccgcc tttcgcgcaa tccggtagtc    318540
     tcgacgcttg cgtttctgct actagtaagc accgagaaaa tgtaccacag ccaatagcag    318600
     cagcttacct cctctgagcc ctcgaagcgg ggtatcgagt tccttatcct ctcacttagt    318660
     tttttggagt ggatactttt ttcgccgtca agcctgtctg caaccgcctt caactcaggg    318720
     atatttcctg ccacactcca ccaggtaaca ttcttaaggg cagggttgcc ctcgcggtac    318780
     agtctgaaat gtgtatcatc caatccttcg atgagccagt atctgcgctt gaggccgtcg    318840
     cgaccccatg gttggacgga gagtggttgg ttcaggtcgt cttcgtggcg tgcctgtttg    318900
     taggactctt tgattttagc ctgaatggca tcggacgagg caagggacca gaggatcaag    318960
     gatctcaata acagcaacta gacagtgtca gctgataagc tctcggtagt tttgaatcaa    319020
     gttatgcgac gtacgcgttc ttctggcgac atggttgcga aagtgcgacc cccgtgcaga    319080
     gggttcttgc cttgccaagc cttaggccac tgagaagcgt gggtttggat cgcctcttcc    319140
     aagggacgct ggtagtgatt ccgactgcgc attgatcgag cgagttagct ttgatgtatg    319200
     gttaccagaa ttggtacata ggtggtcgaa aaggagcttc ccgacgtatc ttccaagagt    319260
     gtagggtctg gggcgtagga ggcagtcata ctcgacatcc ttcttccgat tcaataccaa    319320
     tccaagaaat gcacataata atctctcaat atgatcgccc ggaggagatt ccgcgacgcc    319380
     tctttcaaca tcttgtggtc caaagtgtgg tgtagatcgc gggaacgcat cgtgaaaacg    319440
     cgcacggaac attacaatga actacacatt gcgacaggtc agcaaacatg gtcagaaaac    319500
     gtgcaaaacg cgtccataga gcttggaaag agacttcatc atcatagaaa cctccgggaa    319560
     catactgcaa tatctggatt atccgccaac acatattcgt ggggtggtga gggctcccgc    319620
     ttcggcggcg gagattcgga ctccttcttg aagtacttcg cgatgccgac gggctcatca    319680
     atggccatgg agcccgtttc ttcgtcggac ggaggcgccg acgaaagcga cgataggtcc    319740
     gagtctgaga gcgacatgtt cgacatgttt gtggtgctgt ccgcaggtgg tggtggtgag    319800
     gcaagacaga gcgggcgaat ccgcggcaga agttctactt tacgctactg ctacctactt    319860
     gggttggagc gcggctttta cgcgcctggc ctgtctggca tcatcgagaa cagcccttat    319920
     ccagggatga tcaacaccca atcacgataa cacatttgct atcgcgaact ggactccatc    319980
     aaacgcgcga aaggtccgcg gaacagacta cattcagaag atttctttga taagagcatt    320040
     tagtgcaaag cagctttgta ttatgcaatt cggaagtctt aatagatcaa tactatccga    320100
     aactccgctc caacaacgaa cgagcgtatc taatcgtcaa acagcccggc ttagctccta    320160
     gaacattgga tactgcccta gtatcaaccc tgagagcgtc tgagcggcgt tctttaagca    320220
     gaaatctagt tctgcaagaa gttgccgaca ttcgagtcgc cggacgtgac aaacacagtt    320280
     tgtcgatcca cattgagcac ctggtggtgt caagatacca agatgacatt gtggtaatca    320340
     ccaaagatgc tgactcgctc cccaggcgcg tcaggtctca tttttccggg tacacagtgt    320400
     cacatctgga attgctgatc ggtgcgtgac cctgaggcgg cccggggcaa tgtagagaaa    320460
     gcccaacaac ggaacgagat gcggcaaaca tcaaggctcc gtctgctgac ccggatgatc    320520
     gaatttgacc actccgaacc agtatgatct gtttacatgg agaagacacc caaatgatat    320580
     agagacgcca gcaagacaaa tagtgctatt aagccaggtc agcccaggtc agatattgaa    320640
     aggcggtgcc ttgaattaat agcccactgc aaggacatct caggtaacag tagcaggagg    320700
     aacactgctt gttaagagac ggaatccgac atggatgagc tgcgagtgac cgagacagag    320760
     gcagggtaga ttgaatggga agcggcagtt caataaagaa cgaatttgaa taaagtgtgg    320820
     aattcagaaa gaagggatag tgtgtatcta gaagggaatt tcatcaccaa caacggttgc    320880
     actttatcag taacctcact actctgcagt cataataata accattcttt actcatgatg    320940
     atacaagaag ttcaccaagt gcaagatatg ttcgttaatt gcgaagtcct acgttagtta    321000
     tgccgtctta gtaagaaggc gacccgcgcc acgcagccgc gcccacaaaa cggcactagt    321060
     cctagcgcgg ttagattagc gacttccacc ctaaagccca cacagccctt cgccgacgaa    321120
     ttctcaacac caacccgaca agcccaatct tagcattttg aggtacgaga actcgaactc    321180
     tcccaccaca aggtcgccag gcggaacttt ctcaatacta acgtccaggt tcctatatag    321240
     acagtcgcca tgggtcgcgt gatccgcaac cagaggaagg gtcgtggatc cattttcagt    321300
     gagtgcgacc gcagagatcc tgaagcgaaa ttcgcagcat ctccagatca atttttactg    321360
     atacaatttt tcgctcgaca gcggcaaaca cccgtctcaa caaggctcct gcccagttcc    321420
     gcaccctcga ctacgccgag cgtcatggat acactcgtgg tgtcgtgaag gagatcatcc    321480
     acgaccccgg ccgtggtgct cccctcgcca aggtccagtt ccgtcacccc tacaagttca    321540
     agaccatcac cgagaccttc atcgccaacg agggcatgta caccggtcaa ttcgtctacg    321600
     ccggaaagaa cgccgccctg actgtcggaa acgtccttcc cctcgcctcc gtccctgagg    321660
     gtaccgttgt gaccaacgtc gaggagaagg ctggtgaccg tggtgctctt ggtcgtacct    321720
     ccggtaacta cgttaccgtc atcggccaca accccgagga gggcaagacc cgtgtcaagc    321780
     ttccctccgg tgccaagaag gtcgtcaaga acaccgcccg tggtatgatc ggtatcgtcg    321840
     ctggtggtgg tcgtaccgac aagcctttgc tgagtatgtc tccggaaatc tggctccgtt    321900
     gaatcactct tcggagagaa tgcggttaaa gaagaggact ttgatggcta actcattccc    321960
     tacagaggct tctcgcgcca agcacaagtt cgctgtcaag cgcaactctt ggcccaagac    322020
     ccgtggtgtt gccatgaacc ccgtggatca cgtaaggctc ccttcaatga ttttgtcgat    322080
     ttatctacag attctgacat gttttctcta cagcctcacg gtggtggtaa ccaccagcac    322140
     attggtaagg cctcgaccat ctcccgctac gctgcccagg gtcaaaaagc cggtcttatc    322200
     gctgcccgga gaactggtct gctccgtggt acccagaaga ccaaggagta agcgtgatat    322260
     tgtgtggagt tttctttgtg acgggttgaa aatgctcttt tgctatgagg catatgtact    322320
     taggcgactg cggataatct cccacgcgtc cttagcgaat ctaggtcgtg gccaccaaat    322380
     attttcatga tgaccaaagc aaaagaaatg ggttcaaaaa attcaaactc gggtgcatgt    322440
     tttttgagat atcctatttt aaacggtaga actaggaaga tctttcctgc aagtcatcag    322500
     gtccgtcaaa agaaaccgta ttgcgggatt cgtacaagaa ttggtctcta gctagccatg    322560
     cgagagattc agaagtagac ttcgaatctg caattgctgc tactttgctc agccattttg    322620
     cttgagtctc ctaagatcaa gtatatgcta ctttttctct tcataggtgt aagcgagcca    322680
     tcggatacac gccgtgagtt atcgaggata ttagacacat ttccacatcg ggttgaatgc    322740
     agttcaatgc tactcgaatt attactacct agccaccaat cttcttaccc cagatattgt    322800
     ggaccgggca attgcagaga ccttgaagtt cctgctactt aaagtaatta cgaaagtagt    322860
     tgagcacaga cggagtttat cctattactg cagtgcctgt gctcaggtcg gatatatatc    322920
     tgcttctcac cagattaggg tctaacacat tcattattgc cgtcatgcaa caaatgactt    322980
     cggatgtaat tagtacaatg cacatgagcc cttgaggcct ctttttgccc tcttcatgat    323040
     ataactattg aaagtatagg atgaaatgtc aatgatgcat gacactgcag caaccgagat    323100
     acgaaacctt gctcccaaag tgaccaatca cagccgaata ccatctaacc ccccaactca    323160
     ccatgaagaa ataaatggag gcgatttcaa gaacaattag caccatagac ttatatgtac    323220
     aaacaaaata tcatactcac tcaagaccaa taccaatctt ttaccccctt gatacctact    323280
     cctacatcca aaatggtacc acccccgaaa ctccctctcc ccaaaccatc cctatccccc    323340
     tcctccacat ccccatccac ccgctggctc gccatccaaa cccgcgaccc caaatttacc    323400
     aacgccttcg tgtacgccgt cctcacaaca aaaatctact gccgcccaac ctgtcccgcg    323460
     cgtctcgccc gacgagccaa cgtccggttc tacgatacag cttcgcaggc tgagcttgca    323520
     gggtttcgcc cctgtaagcg ctgcaaaccc gagattgtca tcaacaatag caacaacttg    323580
     ttgggggcgg gtagcaatac cacagctact ggtagtggta cttttagtac tactttccat    323640
     ccgcaaatcc cctcagtgca gagagcttgt cagactatca gggcttctgt gcaggcgggt    323700
     tcaaaaccga cgttgcggat gctggcggcg gaggcggggc tgacgccgag tcattttcat    323760
     agggtgttta aaagggtgat gggcgttacg gtggggaggt atgtggttga tgttataagg    323820
     aagagtggtg atggggaggt gttggaggga tcgtgtaggg attgggttgg gggtgagggt    323880
     gagggtgagg atgctggaaa ttggcccgtg ctatggaatg acttcgatgt tttactagcc    323940
     gctgaggagg aggatgggtt cgttgttcct actactgtta caatgcagga tgtacaacct    324000
     gtagtgccgg tgcaggatga ggaacttctt gcttggcgtg cagtaggttc ttacggcgtt    324060
     gggggagggt gttcggttga tgaaacgctt gcattgggtc atgaagcgct gtagaaatac    324120
     tttaagttgt tttaagcacc tattgtgttt gaagatgaga aggaatgaaa ccttatgagg    324180
     ggatgggtga tcgcagatta agcgatcctg tcgcatgaca tgcactgcct cgatgggacc    324240
     tgacagtaag ggttgtatac gcgtatccgc taaatcaatg tcttggtggg tttgccgcgg    324300
     atgttgatga cttacgtatt cgtattcagg ggaggggcga gacaggggat ggatgggctt    324360
     ccctgctcca gccagttgtg tcggtgcatc taaattgaat ggttcgggat cgcactttca    324420
     aaatacacgg cttgaacttg gttgacacga cggcatgaat gatgatttca gggagctctg    324480
     ttgtcgcagt agatcactac taccctgttc ttccgttgcc tatgatttct atcgtgtact    324540
     ggctcaccat cgaggtctat aaacaggaaa gaagccatat gtttgagtac cgcactacaa    324600
     gattcaagga gctgttgagt agtacgaatg atagctaaag aaggctgccg agtctggttg    324660
     tgttgttaac tgcccgaagg tacgacacgt gactgcatca aagaagtagt tcgagtgtga    324720
     cggtatgagg gagttgttat cttgataggt actcgacgaa gagccatagc acataagaat    324780
     agcatttact aagtacgata tatgtagtac ccaatcttgt gttagtagtt agtttagctg    324840
     ttgctcgaga ataagccaag tagaagaacc agatatatat actactaata ttgcctgaac    324900
     caatgtgatt ctcgaacaat gatacgagta ctccacaaag cttccgtaca gggattctag    324960
     tattctcaca atccaccctt aagtacagag atccaggaat ctagcattcc tgcttcagcg    325020
     ccgaggcgtt aagcattgtg atggtgttgg ggtagtcagt atacctcttt cccgcctgtg    325080
     gtcctcgggt cccacttttc tccgtgtagg ggtctccttt ctttctcaaa caaaaggtgt    325140
     gatcgttgcc cgtttgacca tgaacctccg catcgagtgt ttgtttcaga ttgagaaaga    325200
     gatgtgggtt taaggtcgtt atgactcttg ataggtttag tcgcaggatc tacgaattat    325260
     ctcttggagc cccggataag atcatcctga gatactctgt gctctcaccc aatgtaaagc    325320
     agacacaatg caattgatcg tttacctgta cgtggccgtg taatttaccg ccagtttccg    325380
     ccagataagc ttctctgact caccaatggc aatgattgtt gatgcatcgg acaggtcttg    325440
     catcatgacc cggtgatcgc gtcccacgct ggcgctttca ggttactgta aagagtcatg    325500
     atcagaggaa aacatattgt tacaaagtat tataggggcc cctctgccgt gtctgtcgct    325560
     ttggaccctg aaccataatt gcttgagttg gagtcctctt gaattgcttc cggacatact    325620
     gtgggagatc tttacacagc ctacagttca tcctttgggg cagccccacc tacaaggaac    325680
     agaagctcta ccctgagtct cttaagcatc atgattgttt gaataactga ctgaaccaac    325740
     cttttcgatg ctctccggac ttccagactc acaagactgt gtatctagac catctggtta    325800
     ctgggtaggt agccgcccac agtctgttct gtaaatagaa cgaatctcaa gtggtggcaa    325860
     aggagagctt ccaatggagg accacgtttg ggaccgacca tcggccatcg accgccaatc    325920
     gacggcagtg gatccccact gcaatggccc acaaacgcgt gtcacttccg gcagtccaga    325980
     atcggctctg gcctatgatg cttctcattc tgatacacct ctagatccgc tcaggtctga    326040
     ttgacaaacc cggttttgca ggtcaatgat aacgataggg ccttcgtcag caacttatca    326100
     accggctgtg ccaccggagc gtctgtacct tggctaaaac cagctaaagt agaccaaccc    326160
     actagttgga aattccagat aggagagctg ctaggtttca ggtacacctc atcctgctgg    326220
     gccaaccgaa cttaattatg gcggttctgg ccccgcctcc actgcccatt ggatggatcg    326280
     aaccctccat ccatcacagg gactgggttt gcttcacaat ccgtccgtag gatggttgaa    326340
     tatgatatac tgactgcctc gggtttaggg tagaattaac ccagtaaagc atgacactct    326400
     ggaaagaaag gatggatggg attaggacag accaagcaag gcaacgagaa tcatcatgcg    326460
     accaaattct tttcccgggt ccgtttgggt cgagcgttgg tgggggagaa aatccgctgg    326520
     gaaccttgaa aaggcaatgt ggcgctttcc gtgcaaccag ctccatcgca gagtgtctgg    326580
     cccgcttgcg attggcaatg gcattgtggt cgttgctgtt gctgtctgtc attcctcgat    326640
     gaacactgcc atggtcgcaa tggcagcccc ggatttacta ataatattct cttttgtccg    326700
     gaaaaaataa ttaaggtagt aataataaaa atactaaaat aataatcaat aggcataata    326760
     atagtaaaag gaaaaaataa tcccacctgc taatttcccc tgtcaccctt ttcgagcctt    326820
     cccttaagac ccaacccgtc cctcctggtc tgtcgcaact ctgctgcacc ttttcttttt    326880
     accacctacc ctttctgttt ctacttgctt gctttcattc tcacttctcg cctcctggct    326940
     gtggcgccat ctttttgtct catacgcagc agcgtgcttc ttacggatcc tgtttctttc    327000
     gtttcaattt ctcttgcaac aaccctcgat tggagaaaca aacatcacca agacggttta    327060
     acttaatttc tggtcgcatc gtaaccttca tttccctaga gcataaacct cggatcaata    327120
     cgacattcgt tttcccactc tatttcctat ttaccctata atccgtcaac atgaacgtca    327180
     atcgcaagtt cgatcgcttc aagcaatggg cgggggagag aatgggcgga gaggccaaga    327240
     ccactctctc cgatgacttc aaagccttgg aaacagagat gaacgtgcgc cacgagggta    327300
     aggatcacga cacccaagtc tcatggtata tatccggtcc atttactcat ttgctaccct    327360
     ttaggaattg accgtatcca caaggcgact ggctcttaca tcaagtccat ttcgaagcgg    327420
     agtgaaggtg acgataagga aaagaccttg cccattgctc atctgggtag tagcatggtt    327480
     ggccatggcg aagacttcga tgcgaactct gagtacggcc gctgcatgac cagtaagcta    327540
     acataactac tgattcgcaa gctttatgct gatgacgttg tctacgcagt gcttggaagg    327600
     gccgaggagc gcctggctcg tctccaggac gcttacatct cccaggtaaa cgcggggtgg    327660
     ctggaatcgc tggagcattc cttgactcag atgaaagagt accaggtatg acggagtttg    327720
     cgagcaccaa ttgagtggtc tgaaatgctg actcgatgtt tcacagactg ctcgcaagaa    327780
     gcttgacagc cgacgtctgg cctacgatac ctccctctcg aagatggaga aggcgaagag    327840
     ggaagatttc cgcgtggagg aagagctccg gacccagaag gtcaaatatg aagaggccaa    327900
     cgatgatgta tcacggcgca tgcaggacat caaggactcc gaagttgacg gtgttgcgaa    327960
     cctggaagcg ttcctggagg ctcagcttga ctatcacgag cgctgtcgtg atgttcttct    328020
     ccaactcaga tatgactggc cgagcaggtg aggattgctt gaattgtaaa gctacatcgt    328080
     catgctaacg tactagcaga gcccagcctc ccagcacccg tcgtccagga cgccctcgct    328140
     ccaacactgc gcattcctat catgaacgtt atgaaccact gcatgaggag accgacaaca    328200
     cggctgatct gcggcctatt attcgatcga ccagggcatc ttctatcgag ccagctgcca    328260
     gagaggtcta cccgccagat gctttctctc agagacctgc tctgaacaga actacgacat    328320
     ttgaaggacc tacgcaattg cgccaagagc aatcccctgg cacataccaa tggccatccc    328380
     gggcagctag tgacaactat attggccgca gaaatagcgt gcagtcccgg accatgggca    328440
     gatcatatgt tgacccgtac atggaacagt cggaggagcc tagtcctatt agcggcacca    328500
     gtcccgagag gacgtatatg gggcggaatc catctccagt gtcttcgtat ggaggtgctg    328560
     tctcgagaaa gtccagctct actaccctga atggcacacc actgaacaag aaggctcctc    328620
     cacccccacc tccccgctcc aagaagcctg cgccgccacc gcctcccatg aagcgcccta    328680
     tcctcagtgc aggcgaatac tgagtctttt atttgctcac ggtgtatctt actacaaaca    328740
     agctggacct tggaggattt ggcgggctat ataccaaatt gttgctcacg gatttccgga    328800
     aaatctgtct agcgggggtg gttggccaca tatgcgctgt attcatctct actggagagt    328860
     gatggataga actaataaat cggttggcag agcctcgcac ggtcgctagt agtctgaaaa    328920
     ggttgatcag cgataatttg ggcctgcagc agcagcagtg gtggatgaat gccacggaac    328980
     acacacagga caggtgtccc acagacgtgt tagtgcataa gggatgggtt tttgtttttc    329040
     ttttcttaga cggggttggt agtgtaaatt attcagtcct tgggataggc atttatcaag    329100
     tcatcggcgt ttgatgctgg cgtattcgta taagcaccta acaatagttc tctcctcaac    329160
     gtagtatccc gatgttagcg cggagtgccg agggcgggca cgacgctagg tccaaggcgg    329220
     gcaagccggt gcggcctagc tgagtcagcg acgggcgcgg gcagtgaata cacgtgaccc    329280
     ggcacgaaat cttcttccaa cgtctcgccg cctgcctctc ctcgttacag gcacaggctg    329340
     agcaccgcca gtttccccga ccagcacgga aagtcgcgaa agccccgtcc cctccatctc    329400
     catttcatcc agactggcct tccacgcgcc ttttccaacg cggcccctcc gtctggggtc    329460
     ctttccaccc ctacatcctc gtgttttaca cccccttccc ccttcttcct gattctcctg    329520
     ttttgtcacc taccgccctg tgtctccccc ggcctggtcc aaacatcacg aaacttgtcg    329580
     ccaaggtcca gatacagacc gctaccagtc gcattcatcg acataaggag ctccccatcc    329640
     ctccacatca gtaatttagc gcactcgatc gcccttccct gcgcaaattg tcatttaccc    329700
     tcgctgtcct caattcccac gtgtttccct aggcgcttgt tcggggcctg tcgcatccag    329760
     gtcgcttcca cgtcgccccc cagcgtgtcg tttcgcttat gaatacgtcc accacgcgct    329820
     aaaccatggc ttctctccag tcagcaccca gtatggcggc tggaaacatg tcgttgccgc    329880
     caaacatcac gcaacaacaa atccaagagg tcttccaggt atgcttttcc gtcccttgtg    329940
     gaagcactac caccacacct ccctgttatc tacctgcttt ctctccctca atatatattc    330000
     aattaatttt caaatgtaaa atccctctga catagctcct cgatagaaat tcaaacagat    330060
     gcaggaacaa ggcgttcgcc atgatgaccc tgaatacctt aaggcccaca atcttctatc    330120
     agcctttcaa cggcaacaag cctaccacaa acagaggcag atgcaacagc agcaattgca    330180
     ggtgcagcaa cgtcaacagc agcagcaaca acaacaacag cagcaacagc agctcaatgg    330240
     ctcgaatact gatgctgtcg ctgcgaatgg catgaatggt acgtcctatc tcttctcatt    330300
     gtacatagca tgtcgtatgg cttgctcatt gactcggatc cattataggc cgcaacaatt    330360
     ctattcccag cgcgacaaat accaatatac cggatgccag cgcgacaggg ggtcaacagc    330420
     ctgtagccca gggcgtccct cagaaaggcg cacctgggac cgggaatagc ttctctgctg    330480
     agcagcttgc aacgcttagg aaccaaatcc tagctttcaa gatgctatct aagaaccttc    330540
     cgattccggc tcgcgttcaa cagcaacttt tcccttcgaa gaagcaggag actcctgctc    330600
     catccgagaa tgtcgcggct gcggaaggcg tcttggaagc cactgctcag agcaagccgg    330660
     atcagccaac tacaacagaa gcccctcagc acaaagattt ctatcagaac ttccaggcgc    330720
     catacgatct gatacccaag actgtcagct ttaccgacca cgcctctcgc gccaaccgca    330780
     tgcgtattcc cgctttgatg ccacctggaa tcgacctcga gcaagtgcgc gaggaacggg    330840
     aaatagccct ctacaacaga atcaacgcac gaaaggcgga attggctgag cttcctgcca    330900
     atattggcgc gtgggattct agccagagcg acaccgccac tgcggatgac tctgtgaagc    330960
     tcaaggccct tattgaatac aagatgctca atcttttacc gaaacaaaga cttttccgga    331020
     agcagattca gaatgagatg tttcattttg acaatctggg catgactgcg aatcgttcga    331080
     gccatcgccg tatgaagaag caatcactac gggaggctcg tatcaccgag aagttggaga    331140
     aacagcagcg cgatgctcgc gaaacgagag aaaagcgcaa gcagtatgat catcttcagg    331200
     ctattcttac tcatggtgcc gagttgcaga ccgctgctgc ccaacagcgt actcgtatgc    331260
     agaaactggg ccgcgcgatg cttcagcatc accagcacat ggagcgtgaa gaacagagac    331320
     gtgtggagcg taccgccaag caacgtctcc aggctttgaa ggccaacgac gaggaaacgt    331380
     atctcaagct gctcggacag gccaaggatt ctcgtatctc tcaccttctt aagcagaccg    331440
     ataacttcct caaacagctt gctgcctccg tccgggagca acaacggagt ctggccgagc    331500
     gctatggcga agaagaccag ttctttgaag aagatgaaga agaggagatt gcttccggaa    331560
     gcgaagatga aggtgacgga aagaagaaga ttgattacta tgccgttgca catcgcatca    331620
     aggaggaggt gactgttcaa cccagtatcc ttgtcggtgg tacgctcaag gagtaccaga    331680
     tgaagggtct acagtggatg atttccctgt acaacaacaa cctcaatggt atcttggctg    331740
     atgagatggg tctcggaaag accattcaga ccatcagtct aatcacttac atcattgaga    331800
     ggaagaagaa caatggtccc ttcctcgtca tcgtccctct tagtaccctt accaactgga    331860
     acctcgaatt tgagaagtgg gcgccgtctg tttctcgtgt tgtctacaag ggacccccca    331920
     atgcccgtaa gcaacaacag caacagatcc gttggggtaa cttccaggtt ctattgacaa    331980
     cctacgagta catcatcaag gatcgtccga ttttgagcaa gatcaagtgg actcacatga    332040
     ttgtcgacga aggtcatcgt atgaagaaca ctcagtccaa gctgagcagc acgctttcac    332100
     agtactacac tagccgttac cgtcttattt tgacgggtac acctttgcaa aacaaccttc    332160
     ccgagttgtg ggcactgctg aacttcgtcc tgcctaatat cttcaagtcc gtcaagtcgt    332220
     ttgatgagtg gttcaacaca ccttttgcca acacaggtgg acaagatcgt atggaactga    332280
     gcgaagaaga acaactgctg gtgatccgtc gccttcacaa ggttctgcgg cctttcctgc    332340
     tgagacgtct gaagaaggat gtcgagaaag atcttcctga caagcaagag agagtcatca    332400
     agtgccgttt ctctgcgttg caagccaagc tatacaggca gcttgtcaca cataacaaga    332460
     tggctgtcag cgatggcaag ggaggtaaga ccggtatgcg tggtcttagc aacatgctga    332520
     tgcagttgcg aaaactctgc aaccatccgt tcgtgtttga gccagtggaa gaccagatga    332580
     accctggacg aggaaccaac gatctgattt ggcgtactgc cggtaaattc gagcttttgg    332640
     atcggattct gcctaagttc cgagccactg gccatcgcgt cctgatgttc ttccagatga    332700
     cgcagattat gaacattatg gaagacttct tgcgtcttcg tggattgaag tatctccgtc    332760
     ttgacggatc caccaaatca gacgaccggt ccgatctgtt gaaattattc aacgccccgg    332820
     attcggaata cttctgcttc ctgctatcga cacgagcagg aggtttgggt cttaaccttc    332880
     agtccgccga taccgtcatc attttcgatt ctgactggaa ccctcatcag gatttgcaag    332940
     cccaggatcg tgcgcatcgt atcggtcaaa agaatgaagt tcgtatcttg cgtctgatca    333000
     gttccaattc ggttgaggag aagattctgg agcgagctca gttcaagctc gatatggatg    333060
     gcaaggtcat ccaagcagga aagttcgaca acaagtctac caatgaggag cgtgacgctt    333120
     tgctgcggac gcttttggag actgctgagg cagccgatca gattggtgat caggaagaga    333180
     tggatgacga tgatttgaac gacatcatgg cgcggtccga cgaggagttg actacgttcc    333240
     agcgtattga taaagaacga cagaagaccg tacagtacgg ccctggtcac aagtaccctc    333300
     gtctgatgtg cgaagaagag ttgcccgaca tctatcttac ggaagacaac ccggtaactg    333360
     aggaggtcga tgttgagtta gctggtcgcg gtgcacgtga acgcaaggtt acccggtatg    333420
     atgacggact taccgaggaa caatggctta tggctgtcga tgcggatgat gacacgatcg    333480
     aggatgctat cgctcggaaa gaggcgaggg tcgagcgtcg tcgggtgaac aaggagaagc    333540
     gtcaaaagaa aacagtgggt gattcttcac cggagccttc ccgcgagaac tccgagacgc    333600
     ctcagccgaa gaagcgtcgc aggggtcccg ctcccaagcg caaggctgag gaggttgtgg    333660
     aggaaacgcc tcagccaaag cggaagaggg gaagacaagc caagccggtt gagacgctgt    333720
     ctcccgagga tcgtgccatc ctgcaacgca tcgtcaatac cgtataccaa gcgttaatgg    333780
     atatggaggc ggagctgccg gccgattcgt cagacagcga ggatggccct gttacgcggt    333840
     ccatcattga gccatttatg aagccaccgc ccaagtcgca ttatcccgac tattacatgg    333900
     tcattcagaa cccgatcgcc atggatatga tcaagaagaa gatcaaccgt gaggagtatc    333960
     agagcctgaa ggacttccga aatgacatcc atctcctttg ccaaaatgcc cggacttaca    334020
     acgaggatgg cagcatcctg ttccaggatg ccaatgatat cgaggtgagt acacatctgt    334080
     gagcagacga gattgagcag ttactgaccg tacctaggca aaatgtttgg cggagctaaa    334140
     gaaggagacc gaaggctacc cacagtttgc caactacgat gacttgggtg gacaaggcgg    334200
     aaatgatcag tcgactgctg cggcatcggg ggccgaaaca ccttcagcgg ttgctacgcc    334260
     aaagctgaag ctcacgttca atagcggcaa ccgagacaac gccgcggctg caggagccgg    334320
     caatggcgtc aatgagaatg attgacattg ctaatagacg ttggtgaaga catagtggct    334380
     gttatttctt gacatggttt aacgtgttgc aaaaacttcg aatacctgca cattacattc    334440
     tatgctgttt tgatctgtct ttgatatgcc cccccttttt tccctaccga cttttgctct    334500
     gtggatggcg ttcctgtgac cttttggtgg ctggggatgg acgatggttg atggcgcact    334560
     gctctattcg atttgaagac gagcgatttc tccttttaca cttctctccc cggaatcctc    334620
     ttcgaatttt ctattactac acctgttttt ctttctctct ctctcttcca ttttcctcat    334680
     ttgagtgccg acgatgtcta gaccgggcag gtcgtggatc tttcactgtc acttcggact    334740
     cggctgggag ggttctgccc gccaggggag tctcgctttt gaagatgaca ttggttgtaa    334800
     ttggatcttc aactatgtga tttattagcg acggtcaatg tagccctacg taatgtacca    334860
     tgtttgatgt tggtgtgcaa aattatgccg tgtggattcc tatagctacg agggtagaca    334920
     gattgattgt gagataccga caatgagaat atcattgtaa acatgccatc gtgtatttca    334980
     aaccagcttg ggcctgaatt atattggccg acttcgtagc tcggtcgcaa gatgcccgta    335040
     aggcagtaga tgcttacacc atgagataca ttatgacacc gcaacatgct atctacacat    335100
     tcgaattgga aatccatatt ttacatgagt tcttcgactt tcagcctgtt tccagtaagg    335160
     agttgaaaac caacgtgtgg ttcgctaact atttagttag gaacctctct gcctatcagg    335220
     ttcacaggct catagatggt gggataaagt gtactatgga ttgaaatgga aactaattcc    335280
     gcacacacaa acacagacac aaacaccggg cacgataatc cacttctttc caccagatct    335340
     gtagtctagt attgtctagg atttcaggac accttctatt gatataagaa ttacctacgt    335400
     gattttctag agagtttttt tacacctaca aaaattcgat agatagttgc attccgactt    335460
     gtgtgggaat gggtttgttg gatgcaactg cagatcttgt tacgtatcag acccccggtc    335520
     aatccagtcc gaaactttgg taagcgatcg ggattcgttc gatctttgga tgggacggga    335580
     atggatctct ctttctccgt gtctttctct tcctctctaa actatgtata gaaggtgggc    335640
     atattactgg gagagaagga ggttcggtca ttggttgatg gggatggatg cagatgcaga    335700
     tttcatgtac ctacttactt agttactact aatactacta gtcctactaa attcaagcaa    335760
     ggtcctgaat tttgtcctgg tcgggaggaa ctcttatcga cacagatact ttttggtggt    335820
     tggagtgttt actcctatca tttaacatca cagtttactt actaccttta tatatgctgg    335880
     atgatagata gtatgtgcac tatgtagagc catatcagag tattagttag tcgataacta    335940
     atattaatca ataactcact atttaatgtg agggataatt ccagccccag tggagcccaa    336000
     aacaaaaaga aaaaaaaagc tgcacaagaa aaaagccctg ccgccggggc ccggacgaga    336060
     ccccccgtaa catactatac atcgctgata ccgagcgtat cgatcgaact gtctggaaag    336120
     aaatccctcc agaactccgt ccaagagaaa gtacactgac tgtaggaaag agataaaaaa    336180
     tcctcagaaa tcaagcacac gaccagcatc cccatctgac ccaccttgag atgcactctc    336240
     atgtgcttct attccggtca aacagattgc ttgctggaac gtcatctggg gacaataatg    336300
     gccagccctc gacgtcatga gcccatcacg tgaccccacc gtcatcccgg ctggcggttc    336360
     cgtaaccgcc agctcgtcct ttcgaatctc acctactcgt tcgtcctcct ctcctcttct    336420
     gccgcgccct gataacgacc gaatccgact ttcgctttcc cttctccaag agtttacgaa    336480
     cccagatctt tcatccttct cctagtacag cttctgctat cttcattttc cttcgaaaat    336540
     ggcctctttc caggatcgtg ctcagcacgc cattgcccag ctcgacaagg aggtaagtcg    336600
     tgtgtgcgtt ttctggtttt gtgtcctatt cctcctccct gtctcccccc caatcggttt    336660
     gcgaaagggg tttcctttct acctgcattg tatctgctcg tttattcctg tcttacaatg    336720
     tttattcatc acggattgga atcgtcggag agctggagga tgggatgaag tcgtgttgtt    336780
     gttctccgat ttctgcctac ttgcatattt ctcagccgcc agtttcgaag ctaaactaac    336840
     catctcctct tcacacttta gctctccaag taccctgtcc tcaacaactt ggagcgccag    336900
     acctccgtcc ccaaggtcta cgtgatcctg ggcctggtcg gcgtctactt cttcttggtc    336960
     ttcttcaaca tcgccggtga attcctcgtc aacctcgctg gtttcctcat ccctggttac    337020
     tactccctga acgctctgtt caccgccgga aaggccgacg acacacaggt atgctccatc    337080
     tctttattcc ctactgtttt cttagatgat aattgtgctg atgatcgtga ccctgcgttt    337140
     agtggttgac ggtatgtttc tcgtgatccc cgttatcgcg acatgactcg ggcgtttcat    337200
     acgcctaggt tatctttctg cacgtgacga cgtgcgctcg tcagctagcg gttatactga    337260
     ttggcatgtg attcttctag tactgggttg tttacgcctt cttcaccgtc attgagagcg    337320
     ccatctctgc cccctactgg ttccgtaagt attcgcaacg tttgatgtga ttcctacagt    337380
     ggaaagtaca taaactgatc gcgacgcttc aacacagcct tctactacat cttcaagttc    337440
     gcccttgtcc tctggatgtc tcttccccag accaagtaag ctatccactt cccgcagctc    337500
     cgaaacccat tattattatc atcaccagaa ctccgactga ccctcttctc cagcggtgct    337560
     caagttgtct tccactcctt catccagccc gtgctcggcc gcttcttcca gggcggttcc    337620
     acttcggcca acctccgcgc ccaggccgag gctgctgcta aggaccagta aatagctaaa    337680
     ccgcgaactc cgggtgaatc tgtggcttga tctcggtcaa ctcacagagt cagtcgtgtc    337740
     tcggtttatg ttttggagga attttgcaaa acaaaggcaa ttacgaaagc tttccttcta    337800
     ggatcctttc aatgccgata tgtttggaga aaatcgatgt aactggatga agcggtgtga    337860
     ttgattgatt gattgactga ttgatacgat acgatacttt gagccttgtc gggcgagaat    337920
     tgggctatcc ttgtgtggtt gttttcatgc tgttcatttt tgccatgact tgaatctaag    337980
     tagaattgcg tgttgaatct tttcgcgttg gttggaaagg ggagaggtta tcacgggcct    338040
     aatatccgtg ctctctccca tggctgtgtg gtattattat tatagctata ctttgatgca    338100
     ttatgcctcg tttcttggta aattgagcat tgtcaataac ttgactggac tggacttgac    338160
     cctcctggtc attcattcat tcattccttt tctcgtgtct tctcttgtct tctcttgtct    338220
     tccttctctg tcgaagggaa atgggagagt gtaagtggcg gacattgggg ggtggggggt    338280
     ataagaacat ttcatcctct gaaccgaatc cgaaggagac gcatatgata aaggggacaa    338340
     aaagaagcgg gataaaatac acttgcaaga gaatcaaagc tggttgttgt tgttgcgaat    338400
     gccaccgacg ccggaatgga aacggaccag gggtggcggc aggctgctac tcctgggcaa    338460
     acacatacta tgacataggt agcattccat atgcatcccc agacgtgccc tgccgcgcca    338520
     gcctgccctt cggattgtct tcatgtatat catatcaata ttgcgtccag gtgaccgtag    338580
     cctgggcaca ttttttgtgt gtgattaaaa ggaaagaagc agtagagggg tagtaggtag    338640
     gtagcctgca tcagtataac ccaaagcgat tctgccaacc atccgatctc gggtttaaaa    338700
     ccacgcgata aggaaacgga ttcgaatcgc tcgtagtgat cgggggaatg tgctccttat    338760
     cgcggttaac cacggctagg atcttcagga cggctttctg aagcatattc tccattgctt    338820
     tgcgcacttt ggcgcgttct agacccggca atcacatgtc agtacaaggg agagaggcaa    338880
     tggcttggca gatggggggg gggggggggg aggtgggttg ggttgcgtcc ataccagact    338940
     ctgttcgagg agtggctatc gtcacgtcca aattccacac ttcccagcat acttcttcct    339000
     cgcccttccc tgatagtccg ccaaaccaga ttcccggtcg tcgacgtcgc ttttcgtaga    339060
     attccacggc catccgtgcc cggacacccc cgccgccgcc atcgggggcg ctggcggcgg    339120
     aggagtgctg gcggacgagg gaactcacac gggagtcgat gagggtttcg aggtctacgt    339180
     cgttgatggc ggggagggtg aagtcgagga cgtcgaaggt gattgggcgg atggagggga    339240
     agtatcggtg gaagaagatg gtgttgagaa tacctgtttg tggagaagag atgttagtat    339300
     ttaggttttg tagttataga gacgacgatt cagtgaagag aagaactgac tcacctttta    339360
     acacgtcgcg gacgttggtg gtatctgcga agatctccaa aaagtactcc gggggcgttt    339420
     tgcggggctc catcttgatg ggggcagcga ccggtgccac cctcttgttt aagatggaga    339480
     aattaactga gctcagcgat cggcaagcac aagtgacggt ccagttaagt tccaagctga    339540
     gctgtccagc ggggaagggg ttccgacgtg tttagtcgaa ggatggatca gatcgagtct    339600
     ggggttgaag ggggaggaac cagtgatggc gatgacgctg gcgttcgggg ggggagggag    339660
     ggggacagag cgggattgat tgactaggac cggtgtggag atgttggcat ggagaaaggt    339720
     ttatggggga ggcatggttt gctggggata taatccatgt gtattcaagg attctgaagg    339780
     gcagagttat atatggagga gaaagaaagg aagagaagag aagagagaag ataaagaaag    339840
     gaagatagaa gacgatgatg aagggaagaa taatggagag tcatggcgtg tatgtaatga    339900
     tggggagccc ctcgcctgtg acggtatgat ggctgttctc cttatccctt atcagccctg    339960
     atagggggca tccgcgtctg tatcgtctgg tattggcggt acctggcaaa ctgcgtccac    340020
     gtcggacaga atcaggctga gatgcaaatg aaaagaacag aaacaccgtg acttctaata    340080
     atgatgatgc aactaatcgc ggggatgaag tggcacaaac taatgccatt cggttcttct    340140
     tcccagtccc cacaacttct gtctgtctac tagtctaatc atgtacagag catagatata    340200
     tctagtctat atcctcgcat ccgtgatagc ctgacccgct ggtgacgatc atacgtggtt    340260
     gctgctggct gctctttagc cgaggccgct ccagggaccc tcgatccccg accgtgcttc    340320
     ccgtcgctct tccatcactc acgccgtctc ttcggctttc cttgtgattc ccaacctcca    340380
     ttcttctttt tcttgctttc tattttacct cgtacgatga actacgctgc tccctgtatc    340440
     tgagaaactg ttcccgatca tctttgctcc ataatgatca gtgctactaa gcgctggttc    340500
     cggcgcaatc gcaagggcct tgcgatcgga gctggcgtga tcggagcggg ctatcttgca    340560
     ggccagtatc tgctgtccaa gatctcagag gcacgcgagc gcatgagtag tgaccgcatt    340620
     gctcgggaga agtaagtgat gggcctccct tacctcgcat tatctcaacg ctgtgacctg    340680
     ctcgcgtgtt cgaaaacggt aactgacggc tattgcctct tgtccagctt gcggcgacgc    340740
     ttcgaacaaa atcagaccga ctgtacctat actgtgctag ctctattacc gaccgcggca    340800
     gaggatatcc tcgaggcact tcccgtggaa gaattgacca aggaactcca gaagaagcgt    340860
     gccgagcgac tagctcgtct taacgctggg gaaggaacag gctcggatct aagctcggtg    340920
     ggccccagta taacggacga cgatcgccgc agcttgtcta gcttccaaag cgatggcttt    340980
     gtccgtacga gtcaattagg ggagtcgacc atcgagggga gcggctcacc acggccgaag    341040
     cgaaacaaga ctcagctatg gaacgaagtc aagataacct gtcagtcacc ccatattgtc    341100
     acttctttac aggaaccaag gagtctaacg gaccatcata gctatcacta ggtcgtttac    341160
     actcatctat accctgacct tgctgaccat cttcactcga atccaactca acctgctcgg    341220
     ccgacgcaac tatctgtcca gcgtgatctc catggctaca ccccctgcgg atggatcgac    341280
     tattcgtctg gaggatcacg atgatgatga cctcacacaa acactgggaa atgactttga    341340
     gacaaatcgg agataccttg ccttcagttg gtggctgctt caccgaggct ggaagcagtt    341400
     gatggaggag gtgcaggccg ccgtgacaga ggtgttcggt cctttgaacc cccgggagga    341460
     catttctgtg agcaagctgt cggaattgat cctacaagtc cgtgggaaga tagagggcgt    341520
     gaccgaggag gacaggaagt acgttgacta tgagcaagtc ctagtggccg ggtgctgacc    341580
     gttcatttgt cttatcaggt atcggaagtg gttgtcttat gtgctcccct cgcgggaaga    341640
     ggaggaccat ttgttgcagg agtctggggt tctcggagtg acggaacccg cgacgcctca    341700
     aacaacagca tcgctgcgcc atctcctgga cgagacggcc gatctgatcg actctccgac    341760
     tttcactcgt gttatgttgc ttctcaacaa tgaatgcttc cagactctca ttgaacaatg    341820
     caaggccgac gcgttcaagt cgtccactca ggtgcccacg tccgttcctc agtcgttcac    341880
     atcggtcgcc acggtcgtcc ccgcggctga cggctccgac acgaagacga agctggcaaa    341940
     cgtgttggcc gttctggctc gacaagccca tgtgatcgga aatgggacag ctccccccaa    342000
     cttgtatctt acttccatcg aacaaggagt acgagagctc gaggcctttg cggctgttat    342060
     atacagctca aattttgact ctgagctgct tgggaccgat ccaaggacgc agccatcggg    342120
     agcagaggcg ggctttgagg ttcctacatc gcctgccccc gagatgattg agaaggagga    342180
     ggtcagcgaa gaaggaccta ccccaggagc gtccgtcgta gcagtggacg atgactcggc    342240
     ctttgagaag gcatggggaa aggctgtaga cgaccaaccg tcgagcagtt gaccgtgtga    342300
     ctgtatgcgg gcttttagag aatgttgggg aagttcggga atatctgtgg cataaatggt    342360
     ccctaatcta tccggagtct cgtctcggcg cggactgagg gaagatatgg tatgattgta    342420
     tgatagctcg tggtggcgag taactattct ttatgacaag ctagcttata tgggttatgg    342480
     gtattctaga atcattaccg gaagggcggg gcatgttgct agactggatg ttgaaagtat    342540
     cagtattctc gtccgcgtcc tcacttctca gggtgttggg ggggacgtgg gacgaatgaa    342600
     gggcagcacg tggccagcca ctgccacaca tgatgggccc aaatgagcag acttgacaat    342660
     ctttgccgag cgacttggga agacttcgat ttgcgcgctt atgcaggttg tacgactgta    342720
     tacggcatct gtgctacccg gtccatatct ctttgctctc tcattgggcc tacatgtgca    342780
     tttagctttg agttgcgacc tgtggctgga ttctgtagtg gcctgaaagc atgaaattcg    342840
     acagcgcgca gatacttcgt cgtcgttcga atgtccataa ctctcccgat tttgcccagt    342900
     gcttagggaa cgaactgctc gagaacagcc gattgtgggg tagataagct tagcgaagga    342960
     agggatctgc ggggaaaggt gggtttggca cggctagtcc agtattatta tctattgagt    343020
     ccagtggagt tggccatggc tgggctactg cttaaaagta cctgctcact gcttactctc    343080
     tactccttac tagactagga ttgtgatccc cgggacaggg aactggcaga ctggatggag    343140
     ctggcagccg ggcatgttct cctccattcc attcctccta aactctcttc ccctcggcat    343200
     gttacatccg tccggactgg catcatcttt ggttcctacc cagataaagc catcaccatg    343260
     gcctcagact gtgcagataa gcaatcggat gaaaccttcg agtggcacgg cttgggagcc    343320
     accatggatc ggacaatcat gctaagcaat gcccagcctg tcaggctatc tgacttgcgg    343380
     attaggccga aatgggtagg atttgtccga cccgtcccat tttcctcgct aatgtaaggc    343440
     ctccccgagt caatgagtta attggtcctc gtccactgcc gtgttcatca cagcgggctg    343500
     tataggctat tggttaggct agatggttcg tcagccgcca tcgatgcagt ccgtattcac    343560
     tatcaatctg tctggcaccc ctgcttgccc ctcttgtgct gtcttttctt ctttctgctc    343620
     ccctatgcat ggccaattgt cgtgatcctc tactcaaata gtgtctctgc gccgtatctc    343680
     gtctgtttac gcgctcatcg tgtcatacat cccttgcttc tcgaacttta ttttggcacc    343740
     ttttatctgc cgagagtacg cccttgtcaa ctggagtaat ccggtcacga tatttctatc    343800
     tatcgtgtcg caataccgcg cagagacaca gaagcgtaca acaatattca tatttccgcg    343860
     cacaactcgc gatggggtca tccgaaggta cagttcatac gcatcgaggt ctcacgaaga    343920
     cgataatgac ctcaatttgc gtaaacagag accatagacc gctctcctca gcccggaccc    343980
     ggattgaaac ctgaggacca cattgaagcg cttccctcgg acctccctgt tcttaccaca    344040
     accacggagc gcaggctctt ggccaagatt gactggcaca tcgtcccatg tctctgtgtt    344100
     ctgtatctac ttgctttcct ggatcggtat gtgcctccgt gctgtctttg taatgagatg    344160
     tcatttccat aacagtttgt gtctggtaca gtgtcaatat cagtaatgcg gccgtactcg    344220
     ggctcgaaac ggatctcaac atcgcgactg gaacgaagta caataccgca ctcactatat    344280
     tcttcgtgcc ctacgttata ttcgagatcc cgtccaatat cttgctgaag aaactgaaac    344340
     ctcatgtatg gtgtacgtgt cctacgtaca tgaacgccgt tgtgcaccgt ttactgggtt    344400
     gctgatgatg gcagtgtctt tttgtatgtt cgggttcggc ctcgtcacga tatgtcaggg    344460
     cttagtctca aactggggtg gactgatgac tacacgctgg ttcctgggta tgaaggcatc    344520
     cacatccaac gacacatagc taatatcgac acagggatgt ttgaaacggg catgttccct    344580
     ggatgtaggt ggtctctttc caaagctctg agagtctttt gctaatagag tgcctgccaa    344640
     ggcttctatc ttttgggcat gtggtataag cgtagtgagg cacagaagcg ctttagtttc    344700
     ttcttcagct cgaccacatt ggcgggcgcc ttcggcggcc tgcttgccag cggtctaggg    344760
     gagatggccg ggctccgagg ttacgggggc tggcgctggg ttttcatcat tgagggagtt    344820
     atcacctgcg tggttgccat tgtctggttc ttcataatcc ccgggttccc agaggatgtc    344880
     aagtggctta atgaggaaga gcgaatgtac atccgggcta agctggctcg tgatgcagga    344940
     aaagctgggc atgatgctcg tatgggttgg cgcgatgtgt tggctgtgtt caaggactgt    345000
     aagtacattc gagggccagg aggcgccatt tcattcctgc atatgctgac tgagatatag    345060
     acaaaatctt tcttggcgga tttatgtatt tcgggcaggt tgtcacagca tatggtaagt    345120
     ttgattgtca tcttgatccg tgagtatctg gaaagtagta tagggtaaca agctcaggat    345180
     atgctttctt tgccccgact attatcaaga cctatggcta cggaagtatg tattcgtcac    345240
     cactaaatgc gctgtatgct gagcttttgt actagccatc ctaacgcaac tgtactcgat    345300
     cccaccgtgg gcagcagcgt ttgcattttc gatgataatt gcaacatttt cggatctaac    345360
     cagacaccgg ttggctttca ctttgattcc tacagccatc gccatggctg gatttggaat    345420
     actattgaat gtacacggag aggctcaccg acacgtccaa tacggcgcgc tcttcatggt    345480
     gacctgtggc tgctatagtg cgatgccggt tatcgtatgc tggtttgcta tgaacctagg    345540
     gggtcatcgc aggcggagcg tgggcacggc atggcaggtt gggttcggta acagtaagtg    345600
     acgtcgacgc aaagcataaa ttgatgacgc tgctgacatg gcttatctac cagcgggagg    345660
     tatcatctcc acatatgcat ttctagccaa agatgcgcct gaatatcgga atggttacat    345720
     tatcagtctg tcctttatct gcttctctgc ggcctgctgc attggatact ttgtggctct    345780
     ctggacggag aacaagcgac gagaccgggt catggccaat ggcgccccag cggagctgcg    345840
     agcagatgaa gaagaggtac agggagatct ggcggtgacc taccgctacg gctactaagc    345900
     gattgtccca atgcagcttg agaatcctca tcttcaattc tggcggacat ctacattcta    345960
     catagaccac gatgttattc ctaggtatac agtagtagat agggctggct agggctggcc    346020
     tcgataatac acacgaacag gtgaaacggg aatagtgaat ctcaatgcca ttgaacgcat    346080
     cataacaacg agtctttttt ttttctcaat ggtaatgggt tcccaccgca tgccacggta    346140
     ctgaaggtac acgcaccggg agggttgatg tcacgggcaa ggcccaaagc ggtaatgcca    346200
     gtctcggtaa agcagtggat gacaatcagc gagccaatca gcgccggcgc aacactagcg    346260
     agcccttagc ggcattgcat gctgagtcag ccacggcgca cacaagaagc tcaaccgcgg    346320
     ccgctctcca tcattcttgc aaccatctct tcatcctcgc agaagtgtga gtaccccatc    346380
     ctagcctgca cgggttgcag tgcttcgtcg tctggctggg ccaacagtga ctgactgact    346440
     ggtatcagtt tcgaattctc ttcgaagatg agagccaagt ggagaaagaa gcgcgtccgt    346500
     cgcctcaagc gcaagagaag aaagatgaga gctagatcgt gagtgctatc caagcaaacg    346560
     aacaaaccaa atcgacaatc aactaaccca ttcccgcagc aaataaatta ctcgcccact    346620
     ccatctcagc tcttcatgtg aacgctcaag ttgaacgcta aacatgacaa ttgcgacgac    346680
     gtcacgatga tgattccagt tatgatcgtt acgtggttcg gtatctcaat cgaggcctgt    346740
     ctggtctgcc acaacattct cggtgcaatc gacttcggag cccgccgttc agcaggttga    346800
     aaagcgattt tctccacatc caatccctcg ggctcgttat aacgttttcg atcttctctt    346860
     gatttccttt tgatccagac agtgggggtg cgagtgccgc atcttttcct tcggaggtac    346920
     gaatgtgttt ggtggggttg gaaggcacgg tggaagagtc aaatggtctt tctgtattcc    346980
     tgtactatct tactctttgc cattgccgat gagcttttgc gtggggactg gtcaatttct    347040
     cgtgtcctgg gttctgttgg ggaaatccga tggaattccg ggccatggag aggtcatgag    347100
     aatttattcc aaataccaaa aagtttacga cgcacatctt attctctgta aatcttcata    347160
     aatcacgtag catgatcttg tagatgaatc catgatatcc aaaatgtcaa tcgtactaca    347220
     atgaagggcc ataatgaaca gagagattgt gcgtatgaaa ggctgcccgc ctggacgctt    347280
     ctccgccttc cgctcacagc ccgcctgacc gccttcaact ttttttcgtg gaattttccc    347340
     tccacctgcc cgataatctc cctgccagtc tattctctct ccgcggcgtc gcatttccct    347400
     tcaattcctt atccagacat aatgccgtcc gataaggttg aaaagaagcg caagcgcgct    347460
     tccgatcgcc atgagaggcc cagcaagaag cccgcgcttg agctgcaaga tctgcctccg    347520
     ctggcctcca gcgtcgtcga ggatgatagc gaactagctc cggtgatcag tatgctgcac    347580
     cttttcacac attaactttc ttaccttcac ggcatattca tatgaaatgg gaaaggtcta    347640
     atataatcca ctgcagtcac tactcccggt ctcaacgccc cgcgcaatct ccgcctcaac    347700
     ccatacctca agacccgcag caaaacctcc tcctcgtcgt cacggaacaa gggcatcgtc    347760
     tcatcggaat tgctgctaca gtcctccgag caccccaagc tggacttcgt gggtcgcgag    347820
     gccgaggagg atgccgactc ccaactgaag cactacgtcg cggtcgtgga cccggagaac    347880
     aaaacctggc agttcatcga agtgcggaag atgactctgc gtggcgccgt tcgcaagatg    347940
     ggagccattg aagaagagga agaggaggag agtgacgagg aagaaatggt acgctcaatc    348000
     ctctcctcta cgctcttcac tcggactata agctgaccct tcacccttca aatagaaaac    348060
     tatgcgcgct caaagaacag agctcaccaa caccttcggt accaaacaat cccgcaaggc    348120
     cgctcaatcg cttgccgaaa acgcccagct ctccaacgtg ccctcaggcg ccgcctccgc    348180
     cgctgaaacc gccattctgg gcgcaatgcc cgccgacgca gccacagata tcgcctccaa    348240
     gaccgccgcc ctgcaagcgc aggttcaagc cgcgaagcct ctgccccagg ctaacctgga    348300
     cgccgcgcac ccgtcagaag tctacccact tgatgtcctc gtccccaacg gcctggccac    348360
     tctgcgccaa cttcccaaca tcaaagaatg gcaagacagc gttaactccg gcgccgccgt    348420
     caacaccacc tcgcggtacg tctcccgccg cgtcgaagcc gtcgccctct ccggaaacac    348480
     cacccacctc caaatcctcc gcttcatcct cctcctcctg gaactcgccc gcggtctccg    348540
     tcccggccgc gacaagtccg ccggcccagg cagcaagcgt cttcctcccc gcgaagacct    348600
     ccgccgcatc ctctccggtg gaacaaccag cgagaactcc gccagcggcg aacagctcgc    348660
     ggaccccgtc atcgacgccg tgcgccgcaa gttcgcgccc cagggtgctt ccctctccaa    348720
     gaacgacatc accttcctcc acactaccat ctgcgccctg tcgctgcaca tcccacccca    348780
     accttccaag gatggcggca atagctccgc cggcggaaac gcccccaacg agctggccac    348840
     cgatccctcg gatctccgtg atgatctgcg cctggataac gtcgctatca cgcagtactt    348900
     ccgcgagttg ggctgccgcg tcgacaagcc ccgcgagtcg gagtttgcta aatggggtat    348960
     caagggtggt aaggctgagg ctgcggctag acgggttgct aggttgaaga ttccagttga    349020
     gttcccgaag gttagtcgtg gtggtggacg gaggtagatg gattcaattg ggaatggaat    349080
     tcgttgtgat tgattgattg tgtaagttag cattatttct ctgtatgtat ggatggatac    349140
     aaaagaacgt cgttttctct cttccattgt ttcacttggg cagctggacc actctaaatt    349200
     ggctaagctt gcagtagttc acttgtaaat caagagtcat ttcacctccg taacttctag    349260
     tcgatattac tagtagttac ctatctaatg cacatgtcaa gtctcaggaa gtcaatcgta    349320
     tatatgccag tgttgctata cgatatagat ataactaata tggctagtac tatctaacta    349380
     gatagagaca acaacaattc ttatattctc cctttactac catactacat acagccttta    349440
     atgaactgca actttctttc tttctttctt tctgtctttc tttctctata tataccaact    349500
     actatgacta ccgattatga ttatactata atgcaccagt caaatttact tatacagtac    349560
     taaattagaa gtaactgcta ctagacatca tcacttctac ctcgccaaat actaactcaa    349620
     cctggcaagt gataaaaatc cctactatca ctgctgaaaa tatactttct caagaaaaaa    349680
     ggtaactcag ataatcctag taactctgat ttagacttag aatagaatat tcacgttagt    349740
     agtagtagta gtagtagtag tagtagtagt agtagnnnnn nnnnnnnnnn nnnnnnnnnn    349800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    349860
     nnnnnnnnnn nnnnnactac tactaatatt tacttgtaag tttgttacca gtcttttact    349920
     accacacgtt atacttaata tataccagta ctacctgtag ttgaatattg tacgcagaat    349980
     agactgaatt atcgctgaat tctaattcat agaatcttaa tgtgcagatg tgttgtggat    350040
     actaccacca ccagaataaa taaatatagc cctcagtagt gacagatagt caacaccaaa    350100
     aaaaagaaac tcccacacga gagagagatg cagagaactc gtccgaagaa tcgaggcgag    350160
     gcgctgatga cagttgagat ggctagtgaa ttgatcacat gataaataac catgataatc    350220
     tggagagggg gcaatctgga ttgaattcgg agttaaagaa gatcatacta tcttagtatc    350280
     acccagttca tttactcaga tgacaaggta ttgtcggtct gagtgggttc cgggattgta    350340
     ggggaaggtg agagtgacac tgaggattgt gctggatagt aattagtagg tgcagtgaca    350400
     gttctgacat cggatattct ctttcgatta cgagatagct atctgcaatg gtaaatgcat    350460
     gtagactaca gaatacatac tacatctaca atgatactag gaaaaaatat gcgcagcata    350520
     atgaggaata gacatgatca attcgatcta gaacccaaat tcatcggtaa cgactggccg    350580
     gttccatgtg tctttatcca ccttcatatt tcatattatg atagagcaaa tggccagagt    350640
     ctggtcatat ggtcatgctg ggattgaaat ccgacagcag cgaaaagaaa agtaatagta    350700
     acgatcaact catccagacc accacattat tagcctgaac cgaaaaggtt taagcagcag    350760
     ccactcccac ggggattgag gcagcagcag cagcggcggg acgcaccgga gtggcggtct    350820
     gcatgcggga agcggcctga gagagcgctt cggcagcagc cgtctggaac tcccgcgtca    350880
     cggcagcttc gacggtttcg ttaggctgca ggcccagctg cgcgtcctcc cagatgggct    350940
     ggttggcggc ctcggcaccc tcgacaccca cgccaacaaa gcctccctgg gcctcccagt    351000
     cactggcgcg cttgatgccc agatcgttcc agacggtctg cagagcctgc accaaatggt    351060
     cccggtgctc cttgacgtgg ccgggggtgg gggtgatgcg gagacgctcc tcaccgcgag    351120
     gcacggtggg gtagttgatg gcctgcacat agatgccgtg ctcctcgagc agcttgtccg    351180
     aggcctgctt ggccacctcg gcatcaccaa cgagaagagg gatgatgtga gacgggtttg    351240
     gaatcaccgg aatatccagc tccttgagtg attccttaac cgcgcgagtg tgcaactgtt    351300
     gcaggacgcg gtcgcgctgg tgctgtgcct ggtactggat ggcggtgtcc gctccagcca    351360
     tggtagctgg gggcagcgaa gttgtgaaga tgaaaccggg ggcgagagag cggatggtgt    351420
     ccaccattgc cgccgatccg gcaatgtagc caccaacgca accatacgcc ttgccgagag    351480
     taccggtgat aatgtcgata cggtccatga cggttccctt ggtgtcacga gggttggccg    351540
     tatcttgaga agcgtaaatg tcgtagtcga ggtgctcagc cactcccgca ccgtgaggtc    351600
     cgtacatacc cacggcatgg acttcatcga ggaaggtgat ggcaccgtac ttgtcggcca    351660
     gatcacagat cttttcgatg ggggcaatgg atccgcacat actgtagacg gattcgaaag    351720
     caataatctt ggggacgttc agagggagag atgcaagttt ggtttccaga tcgaccaggt    351780
     cattgtgctt gaaaaccatc ttcttggctc cagagtgacg gataccctgg atcatggagg    351840
     cgtggttgag actgtcagac agaatgacac agtctggcat cttactgccc agagtcgcca    351900
     gagtcgcatc gttggccacg aagcaggaac tgaagactag cgcagcctcc ttgttgtgaa    351960
     gtttggccaa ggtgctctcg agagcaacgg cgtgctggtt gtgtccggaa atgttgcgag    352020
     tacctccggc acccgctccg tagttgtcca aggtcttgtg catagatttc agcacctcgg    352080
     ggttacgacc catgccgagg tagtcgttgg agcaccacac ggtcaccctc tcttcaggag    352140
     aagcggtgtg ggcacgagga aactccttgg ccaggcgatt gatgttgttg aagtaccggt    352200
     acgatttgtc cttgtgtttc ttctcgagct cgccctggta gaatgcattg tagttgaagg    352260
     gtgcggcgtt gggggcatgg ggacgagggc cgggcacggt agcggcagaa ggttcgagct    352320
     gctgcttggg aacaccggta agaccggggt gaactggggg gaattccgtc agtacaatta    352380
     cattggcgtt gtgactgtgc gagagaaaat aaggaaaagc actaacctcg ctgtgactcc    352440
     ttgtagacat tcggggtcac atcagcgcca ttgccggcgg tggaatgcaa cgctctcttg    352500
     ccgacagtgg gccggaattg cttggggttc aggcccgcca caccggcagt ataagaggtg    352560
     aaccgcttgg tgtgagccag acgagcactc tgcaccgcca gagccttgct catcactggg    352620
     cagcgacgag ccaggacctg gaggttggac atggtgcctc cgccagggct ggtgctggga    352680
     cgggtcgcgg tcgacagtga gcgcaaagtg gtcggggaag tgcgcttgag gaacgggcac    352740
     atggcccggg actgctggag aagcgactcc atggagactc gaatgagcgg gcagacaatt    352800
     cgagacggag agtgcaagcc gaaggaatga gatagcccct aattgacgat caggaagcaa    352860
     tggatgtgga ggaatgggga gaagaagaag agggtagtga agaggagaag aagggaaaag    352920
     gaagaagaca agacaggata tctggaagat tcaagatttg ggaggggaaa aattactggc    352980
     ctcccgatta cgggatacca tgaccggtaa tgaatgtaat tttaggtatg actcgccgag    353040
     gctgacgatc gaggcgtcgc tgattggccg ttcggcaggc cggcatgggg gacagcatgc    353100
     tgactcagac aaacggacca ctcacggcgt aaatcaggcc acccggtctt tgctcggctg    353160
     gagatttggt gaaaccctgg gccagggatc ggacagataa tcagccagtt actccttgaa    353220
     atatatatgt cggtcacttt actgcgttgt cctctgcatt acccactgca tgttaggacg    353280
     cggagatgct cgttggcgta tgccatcgat gaatcggtca atgtacagga aatactatac    353340
     tgtgttgggg acgatcctta cagcgcacgg gggcaaaaaa gtgcggagaa ggccgatcta    353400
     ctactgcagt caccgggatt actcagcccc taaaggccca gaaccacatg ccatcaataa    353460
     tcaaaccccg tgcgaaagaa agacttgtaa gaaataaaga tgaaatgaaa atgtatccca    353520
     gttccaaatc caatcacatg tagaacaata caaacataca acatccatcc gtctatccgt    353580
     cgtctgcttc cctcctcgcc gctgcttttt ggatgcatca taatgactaa gctcatgtcc    353640
     atccgtctca tacattaccg caatagtctg ctcatcaaca cactgccgcc tgaacctaat    353700
     gtctcgtgta tcaaaatgct ccttgttaat acatgacctc ggacatcata gcccgaagcc    353760
     ggggaaagaa gtaaaaagga aaaaaaaaaa aacaaggtgg tcgaatcgcg aaataaataa    353820
     aaggagaatg ataaggatgg aagaaagcca ttaaagactt gggcatagac aacaagacac    353880
     gagggaaaga tatccaaacg ccgccattcc gtcaaatcgt atgggtaaaa cgagagaatg    353940
     agagtgcgaa tgtctgatcg ggatcagctg ggacccagac ccccatcgcc gtcaatgaga    354000
     cgcagtcgct ccttggttgt cttggcgcgc ttggacgtcc ccttgcccga tccgcgtcca    354060
     cggccacgct tgggtgccgg agtggacgag ggcgtgccca cgttctccgc ggtcgataca    354120
     ggggttgccg ccccggatgg tttggcactg gcatcatcga aattaccctc gcctagaaaa    354180
     attagtatct atctcaaagc aacatgtaaa gtgcgtaggg aaagacatac cttcgtggta    354240
     catatcatcc aacgtaatgt ccttctttct cttctgggct gccttctttc cgcctttgcc    354300
     ggcaccgaac acttcgccgc ggtccaaagc ctccttctcc ttctgctcaa tgagctcggc    354360
     ttgctcatcg tcggccagcc acatggcaat gtctttcgtg cggctctccc ggttgcgcgt    354420
     gttgaagtcg actcctccag ccgcgccacc agtgataaca actcgctgga cctcttcctt    354480
     ctgcagggcg cgcttacgaa tccgctcttc gatggtaccc cgggtaatca gtcgatacac    354540
     tgtaacttgc cgtgtctgac caagacggtg cgcgcggtcc atggcctgag aatcaatagt    354600
     cgggttccaa tccgaatcgt agaagatgac ggtatcggcc gcagtcaagt tgatacccag    354660
     accaccagca cgagtggaca gcaggaagac gaagatttca gggcgctgtt ggaaatcagc    354720
     cacggtgtcg cggcgatcct ccagtttggt gcttccatcc aagcggcagt acttgtaatt    354780
     gcggtaagtc aagtattcct ccattaggtc gatcatgcgg gtcatttgga agtacagcag    354840
     tacacggtga ccgcctgcct tgagctctcg aagcaactca tccaacttag ccaatttacc    354900
     agaatcggtg acaaaccggc gcatggatgg cacctcaatg tgcgtgtaac ggcccttggc    354960
     ggaaatcggc ttcggaagca tgggagcaag cgagtacgga gtagggtcca ccttcttctc    355020
     gataatctgc tcatcgactt gtcttgaagg cgtgctatac agtgcgtgtc gaacggagac    355080
     attgaagagg gtgtcccttg tctcgattga ggggatatgg ctcgaggaca ccacagagat    355140
     cggaggtgcg gatgcggcgg gactgacgca gggctcaatg atgttgaggc cctcgcgctc    355200
     gtacgtagat tgcgagacag tcatcaagtc ccgcattatt ccttctgcgg caacctcatt    355260
     gacggcgtgt ttatcattgc ggtcgacgat attgaacagt gtatgcggaa gggcggaccc    355320
     tgccagttct ttgtcgtcgt cgtaggcaac gttaagccga gatagcctgt tgacctgacc    355380
     tcggcggcgg accgctcgct caaagattcc gagatgcgac tgctcgtacg cttcacccag    355440
     tgatgtatct acaaaacgta ggaaagagaa cgctccgtcg tcctggatgc tttgcttcat    355500
     gttctccggg gtgaagatat tcatcaagtg gttcaagtac cgtccgcgga acccggcgtg    355560
     aggattttca gcgcctgcaa catcgacacg accgcctgca ccacagagaa ggcgtggcat    355620
     ggggtattca atcaaattgc gggtcgagta cctgacatcg acgttgttgc cctcccgaac    355680
     aaacgacgcc gtctcggcaa agtaggcggt agagaaggga gacttggttt cggcacgctc    355740
     gaacagatca gggtggttac agaccttacg gaactgcata accaaattca tcaaggtcgt    355800
     actatcggcc tcgtcaccga cggcagcctt ttcgatgaga tccatgatgc tgacgcggtt    355860
     tcgtagattg gtataatagg cccgctggcg ataggtgagg tcacagaaaa tgtccttctc    355920
     gaccttatct ccaagctcct gctggacgtg cttcttcaca cgacgcagca tgaaaggttt    355980
     taagatcatg tgtagacgcc tcagctgatc ttcgttgagt ttcgtgttac tttgagcatg    356040
     ggattcaata tccttggaga accattcgct gaactcgtca tgggagtcaa acagagtcgg    356100
     catgatgaag tgaagaaggg cccacagctc ctgcatatta ttctgaatcg gtgtaccggt    356160
     aagaaggaga cggttgcggc agtggaatcc aagcagattc ttccatcgtg aactctgcga    356220
     ggacttgatg gcctgagctt cgtccagaat catgtactgc catttcacct tctggaagta    356280
     ctgggcatca agcacgacga gctgatacga cgtcaccagc acgtggaact ccgactcttt    356340
     ggtgtaggtg atatgcttgc ggtcccagaa cttgcggaga atcttacgat ctttggcgga    356400
     accccagtag ggaagcacct tgatatccgg cacgaatttg gtgatttcct gctgccagtt    356460
     gtgtagggtt gaagcgggcg caatgaccaa aaacggaccc cagatgttgt gtacttcggc    356520
     gagataagcc atgacggaga tggattggat ggtctttccc agacccatct cgtcggctag    356580
     gataccgttg atgccttgct cgtacaagtt gaccagccag ttcagaccct tcagttggta    356640
     ctccttgagc ttagcagtaa gcatgttggg ctgcgagatc tcgatgtctc ctaaactcgt    356700
     aggattttgg aagttcagtt cgccctcatc caaggcatcc atttggttct gtccagagtt    356760
     gaaggcgcgt gcccgatcct gcgcttcctg gacagcgttc tgagcattag ccatggcggc    356820
     ctgccgcaag gcggtctcgt cttcggcatc aaaatcaaga tcttcgaagt tcgtaacttt    356880
     ggtgcccgca tcagcaacac tggagggcat gtcgatggta tgatcctgac ccttgccggg    356940
     ttggacggtc tcgcccgtcg cttccacggc tgtgtccccg gcagcatctc cttctgcacc    357000
     cttgattttt cggccaatga agtgagaata cagctctgtc tgggagatga ggaagttaag    357060
     cttgcgcctt tgacggttag cttcacgttc tgcttccgcc ttcttagcgg actcaatctc    357120
     ttgcttctcc gcaagacgac gaagatcacg ctcctctcgt tcgttgcgct tccaaaagga    357180
     catcatctca cgcatggtgc gcttggcgcg ggcttgagta tctttcatac tcttgtttgt    357240
     acgctcctgc cacttgcggg actgcttgct ggccagctga gctgtcttgc ggagattctc    357300
     ctgacgcgtg ctgagggaca aggccttgat gcggtagact ttgggaatgt ctttccgcgc    357360
     aatgtcacgc cagatctgct cataaatctg gttatagcct ttagtctcgt aggcggacaa    357420
     gggcgttggc gtgggctcct tggagcggcc acctttaact tccttcttga gagactcctt    357480
     tcgggggtcc tccttgggtg cgataggtag aggttcgtca ttctccatag ctgcataagc    357540
     agcctccgca gcatcctttt cggcttgctt ctgctctttc gacttctttg gccgagtgac    357600
     cggaccaccg cgaccagact tccgtctcga tggtgagccg cggccaatgt ggaaggagct    357660
     ggtagtgccg ccttccagat ttggagccaa tggagtgacc tcgctgatct cctctggggc    357720
     agtgattccc tcgagagctc tcttggtcgt tttgatcttc ctttgcgccc gttccgcttc    357780
     acgaaggaac ttggccttct ccgcagaatc ttgagcctcg tgcgccttgg cctctgcttc    357840
     ctttttcttt tgcatctcca tgcgcaccgt attctcacga cgccgcttgc gttgcatgtc    357900
     cttcttgcgc tccttttcat cctgaatctc tttcgcctgg acttcagcaa cgacggatgc    357960
     ctcgtttgca tatcggaatc ggtccatgcc ggcagttgct tgtttctcaa gagacttgct    358020
     gagcttgacg aggaagtcat ttcggcggcg ctaaataccg tgtcagtaaa tccagacata    358080
     tttgcatgtg gtaagtcatt gtgttacctt gcgtctcagg atttcggcct gttcagtagc    358140
     aaaggcacgt ttcttgccct tggcgcgata ttcctcccgg aaccggtcgt aaccaggtgc    358200
     ttccacatca cttttgtcag cttcggccat atcagccaac gctttgttga gagcttctgt    358260
     ctcccgttca gacatcactg ggcgagatcc ggcaccacga ggctgagcga gcgtcttcga    358320
     gggctcagag acgccgttgg ccacattgga ggtccgtgag tcggctgtct tttgctcagt    358380
     ttccggcggg ttgcgacggc gtttctccgt ggtgggcttc ttctccagtc tcggtagaga    358440
     ggcggtgaga gccggtgccc ggtctttgga tttttgtgaa gtagcagccg aagctacggg    358500
     cggaggactg agactggttt gggctgttgc tgcgggcgct aggggagtgg gcgtagcctc    358560
     ggccgaagac tgtctcgggg gaggagcgcg ctcctcagtc ggtccggaga gaatgctggc    358620
     aaaagacatg ggatctgctg cccttgtagg tttctagatg tagcagagca tcacagcgtc    358680
     agtcaatggg taggtaaata tggccacgat taacaagggg atagcatacc acgtccttgg    358740
     ggggtgaaga tgctcgtggc tcgcgcacca cagaggatgg ataacccata acaccgtgag    358800
     tgctcatggg aaactgggat tctgactcct tcttgggtga tgtttgggga tggctatcgg    358860
     gccgaccagc gggatgggca tgggacggtg tagagtgacc gtaaggagat gcgccgttgc    358920
     ctgacaagac ggagccagga tagggccgcg ggagagcaaa ctgtgggttt ccagccgaag    358980
     aatgtgcctg gtattgcgac ggcggttccg agggatgaga tgacggcggc gccgcgccgt    359040
     tcaatggcgg cagagtgcct ggcaacgggg aaggcgcatg ggagaagtga gggctcctgg    359100
     atgagaaggc aggaggagtc tggggtggat gttgctggta ttgttcattg ttggcgtagt    359160
     aggggcggct tttagccgga ggcgaataga ccggatagcg agactgctgc gtgggagatt    359220
     gaggattata aggcggagcc cccgtcatga tggccgcgtg tgccggggaa cgcggcggcg    359280
     agggttagaa gatggtgcca gcaacaggga ccgcgaaagg cgatgggggg ttggagaagg    359340
     aggaaggaga gaaaacgtgt tcggggcgaa caagaaccat ttatgaaaaa cgagggctgg    359400
     ccatgcgcga agggggtttc gagaggattt atctcacgaa gatctcgatg gggggcgatc    359460
     acgcgtcggg ttggttgccg ctgctggtcc cagctatctg cggaaggaat taattctgag    359520
     aggcctaaat ggggagaagt ggagaaggaa ggctggaggt tattgggagg gaggatggcg    359580
     atgatatgaa ggcagaagat gatggggggc agatggaaga aaagaacagg aaaggatgag    359640
     gtggaaaagg gaggatcgcc tcaccggatt gacaggaatc ttcggagggc tccaaagtgc    359700
     ttgtggtgag cgagccaaca aaccctccac gggtcaaccg ttccggacag gatgcgacaa    359760
     gaaacacagg cccagccaag ccgtgaatgg gctacccgat cggggaatgg tcctgggccg    359820
     gcagcgaaca ctacttgaga aacccagcaa tgtccgtaac ggagaccctc tggatgaatt    359880
     gatgaaggat tgggattgag atggggggag ggtgggaggt tggatgtgaa tgatggaaga    359940
     ggaggaggtg agcagcaggt aaggggaaag aagagtggag ggtgatgatc tcagttcagg    360000
     tctggtgttt gtagtgtatc gtacctcaga cggtcgagat accttcctta gctagctaga    360060
     cgtggtggtg aatggggtcg tgctccgggg aggagatgac agaattcata gatgatgatg    360120
     agagagatgg atgtcgagat gaagattgat tgcactggag attgggatgg gatggattgg    360180
     atggatgatg aagaggatga tggcgatggt tccagtattt tttgattttt ttgcgctgct    360240
     gcttcccttt cccccccttt gggccaactt tctccctcat tttccctcat cttgtctcgt    360300
     tccttctttc gtttctttct gcattccccc atccaatccc gcacctgtcc gtatgtattg    360360
     gtattactgt tactgattat tactgaccac tagccgttgc ccagatcacc aaagctgaag    360420
     ttcgtagcag cacgatgcct tcttccagcc tactcctgtc tacaacttgg aatttccccg    360480
     aatattggtg ttaatctata caagggcaga cgattagttg cacaacaggt attggaaact    360540
     gcttctaaac atgattccct caagaggatt gtaacacttc tccctgtatc tccatcgatc    360600
     tcgcctgcat ctggaccggg gaggctccgt tcgatgacag aactgtttag ttcgatacag    360660
     gtaatgaccg tctccagaca tcatcgcctt cgatcgggaa cggagagagt gactgactgt    360720
     gactgacgga cactcgggtt attatggaga ttcccgccaa ttcttgtccc ccggttctcc    360780
     catcatcacg ctattaaaat ctcacaaaca ggacacttca tcgtgcacct gatcatgagg    360840
     ggtgatggtc gcgtgtgctg ctgcccctcc aggggatttt gacatgatct gaagtgcttg    360900
     catcggccta cagtgtccgg cgtacatgga tcaggtagac ctacagccgt agttaagtcg    360960
     agtaactacg ccggcgtctt gccatgtcca agatcccata ttatgttccc ggcgtctcgc    361020
     gacttcggtt caagaataca tcatcgatac ccacaaacaa gctagttaga cttcagtctt    361080
     gggtcatctc aatatttcag aacaaattga tgttcaaaaa tagtatttac ttcctttcat    361140
     gtttctagtt cctataggtt ggcgatagca tcaaattggc ggttgaacgc agagcgtggc    361200
     aattagctta tcccgcgacg attcccgtgc atcttgctga agctaccgcc accaaaaaca    361260
     agtgccacgc acaatgagat cgtccatcat tgatatccaa tgacaacttc gcagttgacg    361320
     ttctcaggtt ggacggcggc tgatggttac atactaacgc aacgcttgtc cgaacgaggt    361380
     ggagtagaac gataaatagt tctaaacata ccctggtact caattggaaa gacggtgatc    361440
     gagttgtctt tccatcaagg ggtgtctatt actatggatc taaaaaatta tccaggtaga    361500
     aggaagtagg aaatccggac aagattcact cactcactca ctcactcaca tcctatgcta    361560
     gttggtagct aaatatttga ctggtactgg ttttgaatat tatgagactt gcaagagtga    361620
     aaccctggat ccaagcttct agcctccgta taatatttgc aaattgttgc acgactcatg    361680
     tccatgccaa tgatcaagac tcagccggtg ctgcaatggg agtagatgat agccccgatg    361740
     caacaagtag atttacccaa gctgcaagta aagcatgtcc aagactgggg taaatagcaa    361800
     tcacctagtt cctctccaat cgcaatttgt tacttcaaat agcgactgag gaactatttc    361860
     aagcatcaag cacccgttct tgtctagcaa atcctggcgt gctggcatcc catccataat    361920
     gggtcggctg atcagggcat ttgtaccatg atactcatta atcatactct atagatcttg    361980
     ctgtagttaa aacagcatga ctggatccat tgctaagaac tcctccgaaa gaggttaaga    362040
     tgagcctgtg gtcaggtggg tgccccggag gtactcgatc agcccatcca caactgggct    362100
     ttttcaacct tccatctgcc ctttcgcctg gaatcttccg ctgattcagt tccctgatga    362160
     tactaccact gatcatgata ttgtgatctt atcatgtctt accaccactc aatgggaata    362220
     ccattgaacc accgggaagc tgcgaaatcg gctgaggcct gcgaatccca tgtaatctag    362280
     ccgcagcaat gagagttcat ctgcggagag accagccagt gacagggttc ggcagagcac    362340
     gaagagtttg aggtatagga actaacagca tagtaacgcg gaggaaacta aagaacattc    362400
     ttgaacttgg ggtgagacaa agggatgcga tgcaacgatc ctggatgagg cccaaggcag    362460
     cgataagaat gatcggcctg gcgctctcgg atcgcccgtc caaccatgca cgttgaaatc    362520
     tgccgtggca gcagatctat ccgcaagcat gcttctgcta cctgccttca ttgctgctgc    362580
     ttctgataaa atcgagtgct atagactggg gaaagaccga gaaggaagcc gttcgtccgc    362640
     gtcatccgcg cctctctcgc tcacgacctt ccatcggaac aatcaacccc tctttgccaa    362700
     cacgaaccag gcactgcaag ctggggctgg gccgacttaa tgcggttcta gtagcgggga    362760
     tctgataata gacggtctct atagccagcg ttcctcgtat gcatctgggg tttcgggttt    362820
     caggatgtct ttccccccac gcttttcccg cgattggaag ctgcggagag agagtttggt    362880
     ttccatgacg tctatgccgt ctgccatgtc ccgccatccc gacagccatg gatcgggata    362940
     ctcaaccact taaaactcac ttgagacgtt tggtgcgaaa tactttccaa gagtggcttg    363000
     tggcatatac atgtttactg gcctgtctgg ggaatttcgt ccctaattgg attgatcatg    363060
     cagtaagccc gaggatgacc gccccggccg agagaccaaa agccagctct aggctcggtg    363120
     actgcttcct tgtcagtgtc tcctggcacc aaacccctgt cctgccactg gatccttctt    363180
     gttcgacgtc actcgatccc aattcacttc cggcgatgag cggacatcac cccacctgtc    363240
     cgtcataccc ggcaacacca ccaggacgca actacataaa gccacgaagg actcacgccc    363300
     cttgacctgg aagaccctga ttattcgtct cacatagaca tcaattgcat tcatcagcct    363360
     cccatcactt ggtatctttg tcatttacta tctcatccga atcccagact gccaatatga    363420
     ctatcccgga gaagcaatgg gcccaagtgg tcgagaagaa gggtggaccc cctgtctaca    363480
     agcagattcc ggtggcaaag cctggcccgg acgagatctt ggtcaagatc cggtataccg    363540
     gggtttgcca taccgacttg cacgccatga agggtgactg gccactcggg ttgaagcttc    363600
     ccctcgtggg cggacatgaa ggagctggcg tggtcgtcgc cacgggtgac ctcgtcaatg    363660
     agttcgaagt tggagatcac gctggtatca aatggttgaa cggatcctgt ttggcttgtg    363720
     agttctgcaa gcaggccgag gagcccctgt gtcctcacgc gttgctatcc ggttacaccg    363780
     tcgatggtac gttccagcag tatgccatcg ccaaggccag tcatgcgtcg aagctcccga    363840
     aggaagttcc ccttgatgct gtcgctccca tcctctgtgc tggtatcact gtctacaagg    363900
     gattgaagga gtctggtgct cgtcccggcc agaccgtcgc cattgtcggc gccggaggtg    363960
     gactcggatc gctggctctg cagtatgcta aggcaatggg gcttcgcacc atcgccatcg    364020
     acggtggtga cgagaagaaa gctatgtgcg agaaactcgg atcggaggta aatgtctcag    364080
     tccccaatac caccacatct ggctaaccct ctctctctat ccaggcatac atcgacttta    364140
     agacatccaa ggatgtagtt gaggacgtca aggcagccac tccggaaggc cttggtgccc    364200
     acgctgtgat tcttctcgct gtggccgaaa agcccttcca gcaggcaacc gagtacgttc    364260
     gctccaaggg tagtgtcgtc gctattggca tgccagccgg cgcattcctt cgagcccctg    364320
     tcttcaacac cgttgtccgt atgatcaaca tcaagggaag ctacgttggc aataggcagg    364380
     atggcgtaga agcagtagac ttctttgccc gcggactcat caaggctccg ttcaagacgg    364440
     ctcctttgga ggatttgccg cgcatcttcg aactgatggg tacgttgtat acctagtgat    364500
     attaagtcga gttactaact atgaaaacag aacaaggcca gatcgccggt cggtatgtcc    364560
     ttgaggtgcc tcagtaagca ggtagacacg gaaagatttg gcgttgggga tgacacgagt    364620
     tgctggtcag acggagttta tttaccagtc tcgagcatga ctactatgat gggcttatga    364680
     ctactaataa cgtctctctg acatgtttaa aatactgaaa taattgaatc ttctatactc    364740
     ttattcacca tatccgcacg tgatggatac caagtaattg actctacatg gagagcacgc    364800
     acggcaagcc ttgctgcaaa tcagattgtc tcatgtcatc catcatgcat aagcatcatc    364860
     acatcgccat ggcctgcatg actacctaat atctgttcag atacctagtg gtacaaactg    364920
     aacaaagccc caaacataca gataaacaaa gtacacgaag ctatactcca tccaagagat    364980
     acaatgttat gtactaaaca ccatgctatg ctttcataca aaccaatcaa agaaatttcc    365040
     cattatcccc agccaaacag tacagtagta taatagtacc tctaacatca cccaaggaca    365100
     ttcatccata cacaatacaa ccgaaccctc caatatgaaa accataaacc caaccacaaa    365160
     atagcaaata caacaaacaa tcaatcaatc acttctcatc ctcctccaac ccggacgact    365220
     cccccccacc acccaccgtc atctgcggcc ccctatacac cttcctcgca taaacgacat    365280
     aataaaccat cgctcccagc cacaaactcc cattaatcac aatcgtatag ttcatatcct    365340
     gcgctacaca catcattagc tcaaccactc caaccctcaa acgaagtata ttcaaagaga    365400
     aaagaaaaaa aagggaacaa cttacgcgac ggactcggcc cccccgtcgg aaacatactc    365460
     aagacaataa catacgccaa atacacgacc gccgtaatgg caatgggttt actaaaccaa    365520
     cccgtataga actctccagg gtgaaagcgc tccttacccc agacgagacg actcaggatg    365580
     ggcaccatcc aggcgagatc gttgcccgcg acggcgaggg agaagagggc gctagaggcg    365640
     gcttcgtcga tgaggcacag gaggcccagg atgacggaga tcaggacgac aaagcagacc    365700
     attcgcacgg gttggtagcg gacgcgcttg ctcacgtgcc ggaagaaatt cgagaagggg    365760
     agggcgccat cgcgggagaa ggcccagctt tggcgggagg ctgccactac ctataaatca    365820
     tgatattcgt catgtgagtt tcgtggttgg taattgggga tgagggggtg gaaaggagag    365880
     gggctgtacc agactcaagc ccataaagaa ttggacaatt gcgacgacga tcatgaagcc    365940
     gagggcaccg cttttgccga gggcgtcgta gtagatctgt gcctgcggtt attaccattc    366000
     taggatagag ggaatggaga gtaggtgagt acctgtgcca ttggctgtcc gaaactcgag    366060
     ttcagcacgg cattaaggtc cgggttgatc acggcagcga tgagcgcgag ggatacaaac    366120
     cctaacagtc cgcagagtcc cgcagaccaa atgataccta atggcacggc acgcgccgcg    366180
     tgactagctt cctcgctcat gtggacgcag gagtcgaatg caccgatggt ccagatgggc    366240
     gacatccatg acagcatgaa ggtccagccc tggggccagg tcgtgaggtt ctcagagtgt    366300
     ccaaagacat acgttcccga gttgatctgt cccccgcgga cggctttacc gatgggcaga    366360
     gcgaggactg tggcgaggac aaggccgacg ttgctcacga tacaggcgga ctggatcttg    366420
     ggcatgatgc gcgcgcagaa gatggcgata aggccgtgga cgaccacgca ggcgacgtag    366480
     gtgccgtata ggacgggtcg agaggctgtc cagtttccat cgcgcgcgat tgatacgact    366540
     gagaggagta ttgtagcgaa gccatcttgt cggctagggt tagcgatagg aggacacgaa    366600
     aggttcgagg gattcgcata caatcgatgg agcagacgcc gccgatgagt cctagactat    366660
     tgctgtaccc gactacgaag ctgagagggt tcttccactt ctcgccgctg aagtagtgag    366720
     tccagaagta gagaccaccg gcagtaggca tggcggatgc taggtcggcc tatatccagt    366780
     gggtagtaag catccaaaca attcgatgag catgaggtat attgcgcatg aagcagacca    366840
     tcgccaaagc cactatgaag ataaacacac tcgcagaaaa ccatcctgca agacccatca    366900
     gaatcaatgc ctagaccata ctagcgaaaa gcctcaccct gaactcaagt tagccacgaa    366960
     tcccatgtat gtagagccag catgcatatg caaccatacc caaaccatgc ctacgggacc    367020
     agcaggaatc gagtacgaga gcgtcgtcgc aatcgagggc aataatccca taatactaaa    367080
     ggcgatagcg aagacctgga cggtggaata atgacgacgc agttcctgct tataccccag    367140
     cgtagcttat ccgatcagat cagcacaaac aatctcacca taatcaacaa ctcgataaaa    367200
     gtataaattg atagcatgac atacctaaaa gctgcgaatc gccctgctca atgggaggat    367260
     ccccatcagc tacctgagca gcatccttga acttttccgc catcatgaga gagagaggga    367320
     accgcagata accagagcga agaaagaaac gtgaatcgca gcagaaggaa gcacaagcac    367380
     cagacactta acttatactg gttccgaatt tcccacagcg cggggttcca gacctccacc    367440
     agcccatcgg aagtataaca agtatcccat cccttacgcc gaatgggagc aaaaggcgtg    367500
     ctgataatcc attcatcctc cgataagccc aacaaatcgg tggcaccgcg tacaccacaa    367560
     cgccacattt tagcatcgac caacgaacga gagagaactc ttcgatcagg ggagctgcaa    367620
     gactggcgtg tgttatcatg actcttatcg cgggggaaac ctagcacgac gcccgagcaa    367680
     ccaatctgga cactcctgcg cctgataaca gcccgcgctg ggccaccgta agtctggagg    367740
     cttgtcgcga aggattgcct tttcggaatc ggaattgaca ggaaaaggga agaaggaatt    367800
     ggaggtgctg gattgttccg aggtttacga ctagctcatt aagttgctgg tgctgccggc    367860
     tggggaatca cgggcctact tagtgagagg gggatcggcc tggtggatta gaatggtttg    367920
     gcttatctat ggtggtatat tactacctac gtatgtgctc cattgcaatt cgaaagaaca    367980
     agaagagtct caatcattca aatctaaatg gaaacatggc aatcgtacac aatgacatgt    368040
     gtccagggtg tccagacccg gctatgccaa agaaaaacaa tataacagca gtctgcactg    368100
     gtatatagtg gatatacaag cgccccccaa ttaagaaaga gaggactgtc gtgctggagc    368160
     atactcgcta ccgaacgcaa caggggccag ctacaaccac cgacagaacc ccggggtcga    368220
     gcagaaggaa aagccattcc gaccatgggg gggctggcag aagaacagtg gaacagaaga    368280
     tggaatcatg cattatgagt acacacaagg aggaaaagaa aacgaaagga gtatcatcta    368340
     aacagcacca ggccccttgt ggttcgactg atctaacaaa agtcgaggct tgatataatc    368400
     ttcgtccaat tgtcggaacc acgccgcgtg gtccccagac ggtcctcccg agaagaggtc    368460
     tcgaatggca tcgcgggcgc tcaatccggt ttcgcgccgg ttaggtgacg ggttgttagg    368520
     gggtgtggtc tgcgacgact ccagatattg ctgaggctga gacggcgatc gcctgagtcg    368580
     cgaggtagtc ggcgccgggg cggatggggg caggtcgtca tcggacggcg catcctcgac    368640
     atcaaggtcg aacgcatcca attggtcggc gtctgccaca cggcccttcc cagtggtcct    368700
     caagccaaac tcatcctcac tggcagcctc gctgtcgctg tggttacggg cgccaccacc    368760
     cagcagcgtg gctgttgacg tacggtcacg gcctgaatct ctctggctgt atgcattgga    368820
     atagagccgg gcatggccgc gagtgcggcc cgagccggat ggaggaggac tgggacgacg    368880
     attattgccg ctcgaatagc tgttgttccg atccatatcg ccgcgcggca ctccatccaa    368940
     cgggatggtc gagtccatac ggcgaggcgt gtatcccaaa cctgtatcag agcgtttgta    369000
     gtaggtgcca ccgttggtga cctcaatgtc aaactcatcg tccgactcga tctcttcgac    369060
     aactccggtc cggattccca gaatctccaa catccgggcc gttgtgccgc cgaaaatgat    369120
     gacggtcaac accaccacca cgagaacagt ggcccgcagc gccggggcgt tgactccctt    369180
     caggcctgcg gccagcgcaa caccgacagc tccacgcaga cctgcccaga aaagcattgc    369240
     ttggtaggcg aagggcagct cgtcggcaac atccatgccg cggcgacggg ctctgtatcg    369300
     gataaaccag ttgatcgcct tagatagcgg gaacaccgcc aggtaccgcg cgatacagat    369360
     accgaaaacg gcgaccaaga taaagagagg cttgaactgt agatgtcttt ggacgagcaa    369420
     gtcgagtccg agatagatga agataaagtt ctccgacaat tgcgccatca cttggaagag    369480
     gtacttcgtg gtaagttggg tacggcgcga catgttgtag tatgcatagt gtttgagggt    369540
     gattccacaa aacaggagag acacgattcc taagaatgtc agcttgcttc gcaccgaatt    369600
     gtgacaagca tctcactcac cagacagata gacaccattc gagaagaagt aactggcata    369660
     ggcgataagg acaatcaagc aactctcaat cttgggctgg cggcgcacat gcgtgtactt    369720
     caagcccaga gcggtcatga tgccgacgat gacacccacc atcatacttc caaagaaaac    369780
     cagcaagaac agtccaatag cctcgaacaa gttcaagaaa gtcaaggagc ccgcatcact    369840
     gtcggcatac ttctgcgcgg tctcgaataa cacaatagcg atggcatcgt tcaagatcga    369900
     ctcgccaaaa ataaccgtgt agagcttcgg ctcgaccttg tacaagttga agatagccaa    369960
     gatggtgacc ggatccgtcg ccgacagtgt cgcaccgacc gcgatggcct caacgaagga    370020
     aatgttcaac ccatccaacg gaattctcgt ccagacaaac aggaccagtc ccaacacgat    370080
     agccgagatg aacgttcctg cgaaggcgaa ggtgagaatg gtaccgatgt ttcggaagaa    370140
     gttcgcctgg tgtaattcgt aacccgatgc caaaataatc ggaggaagga gaaggttgaa    370200
     gaagaactga taatcgaagg tgacgctatc ctgaatgggt gactcaggac tcaatcggat    370260
     gatcaatccg acaaacatgc ctaaagttat cccataccca tgagcgcctg atcctcataa    370320
     tatcccgaaa ggtaacaacc aagctgcgat cgacataccc gcaaatatag acagcactgt    370380
     ttcatgaacc gcctggatct tcttctgttg gagaatgtaa ctcgtaaata gcgcgaacat    370440
     caacaacata atcaggatga agagcgccca ggagctgaag aactccttat cgccggtgtc    370500
     cggagcatct gctgttaaaa ccgacattgt cagaaccaat ggcctcatgc agaaataaga    370560
     tattttgggt gaagtataat gcgcgtacca tcatcggggt ccgtatccga atccacagct    370620
     ctccctgaaa agcacgagtc cgttagtgat cattttcgtt tcaaatcgcc cggccgcgta    370680
     tgcatccatc acaaggggcc gccgcctcct cacagaggaa acccccaggt atctctcagc    370740
     caacaacccg aatcttgaca tccgcatgga aggaaaccac tgatatcgca taggacattg    370800
     gagacatacg gagtagctgg tgtaaaaagt tgcccatcac ttgggtagcc attgtttggg    370860
     gatatccctc gcaaccacga cgcggatgac ggttaacgcc cagcagcgag tctctggcac    370920
     ggggaccagg cacacataat ctgccgatcg caaaagacct gacgggaggc agaaaggcgc    370980
     aacagcagcg aaaagcgaga gacacgagag atgtgtgaag cgaaagctgg catgagtagg    371040
     ggacaagtat tcgtcaacgc ccgccggagt cccgcgtggc caagacccga cgctgttcgg    371100
     cccgctgatc ctcctggcgt gtgacgtcgc ctcaatagat gatactctct attacaataa    371160
     cgggcctttt tcttactatt ctttcccact tcggcctggt gttccagatt ctggtcactc    371220
     tcccatcagt gtgtaatatt gatattacta tctttctgtc tgttactcca ccccaataag    371280
     agcaatccta cgatgaaaca ggcactcccc gtgctccctc ggtaagcctg ctggtcagca    371340
     cagccgccaa tactgccgcg cagcccccga acctcatcac ccacccgaca ctatcatccc    371400
     acggctcacc ccgaggcttc tggaacgcct tgaaaatcgc actagaaatt agactcgaga    371460
     tgatttgtgg cgctgagatg gccacattgt gcagtccgag gatgatccct gcctgtgcca    371520
     gattttcctc ctcttccact tcccctgcct tggcagttga agtgggtgat ccattctcca    371580
     ggtcatgctc gtcggtagag gcgcgagctg gtaaacttgt atcattgcga ggctgctcag    371640
     cggagactgc gccctcattt tgatgtcgcc ggattcgacg ctccgtgtca atgcgggaga    371700
     cctccgcaga gattagggca aagggtgccc aaagcgtcaa tgcccacgaa atccctacga    371760
     tcccgatcac caccgttgcg gcttggtaag aatagatgaa gaaggtgctg aacatacaga    371820
     cagcgaacag gatatgcgac ataagccacg cacgccgaag ggtgaatccg gggatctgca    371880
     acttcgatag ccacttatct tcccctgaat cacccttgtt gattcccaag atgggcgcgg    371940
     gtgcctccat tgcagtgcca atcgaggatg tcgacagcct tctattgcct aggaagggct    372000
     catcctctga ctgaccttcc gtaggcgtag gctcagaagg aacagccgac ttgtaggttg    372060
     gaacaacaag tacaggcaac gtcaaattag tcacaaatga gatgattgcg tagaccagca    372120
     gcgcgaatgt cccaatcctc gtagcttcct cccaagcttt gttgatatca tcatccgaga    372180
     gaccggggtg tccatcgaag atcggattca caaagagctg cccgatatat gtcgtggaat    372240
     agaagaggaa agggaaccaa cccacccacg cggcaagttg aacttcgcac accttggcaa    372300
     tctctggcgg tagatgcttg atcgacttga aaacctgctt gaagaatgtt acaagcccag    372360
     ggttccccga tgaaggcgtt ccatctagac ggggatcacg ttccttgatg tataggcagc    372420
     taaccaacaa cgttatccca agtgcgatgg acgccaatgc acataggact ttgaactgcg    372480
     tgtttcccaa gaacgggaac catttcggta gatccatgta tccaaaaata tatccgagaa    372540
     tgttaccaac accggtgagc cggctagccc atgcatttgc cgcctcctgc tggtgcgaag    372600
     gggcattgtc cacaatgaaa caccggatgc ctgcctgcac tacagccgaa cagtcacttt    372660
     aggtttgcac atatcagtgc agcaagaggg gacctaccag tatttacaga aaagtcgagg    372720
     cagtacatca aaatggtggc cagtacaatg accactgtcc gcgttgcact agaagctgga    372780
     tcgacaccga aaagcccaag gaagcctccg gtcatctccc tgacccaagc gagggcaagg    372840
     agagaaatga ccgttgcaat gccgcccaca accatgaacg gctttctctt gccccatgaa    372900
     atgcggcagt tgtcgctgca aatgccgata tacggctgca caagggtacc tgttataggg    372960
     ccagcaatcc aaacgaatgc aagcagagcc ttgctcattc caagagacag gaggtagggc    373020
     tatgctcata caacagaatt agcccctatt cccatgtagg gtccgataaa cagtggtagc    373080
     ttaccgatcc attcgacagc tcagtggacc acacaacctg gagactagaa caacaaacct    373140
     cgttagcttc gggcaaaagc tatacaacac acagaaacag ccctagatta catcgccaac    373200
     gggacagact tgttacctac ccgccaatgc tcaaagtcaa caaaaacagg taccagctgc    373260
     tcttcgtctc ggacagatgg tgagcatctc cagccccgct ggtcccgttg ttatctccat    373320
     ttcttgacat cgaatgcact tgattattgt cagatgctcc caccaaaggg gatgtttcat    373380
     cagcgaaccg ctcatgcgtt tctggcattt gatctagcta gcagcagcgt tgctggacac    373440
     aacgatcccc tgctaacagt cggggaattc aggagaaatt accgcgcgtg tgtgtggtac    373500
     gatcaggtct tcctgcgtta gtcattcatg ggatagaaaa agccccgaag atagcacaca    373560
     cggtctagta gtatataaac tgattagacg tggatagata gatccaaggg tttggaaagg    373620
     ccgtggtaca caagctagtc cagtatggaa tgcaaccgtt ctgtggcttc ttcctgacgg    373680
     aggttgaagc aagtggtagt gcaatatagt gtgagatgat cccaatcaag ctgctggaac    373740
     gtggctggat tcttagggat tcggcaagag gcggtcgtgg acacgcgagt ctgtgttcag    373800
     gaaaagtgaa gcgctcgggg agcagtatac tgtaaatagg aggtatggca cgaagatcaa    373860
     cccttggggt tcctagtctt gctccatgct ggacagatca gaacaacagc ttactgcaga    373920
     gaaatgaaga ggagacattc ccgatgaata cgaatggggg ttcatgggat gacgatacct    373980
     tgtagaatcg ggtcgacgtc agcaggccat gcacgtgata taccccgatc tggaagccgg    374040
     atcggacggg tcacgattgg atcaggcgga gacacgcagt cgtctgacag gtgacaaaca    374100
     tcaatcccct gactgaccga ctgactgact tttacggcta ctagccattt aacagcatgg    374160
     gtttcattac catttgattc atatctatat gtatgtgctc aacctctgca cgcccgtcgc    374220
     agacacaaga atccatccat ctctcggaat atctatagtg gaagaagctt caaatccaga    374280
     accccctcct tgcatccccg cttcaggtgt gtgcctggag agccgcaaaa tattccacga    374340
     ggaaagaaaa gtagccattc caggctatgt gcccttttta atcaaccctc atctgtaaat    374400
     ccaacctccc aaatattccc atcaccgcga taaatgaaat agtacaagaa agcccattat    374460
     caacatagca catgaaacaa ataaaaccag taaacccgac cgaacaaaaa gagacaaggt    374520
     gaaaaacaag gacgattatg gggtagagac aacagcatac caaccccgag ggacaaacac    374580
     atgtaacgct tattatggac accaaaatcc agaccgaccg caaataggaa acaaaggaag    374640
     attcaatcca aatctggaag cagccccgtc atcagccggg ggacaaggcc gcgaagcagg    374700
     agatgaggtc ctgcgggaag ccaatagctg tcaaccgagc ctcagtgacg tggcatcaac    374760
     gtacaggagc cacaaggccg aacagcgtac acttggcgat gcaatcaatc aaaaacggag    374820
     taagggacgt tttgtatgca gacacgcgcc ctaaaactcc tagagttaat tagtgagaac    374880
     aaacacagta gacgaccgag ggtcgagatg caaaagcatc agtaaggact gaacaaagcg    374940
     aacagggtaa catgtaacat ggtctggcga agaacaacca gttagaggtc caccatggcg    375000
     ctcactcata gctgctgctg caagagttga ggcgcaatca tatgaggagc gaccattgtg    375060
     ggcatagccg aaggcaaggt catagcggag ggcatcgtgg tcatgccagg aacattgacc    375120
     atggcacctg agacagattc agacggggac gagccctcct cggccgaacc aaatccgttc    375180
     tcttcatttt ccaggtcttc ctcgtggcca gaaaggggct gctgcccatc ctgttgagcc    375240
     tcgtggattc gacggtgtct atcaggcaga ttagcatcct gcaatgaata ataagtgaat    375300
     atgttgataa cttactgtgc caggttatcc gatcgggaga atgctttgtt gcagtaagga    375360
     caagggtaag gcctctcctg ggtgtgtgtt ctcacgtgcc tggatccttc atgttagtcg    375420
     gcggctacag aaacaatggc tttaaggctt ccgtcgatcc cctaggaacc cggaccaatt    375480
     ggacagctca taaaaataga attttgcaac ttaccgtttc agatgttcta atctcttgaa    375540
     gaggcgcccg catgatggaa tggggcagga gtgtgacttc tgcgggtagg ggccgagctc    375600
     catcatggta gcgctccgag cacgacgaat gggaccgtat cggtcagact tattcgtcgc    375660
     actgttctgg acagatgcat ctagcgcctc accactaggg agaggcgcta actcatctgg    375720
     ttgatttgca agagccaagg taccctgctc ggggttttcc tcgaggctcg gcagcggggt    375780
     gctgttgcgg gacatctcat gcagcaaatt cttctgggga aggactgcag cgcgatagcc    375840
     attggcagcc ctgaaagact gatcatgatg agactcatcc acctccgcta ccggagccac    375900
     cgagctagag actgaacgac gaaggtcgct gggtttatgg gccgcgtacg caacagcttg    375960
     gttcggtgca ctcgtcacct gggggtgcgg gccagcgcca acgctggtga tactcggggg    376020
     tatcgaagac cggcgcctac gttgcttgta cgtaggagag ccttcgatga ccgagtagac    376080
     atttgaaggg aaagttctcg caggcgccgg gtagtgagca tgggcaagat tcgacggggg    376140
     tagctgcatc attggattga agtgagttgc ggaagagata tcggggatgg cggtgtagag    376200
     accggtgtct tcgttagcga tgtatgccgg ttcagctcca aggtgggagc tgtgctgagg    376260
     aggtgtaaca ggctcgaacg atagaccccg gttgctgtag tcctcgtatt gagacgaaac    376320
     gaacgatggc gctggcgagt attcgacgaa ggtgggcatg gaggcatggc gctggtgcag    376380
     acgagcaatg ggcatgccat tgcggtcgta ttggatgtgc ccgtactctg cttcgcgctt    376440
     aataacgctc tgggccaggg tggtgggcat aggaactggg ttgtacatcg ccgggttgcc    376500
     cgactcgtcc gggagaaggg gtagcgccgg gggagccatc tggggagcca tctggggagc    376560
     catctgggga ggaggcatag cgtcaacggt ccgaaccact ggggatgcgg gttggccata    376620
     tgtcgtactt gcgtgtgcag caaacgatga ggaatttgct tgttgtgcct ttgtgagttg    376680
     ttcatacagc gactgggatg aatcgaactc gaaagacaga gcaggctcgc tgaccgcaac    376740
     cgtggtcgcc tcctgcccca ttttctcccg cttcagatca cgttccaacg catcaagaaa    376800
     cagccgatcg tgtggcacgc tgtaccagta gaagactttc tgctttttct gggttcgaat    376860
     gcaattgttc ttgtagagga agtcgaggaa cgggctcttg ggttcttcta gagtagcatc    376920
     agttccggcc ttgaggtttc gcaagtccga gaagataccc tcctcgaact tcttcgaatt    376980
     cttcacaggg cgcccgaagg cctggaatct gaatgcgagg catctcacga tgtcggttcc    377040
     ggagatgtgg aagaggttgc tcctgtcgcg aatcagttta ggtgcccttt gatcaactgc    377100
     atggtattgc gacgatcgca actaaccata agacgcaaga gatatagtcg ccagtaggaa    377160
     gcaagaagcg tcggataagt tgatctgcat gccagtctac cggcgccgag aggagaaagt    377220
     atttgactat accatagata gaccattagt caggagttcc atcaaagagc ccagatcgaa    377280
     ggcgactgaa agctaaacag gagatctggg ggggttgtaa gcaaccgcaa agggaaacgt    377340
     acgattgtca acctgctgca gcgcgacttg cgcgtcatgt ggaaggcttt gctgggcctc    377400
     agtggaaagc ataaacgtct ccggcttttg gggaggtgcc ataggggcac cgtgttggga    377460
     atacatagcg gatgtgatat acgatagtct gtaggggaat cagtcaaatc tttaaaacga    377520
     cggtttgctt gcaagcataa gcgcgaacaa agaagagcgc catgggagcg gcaagtggac    377580
     ggtgtcacag agccactggt tgggcagagc aaggagttac gcacagtcac agcacccggt    377640
     taggaaagcg gacaaacaac cactcgcaag gaatcaaggg gagcgatctc ggaggattga    377700
     atgctataaa aagacagaaa caggtttgga tatagggtgt tcaacgacgg aatcgtgaaa    377760
     cacaaagggt tatccaaaca cgggcgatgg taagaaagag aggtgccagc ctcttgtatg    377820
     ggaagagtag ctagtattta ggcgctgacg ttgtgccgac cctcgtcaac aaagggcaaa    377880
     tgaaaggcag tgagaaagag agagagtagc aacagagagt tgaactgggc cagcccgatt    377940
     acaagtccct tgaggagata actcgcacgg cgaagatgga gtggaaatga aacgaaagga    378000
     ggtgaagaag aagaagagga aggacgaagt aagaacggaa gaagaaaaac agagagatgc    378060
     cagtcgcgat gggaagagag gaggggaagg ggaagagagg aagaggacga agtggaggga    378120
     tgaagtaggg acttgctttt ttacagcagt gatgaggtac agatcaagta tgggagggca    378180
     gtcggtaacc ggtaataata atgccaatcg atacaataat aatctaacaa taaataataa    378240
     aatcgggaaa aagaacaata ataattttaa acgaccggcc agtgtcgagg gacggagact    378300
     ttgggtctgg gaggagtaat tcagggagcg ccgccgaccg agacccgcgg atcgagtcgc    378360
     ccacttctgg agtccctctt ctagtactct ctctctctct cttttctcct gggcggcttg    378420
     actaagtcac ttacttactt agttggttgg gctccggcat acgcgcacgg cgaaaaagta    378480
     gggctttttt ttacccactg agtaaagaat aggaaaatat aagtggagac ttgcgccagg    378540
     gaccgacttc agggcagggg agaagggaag gggaaaaaat aaataaataa aaaagaaaaa    378600
     gaatatttga gagtaagtaa aaataataaa ataaaataat gaataatata ataataaaag    378660
     agggggggga gggaaaaaaa aggactgaaa gcctgagaga gcctaagggc aaaaaaagag    378720
     gaggagaaaa ccagagagag agagcgagaa agagacgaca gagagagaag agagagggcc    378780
     ctcccggtat tcaaatcaca cgatacagga attatacacg tatggtaaaa agggctgctc    378840
     cctgaagtaa cctcccccag gaccgataat ccagctattt gctactctca acagcaagtt    378900
     cacaactcca aaaagtgggg tcaacggtaa ggtattcagg tatccaaacg gtcaggtacc    378960
     aggaggataa ccagcttacc agacagtggg gctgccgccg acttccaaag attccagtcc    379020
     atcccatccg ttagtgattt tttgttgccg ggcccgcctc cctcttgggt tagtccacct    379080
     ccatcgttgc taaacttatc catagaaacc tgctggaagg tggtaagagc aatcagtatg    379140
     gagtaagttc tcttgtagtt aactagtcag ttaattttct gctcagtcat accaacattg    379200
     aaagggggga aagaaaaaag aaaagaaaag aaaagagaaa atcatcagtt gaaagggctc    379260
     tctactacat actacatgct acaaagtaat catcctacac accctgtctg cctcctgcag    379320
     cttgcaatca tacaccccaa agctttaagc caatcccatt gaatctgtgg ggtagcctac    379380
     ctgctccgac ttggcgactg ttaatttgaa gagcgcttcc tgaagatatc ttacatcatg    379440
     ggccgcgcga tatttactgg cttttgctat gtgtggggaa ggtgtggcta accttagtta    379500
     ccttacacag aagaaaggaa tgggcaaaca gaacatgcaa aagtggagat ggtccggtag    379560
     cctaggcacc tccatgatgg gtcatgggta tccgacgacc tgactgttgg gaattcattc    379620
     ggaattgcaa ccaaaatagg atatcatttg gctttctctg tgcacaaact gtcctgagtc    379680
     ggatccaggg agccttaacg caagtaagct ctatctcttg gcatcccgat attactatca    379740
     gaagctttgg aaaaggggaa atcaggagaa gggttttcct ttgtggtgta gtaagtaagt    379800
     attgtgtagt aagtagtgta caccaccaga tatgcacata ggcgcgcacg ggcgatgtac    379860
     ctcctcctcc tcctcttcac tgacttaggc gatgattttt tgggggcctc attcttcttg    379920
     ggggccattt gccaggtttc cagcctatcc aagcattaca cacatacaca aacacaaccc    379980
     accattgaca ctagcactgc atatcacagc cagcggctat ggtaagggaa gtcacatcga    380040
     ataagaaaca gtagatgcgg gttgcttaac cgcccagttc atcgctacca accttcttct    380100
     acagtagtcc acccttcgct ttttttttta gcccttttgt gccagcaatg ctgcccgctt    380160
     ggtcaaggca tggatatgaa atcacaaacc aaggcgcctc gctgggtttg ccgccttggg    380220
     tggaaccaag aaaagaccac tacgccaagc ctgcacaccc gatcaaactg gcgcgggaaa    380280
     caatcttgaa gcattcgccc cttgtttcag aattctggtg agcgcttacg actccgccaa    380340
     tgggtggcat gggttatccc ttccaaccca caattttcag tggccccaac tgaactcaga    380400
     gaagcaaatc cactttccag tcatggtagt gtgcctttct ctctctctga gataggtttg    380460
     tttacccttg cctagttact cagtcactta ccttccctgt atgttaacta ctgtagctat    380520
     agtctgacta tcagactagt agggtagcta gtaatagccc atccatccat ccatcacctt    380580
     ggtttcctga ttgttctgtt gacccttcca gcaacacagt aggacaaagg cttccaacct    380640
     gattcttcga ttgtgtggtt ggatatctgg cggctatgct atcatcatct gcaaataatt    380700
     gcctggcgtg gcatggcatg ggcatggcag tgttgtatta cttacttgtc atgggctcat    380760
     ctgattgtcg gacgagcatg cacagtaccg ccacccaatt tctgtccaac aggcgaatta    380820
     catgcagggt tgttatgcgg gtttccgaag tagttagtat ctagctagta gaaactcttc    380880
     agagcaacac cactacttgt aactgatggc accaaaaata aaccgactga ctgatcttac    380940
     gtgataacca gtttgaccgt ggcgcacaat gatgtacaat ccttggtatt attcatctag    381000
     tagaaacaga gtagatacta gcctctaggg aagtctaccg aagccgtcgt acagtatgat    381060
     atgaattgcc ccttcggctt gcatctggcc ccctttgttt gggaagatca agggtaccgt    381120
     ggaggtcact cggccaggca gtgcttacac acatgtacat acagttccaa aagcatggcg    381180
     ggcttagctg ctcaaagata ggaatagcct acagcccaaa acgccactgc caccaaggga    381240
     cgcatgaccg gtgagatttg ccgctcaagg ctggttgggg gtttgcttaa gatagtagta    381300
     gttgggaaag taaaccccgt aagttggtac ctacttaggt actttctgcc tttcgattgt    381360
     ctttggatat atataactga tcaaggtgat caatcactat caccatcatg gcggcaagcg    381420
     ctacgcccat tggcccacca accataaccc ccaaatgaag attaatatcg gatagtacaa    381480
     attatcacga tcgactaaat cacattcacc tgactcttcc acaagataca ggcaacgatc    381540
     taaattaaat cgcacacagt atgaggggcc cgattacccg agctcaattt tgagacatca    381600
     aggtttggtc cgtgtgcatc aatatagtgc acttcgatat taggatcgtg ctttatgggg    381660
     tatgttccta actctcagaa catcaggatc gtcctcgccg tccgaattca tagatgcctg    381720
     atgatattat cactggtatg tcagaaatga cataatgatc gccctagtca cataccaggc    381780
     tgaatcattg tagcaggata ggaaacaagc gcgggtaaag tcgcaatcca tgtttcgtga    381840
     cccgagctaa cccatttgtc taacgcgatg acaatgacaa atctgaaatc gattgtttgc    381900
     tagttactat gagagaaaaa ggcgatgttg cgaaaaatga ggtctagccg gttcatcccc    381960
     ggagcatgcc atcatacggt caggacgttg agcatcaggg gtgatctgcg caatccgaag    382020
     gatggatgcg aaaacggcga agcttagtcg ccaagcctta tgagcccaat tcttgtggtc    382080
     catggtagga tgtgtcttcc gaaagtcagt ccgaagtgtg cggtgaggcc atgattgccc    382140
     cctttacttc ctccacttca gcccgttcag ggaggttaaa gattgctagt atagtcggta    382200
     tgctggccat agaggcatac ttagtgcagc ggtgccggaa ttgtcaggcg gtcattggcc    382260
     cgatcgtcaa gatctttatg taagttagta gtctactcca cagtttcggc cgaattctga    382320
     atgtccacag agaaagaaaa agaaagctac aagagatagt cgccgtgcac tgtgcagact    382380
     gcaacgactg cgtgtgctgg gcaacaaaaa aaaagggggg gctgcatcat gggtatgcca    382440
     tgccggtcag gagaggtcag ggaccaccaa gaaaacacaa aaatagacag gctgatatct    382500
     gagcactgtc atcgatcagg gtcggtggaa agagacccct tgctaaccat gataaattct    382560
     ccgaagaccc agtcaaaaat gccggaggct ggttgctgca tttgggagaa gtccgagaga    382620
     ccgagcagcc cgagggggcg ccgatagctt gcatccatac acatttagag ttatccagag    382680
     ccatgtctct agtctggacg cctcttcgga gcagactacg taagttgtcg cgatatctcg    382740
     caatagtctt cggagcagtt gcgaaaggaa gtggaagaac ggcggtgaaa tggggattga    382800
     gatggagtcg ggatggctca attccaatag caacagtcgg tggaatggcg agactaaggt    382860
     tagtatagca aatagtgcca gtagtactcc gtcgaagatg ctaagtggtt aagtggtact    382920
     actaaggaca ccttggaaac tcaagctctc ccctgacggt tgaatccttc cagaccctaa    382980
     tggggtggca accaagccgg aataggcaat tgtgcctgga ttccatgggg ttcttgatgg    383040
     agaccaaatg gggccataaa ttacggccgc ctctgccggc ttgctgacca caaggtcgca    383100
     attggtaaag ccggcattag ctcgttagtt agttagttag tagtaagtta gttcagaaaa    383160
     aggcctttct actttgactt acctattctg tcatctgcga agaggaaagg gcgcatttcc    383220
     agcaagggaa ggcttggccc gctctctgtg caatgggcct gcgtttgatc gtccggcctg    383280
     aaaccatcta gaaaagtcca gcactgttcc aagttccggc atccgtcact gccagggcca    383340
     cccgggcaat atctcctact gtatgagcct gtgccgcact cggcctgcac tgctacctgt    383400
     cggggatacg agatgggcag ctcaggacga tcaaacagag gccggaccaa cgctaagtcc    383460
     atctttctac atctttactg cctattctgg tgatcgcttg tgtctcgtat ctagcgatga    383520
     agctaagctg gagtagtgtc caagatgaaa cctcccagcc tgactcgaga acgtgcgggg    383580
     gagcttagag tcgcgtccat ccgggttctg tttacaacta actgtcaggt ccttagtgga    383640
     atgcgcagcg aatgcgccgt ctccatactg atcctcccag cctggtgcac ctatctcttc    383700
     cggattgccg atacgttcgt tggttagtag gccagtcttc gtcggcttcc tccacccaat    383760
     atttcgcgca cacacacaat agtcgcttgt tgacttcagt cagactatcc cacaaactga    383820
     tataaatccg cgaaccatgt taacaaacct tccgagaccc aaaagaacaa ctttggctcc    383880
     ctggagaatc tcgctccgcc agtcaacaaa atggaatggc cggatatatc gaaatggaga    383940
     tgatcagcgg ccttatcctc tcgccgttta aacctcgggt ttcggtatta gcctatatgc    384000
     tgtatggcga ccaacggaga aagctggaat tccgtgtccg cgaatccact tcttttctac    384060
     taactttctg cccaggtcgt agatcgatca gctagcttac acttgtctct cgatcctccg    384120
     cattgtcgac ttctcaatat caaggaccac aggtgacttt tctccagcat acctgtcttc    384180
     taagtgaaaa gatatcgatg ggtctaatca caccagctag cgcattgtca agctgccaag    384240
     aagataaatt agcactaaaa gcgggggtta cgcattcttt tttacgttcc tgcatgaagg    384300
     agcatatagc ggcaatttct gtcactagac attgatagtc caaacctgca tcatgtcatc    384360
     aacaacgaca cgctatacac accattctag cttcatacgg gattcggcag acttccgctt    384420
     aaggaatgat aaatgccaag tgtagtcgga aggattacag agtccgctgg catggcatcg    384480
     tctagactct tcagaaggca ccaaccaccc tgtatccacg agtcacgact caggacttct    384540
     gactcgtact aagcgacatt tccaagcgat tccggtgcaa gtgttaaagt acgctgctcg    384600
     gaagggttac gtgcagaatc tgaaacgacg aagatgtctc cctgtcccgc ctaatggatt    384660
     gtggttcgtg caacggcacg agcatgcaga ttttagtggg agatgactaa cgaaaccgga    384720
     tggatgcatg gcaataaggg tcactaatat tgacgcttag caattcgcat caatttttat    384780
     tttcctcctt tcccggcttc tccattcccc ttcacggcag cggtacctga actagagaat    384840
     tggaaccacg gaaccgcttt tgcactaacc tattattatt ggattattca tgcaggtacc    384900
     ccggtacact ggaactaatt acatagtaga cagaggaact gcctgaaggt gggacgttta    384960
     tccgctagta gcagatcggt gtgccttgta gccgcagaac tggcaaactc aatcatatca    385020
     gactggctaa ctactagtcc ttactaggct ggcttaagcc gaggccgagc gtgagatggg    385080
     gggagaaaaa aggagtgtga ctgatcagat gataagctag aatttgacga ctcaacattt    385140
     ggtgagtgct atactggaaa gaactgacgt gtgcgtgata gtagttcact agggaatcaa    385200
     gctaacaagt actaaaagtc ttgttcacag tcggttcatg cgacactctt tcacccccta    385260
     tatctatacg agatggagac gttctatttt ttgctcgata agagactaga cgctttccag    385320
     gatctatcta tctaggatga ctcgtgcttc agctgtttat agacagcact tagcggctaa    385380
     aactggccaa cctctggggt attctcatgt cggtcgacct tctcaaacat cctaagacca    385440
     taggttgtct cagaaatggg ggtctcgtcc tcaaacctta gctcgactcg gggatatcac    385500
     cgtattcgga acagcgtgct cggtctcgcg catagtttag tgcgattgga acgtgctttg    385560
     caggctggtc ttgaggcgtt tcggagaata aggtttgagt gggcaaatca gaagtttcag    385620
     cattgaatca aggctgcggc cagcatgagc gccagggcca tctcgacgtc ctcattacga    385680
     gcgggcgcat cgttctgctc tcccctttcc tgacgcacat cgaggactcg ttcccgacct    385740
     atcacaacat ctctggtcgc ggtcaacctt cacaaagggg tcggggcgtg ttagtgaaac    385800
     agccgaagga cagaaggagg gcgaaggatt gatagagagt tcctcatgta aagaaactag    385860
     actacaaccc ctcttccggt aagaattact ggggctagga tacgtcgaca gccaacccat    385920
     gtcgaatcag ggcgccgcgc tccgggcgcg cacgggacat gaaaggatct gactgggagt    385980
     ggtgtcaggc gtggctagta ctgccattca tgtctctcag gcaggtctaa cgacgtcctc    386040
     tgcctctgcc cttgcccttt gtcgtgcggc gcgggccttg aatggcggcc acgtcacgct    386100
     tgctcaagtt caaagcacca cccgcaaatt ttccgataga agcacctccg acaccgcgct    386160
     cccgacgctt ggtgctggct ggatttgatt tgggtgcggg cttctcgaga atgataccgt    386220
     tctccttggc ttcacgtcga cgcctatctt ccttcatgtc tgccttctcc ttgatacctc    386280
     ttctgtgcgc tgtgggcatt ttctgcttat acagagacgc ctttgccccc agttcctgca    386340
     ttctcagatc aagagccttg attcggtttt taccggttgg cgcaagttcg tttgctgact    386400
     cgagcaggtg ggactccttc agaagccgtt gcaaggcgag atcattcttc agattatccg    386460
     catccatggc atcctcctcg tcatcgtcac tcttttcctt cttggccttc tttttcgcag    386520
     gcttcggctc ttcggaatat gagggcggtt tcgaggtcta gtaaaggcga attagtaaag    386580
     aagccacgac agcacaagca aatctcgtag acgtaccata aacgccttgc gcgccttttt    386640
     gtccattaaa tcctgactct tgatatcacg atgctcaact acctcaaccg gagcctcatc    386700
     ttcctctccg gaaaggccat cccaatcaga gcccgattca gatccctcct caaagtcctc    386760
     gtcctcactc tcttcctcat ccgactcatc attgcgagtc acctggcccc caggcacctc    386820
     caacggttga aactgcgctt caaagaattt gcgaaaaacg tccgcagcag acgcatcagt    386880
     cgtcgcagtc tgtgacgtcg tcctctcctc ctccttatcc accttcgtag tcctggagac    386940
     aacagcagcg tctctcttgc gctttccaac catcttcaat tccttgtgct gctgctggta    387000
     aaacaaacaa ttaaatgctg aacgaccgac caccgtcccg gcggaaaaaa ataatgcgcg    387060
     cgataagtga cgactttgcc gtaatccagc cgcttatgta acccatctac ctccaaacat    387120
     gattcctatc acgtgtagat aagataaccc gcgcaacccc tcgtcggatt tccacaaaac    387180
     cgtgggggga atggatggag ttcattcatt cacatcagta ctaattagac atacgaaatc    387240
     aattgagcaa gcattgtggt ggagaatctc atcaaaatga ccaaatttcg tccctgcatt    387300
     gatctacact ccggccaggt gaagcagata gtgggcggca cgttgagcag tgttgcagcg    387360
     gacctgaaga cgaattatgt gtcgaagttg ccggccagcc actatgcgga attgtacagg    387420
     aaaaatgatt tgaggggtgg gcatgttgtt atgcttgggc ccgggaacga tgaggctgcc    387480
     aaggaggcgt tgaagacttg gcctgctggg ttgcaggttg cgggggggat tacggataag    387540
     aatgcgaagt attggattga catgggagct gagaaggtta gttgtttctt ctaggttttg    387600
     ttctgttggt gtgtatggat ggatggggga cgggcggggg ttgggttgtt gggtattgct    387660
     ttggcttggt ggttgtgtgg ttgttgcgca gtatgatggc tgatgttgca attgcaggtt    387720
     attatcacat cgttcctctt cccggagggc aaattctccc ttgagcggct acagtccgtt    387780
     ctggctgcgc tggatggtga tagatctaag ctggtcttgg atctgagctg caggaagaag    387840
     gataatacgt ggtttgtggc tatgaatcgc tggcagacga ttactgagat ggaaatcact    387900
     caaggtaagc aattctggaa ttgaaattga tgctttgttg ttgtggtttt gcttgctctg    387960
     ttgtttacta cacatcctct ttcttgctct gctgtcagtc attggctcag tacaactaac    388020
     agaggcagaa tcaattgcac ttttggagcc ctactgttcc gagttcctca ttcacgctgc    388080
     agatgtcgag ggtctgcaac agggcgttga cgaggagctc gtgtccaagc tgtcccagtg    388140
     gtgcacgatc cctatcacct atgccggagg tgctcggaat cttcaggatc tggagaaggt    388200
     tcacgtcagc agccaaggga aggtagattt gacgattgga agtgcgttgg atatctttgg    388260
     tggttccggg gtaacgtttg atgagtgtat agaatggaac aaggcgcact agggtgtggt    388320
     cgttgaataa ctgaacgaaa tcgtggtcaa atttttagac atgagacatg gcagatgatg    388380
     tatatatatt ccagtcaata ctg