(data stored in ACNUC27637 zone)

EMBL: AY099530.NCBP2

AY099530.NCBP2       Location/Qualifiers
FT   CDS_pept        61..528
FT                   /codon_start=1
FT                   /gene="ncbp2"
FT                   /product="nuclear cap binding protein subunit 2"
FT                   /db_xref="GOA:Q8JGR6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR027157"
FT                   /db_xref="InterPro:IPR034148"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8JGR6"
FT                   /db_xref="ZFIN:ZDB-GENE-020419-31"
FT                   /protein_id="AAM28218.1"
FT                   /translation="MSIKLNALFSDFYVDVSQYRDQHFKGNRYEQEKLLKQSATLYVGN
FT                   LSFYTTEEQVHVLFAKCGDVKRIIIGLDKIKKTACGFCFVEYYTRADAENAMRFVNGTR
FT                   LDDRIIRTDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKMVQKS"
     atgtccataa agttaaatgc tcttttcagc gacttctatg ttgatgtgag ccagtacagg        60
     gatcagcatt ttaagggcaa ccgttacgag caggagaagc tcctcaaaca gagcgccacg       120
     ctgtatgtag gaaacctgtc cttctacacc acagaggagc aggtgcatgt gctcttcgcc       180
     aagtgtggag acgtcaagag gatcatcatc ggcctcgaca aaatcaagaa gactgcgtgc       240
     ggcttctgct tcgtcgaata ttacactcgt gcggacgctg agaacgccat gaggtttgtc       300
     aacggcacgc gtcttgacga ccgcatcatc agaacagact gggacgcagg cttcaaagag       360
     ggccgacagt acggacgggg gaaatctggt ggtcaggtca gagatgaata caggcaggac       420
     tatgatcccg ccagaggggg ttatgggaag atggtgcaga aatcttga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page