(data stored in ACNUC7421 zone)

EMBL: BA000007

ID   BA000007; SV 3; circular; genomic DNA; STD; PRO; 5498578 BP.
XX
AC   BA000007; AP002550-AP002569;
XX
PR   Project:PRJNA226;
XX
DT   25-OCT-2004 (Rel. 81, Created)
DT   30-JUL-2018 (Rel. 137, Last updated, Version 15)
XX
DE   Escherichia coli O157:H7 str. Sakai DNA, complete genome.
XX
KW   .
XX
OS   Escherichia coli O157:H7 str. Sakai
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-5498578
RA   Ogura Y., Kurokawa K., Hayashi T., Hattori M.;
RT   ;
RL   Submitted (26-JUN-2000) to the INSDC.
RL   Contact:Yoshitoshi Ogura Kyushu University; 31-1 Maidashi Higashi-ku,
RL   Fukuoka, Fukuoka 812-8582, Japan
XX
RN   [2]
RX   DOI; .1266/ggs.74.227.
RX   PUBMED; 10734605.
RA   Makino K., Yokoyama K., Kubota Y., Yutsudo C.H., Kimura S., Kurokawa K.,
RA   Ishii K., Hattori M., Tatsuno I., Abe H., Iida T., Yamamoto K., Onishi M.,
RA   Hayashi T., Yasunaga T., Honda T., Sasakawa C., Shinagawa H.;
RT   "Complete nucleotide sequence of the prophage VT2-Sakai carrying the
RT   verotoxin 2 genes of the enterohemorrhagic Escherichia coli O157:H7 derived
RT   from the Sakai outbreak";
RL   Genes Genet. Syst. 74(5):227-239(1999).
XX
RN   [3]
RX   PUBMED; 11108008.
RA   Ohnishi M., Murata T., Nakayama K., Kuhara S., Hattori M., Kurokawa K.,
RA   Yasunaga T., Yokoyama K., Makino K., Shinagawa H., Hayashi T.;
RT   "Comparative analysis of the whole set of rRNA operons between an
RT   enterohemorrhagic Escherichia coli O157:H7 Sakai strain and an Escherichia
RT   coli K-12 strain MG1655";
RL   Syst. Appl. Microbiol. 23(3):315-324(2000).
XX
RN   [4]
RX   DOI; .1016/S0378-1119(00)00416-9.
RX   PUBMED; 11111050.
RA   Yokoyama K., Makino K., Kubota Y., Watanabe M., Kimura S., Yutsudo C.H.,
RA   Kurokawa K., Ishii K., Hattori M., Tatsuno I., Abe H., Yoh M., Iida T.,
RA   Ohnishi M., Hayashi T., Yasunaga T., Honda T., Sasakawa C., Shinagawa H.;
RT   "Complete nucleotide sequence of the prophage VT1-Sakai carrying the Shiga
RT   toxin 1 genes of the enterohemorrhagic Escherichia coli O157:H7 strain
RT   derived from the Sakai outbreak";
RL   Gene 258(1-2):127-139(2000).
XX
RN   [5]
RX   DOI; .1093/dnares/8.1.11.
RX   PUBMED; 11258796.
RA   Hayashi T., Makino K., Ohnishi M., Kurokawa K., Ishii K., Yokoyama K.,
RA   Han C.G., Ohtsubo E., Nakayama K., Murata T., Tanaka M., Tobe T., Iida T.,
RA   Takami H., Honda T., Sasakawa C., Ogasawara N., Yasunaga T., Kuhara S.,
RA   Shiba T., Hattori M., Shinagawa H.;
RT   "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and
RT   genomic comparison with a laboratory strain K-12";
RL   DNA Res. 8(1):11-22(2001).
XX
DR   MD5; 21f8cf4ccb82d5f145d9b7e9c4032d19.
DR   BioSample; SAMN01911278.
DR   COMPARE-RefGenome; Sakai.
DR   EnsemblGenomes-Gn; EBG00000036302.
DR   EnsemblGenomes-Gn; EBG00000036303.
DR   EnsemblGenomes-Gn; EBG00000036304.
DR   EnsemblGenomes-Gn; EBG00000036305.
DR   EnsemblGenomes-Gn; EBG00000036306.
DR   EnsemblGenomes-Gn; EBG00000036307.
DR   EnsemblGenomes-Gn; EBG00000036308.
DR   EnsemblGenomes-Gn; EBG00000036309.
DR   EnsemblGenomes-Gn; EBG00000036310.
DR   EnsemblGenomes-Gn; EBG00000036311.
DR   EnsemblGenomes-Gn; EBG00000036312.
DR   EnsemblGenomes-Gn; EBG00000036313.
DR   EnsemblGenomes-Gn; EBG00000036314.
DR   EnsemblGenomes-Gn; EBG00000036315.
DR   EnsemblGenomes-Gn; EBG00000036316.
DR   EnsemblGenomes-Gn; EBG00000036317.
DR   EnsemblGenomes-Gn; EBG00000036318.
DR   EnsemblGenomes-Gn; EBG00000036319.
DR   EnsemblGenomes-Gn; EBG00000036320.
DR   EnsemblGenomes-Gn; EBG00000036321.
DR   EnsemblGenomes-Gn; EBG00000036322.
DR   EnsemblGenomes-Gn; EBG00000036323.
DR   EnsemblGenomes-Gn; EBG00000036324.
DR   EnsemblGenomes-Gn; EBG00000036325.
DR   EnsemblGenomes-Gn; EBG00000036326.
DR   EnsemblGenomes-Gn; EBG00000036327.
DR   EnsemblGenomes-Gn; EBG00000036328.
DR   EnsemblGenomes-Gn; EBG00000036329.
DR   EnsemblGenomes-Gn; EBG00000036330.
DR   EnsemblGenomes-Gn; EBG00000036331.
DR   EnsemblGenomes-Gn; EBG00000036332.
DR   EnsemblGenomes-Gn; EBG00000036333.
DR   EnsemblGenomes-Gn; EBG00000036334.
DR   EnsemblGenomes-Gn; EBG00000036335.
DR   EnsemblGenomes-Gn; EBG00000036336.
DR   EnsemblGenomes-Gn; EBG00000036337.
DR   EnsemblGenomes-Gn; EBG00000036338.
DR   EnsemblGenomes-Gn; EBG00000036339.
DR   EnsemblGenomes-Gn; EBG00000036340.
DR   EnsemblGenomes-Gn; EBG00000036341.
DR   EnsemblGenomes-Gn; EBG00000036342.
DR   EnsemblGenomes-Gn; EBG00000036343.
DR   EnsemblGenomes-Gn; EBG00000036344.
DR   EnsemblGenomes-Gn; EBG00000036345.
DR   EnsemblGenomes-Gn; EBG00000036346.
DR   EnsemblGenomes-Gn; EBG00000036347.
DR   EnsemblGenomes-Gn; EBG00000036348.
DR   EnsemblGenomes-Gn; EBG00000036349.
DR   EnsemblGenomes-Gn; EBG00000036350.
DR   EnsemblGenomes-Gn; EBG00000036351.
DR   EnsemblGenomes-Gn; EBG00000036352.
DR   EnsemblGenomes-Gn; EBG00000036353.
DR   EnsemblGenomes-Gn; EBG00000036354.
DR   EnsemblGenomes-Gn; EBG00000036355.
DR   EnsemblGenomes-Gn; EBG00000036356.
DR   EnsemblGenomes-Gn; EBG00000036357.
DR   EnsemblGenomes-Gn; EBG00000036358.
DR   EnsemblGenomes-Gn; EBG00000036359.
DR   EnsemblGenomes-Gn; EBG00000036360.
DR   EnsemblGenomes-Gn; EBG00000036361.
DR   EnsemblGenomes-Gn; EBG00000036362.
DR   EnsemblGenomes-Gn; EBG00000036363.
DR   EnsemblGenomes-Gn; EBG00000036364.
DR   EnsemblGenomes-Gn; EBG00000036365.
DR   EnsemblGenomes-Gn; EBG00000036366.
DR   EnsemblGenomes-Gn; EBG00000036367.
DR   EnsemblGenomes-Gn; EBG00000036368.
DR   EnsemblGenomes-Gn; EBG00000036369.
DR   EnsemblGenomes-Gn; EBG00000036370.
DR   EnsemblGenomes-Gn; EBG00000036371.
DR   EnsemblGenomes-Gn; EBG00000036372.
DR   EnsemblGenomes-Gn; EBG00000036373.
DR   EnsemblGenomes-Gn; EBG00000036374.
DR   EnsemblGenomes-Gn; EBG00000036375.
DR   EnsemblGenomes-Gn; EBG00000036376.
DR   EnsemblGenomes-Gn; EBG00000036377.
DR   EnsemblGenomes-Gn; EBG00000036378.
DR   EnsemblGenomes-Gn; EBG00000036379.
DR   EnsemblGenomes-Gn; EBG00000036380.
DR   EnsemblGenomes-Gn; EBG00000036381.
DR   EnsemblGenomes-Gn; EBG00000036382.
DR   EnsemblGenomes-Gn; EBG00000036383.
DR   EnsemblGenomes-Gn; EBG00000036384.
DR   EnsemblGenomes-Gn; EBG00000036385.
DR   EnsemblGenomes-Gn; EBG00000036386.
DR   EnsemblGenomes-Gn; EBG00000036387.
DR   EnsemblGenomes-Gn; EBG00000036388.
DR   EnsemblGenomes-Gn; EBG00000036389.
DR   EnsemblGenomes-Gn; EBG00000036390.
DR   EnsemblGenomes-Gn; EBG00000036391.
DR   EnsemblGenomes-Gn; EBG00000036392.
DR   EnsemblGenomes-Gn; EBG00000036393.
DR   EnsemblGenomes-Gn; EBG00000036394.
DR   EnsemblGenomes-Gn; EBG00000036395.
DR   EnsemblGenomes-Gn; EBG00000036396.
DR   EnsemblGenomes-Gn; EBG00000036397.
DR   EnsemblGenomes-Gn; EBG00000036398.
DR   EnsemblGenomes-Gn; EBG00000036399.
DR   EnsemblGenomes-Gn; EBG00000036400.
DR   EnsemblGenomes-Gn; EBG00000036401.
DR   EnsemblGenomes-Gn; EBG00000036402.
DR   EnsemblGenomes-Gn; EBG00000036403.
DR   EnsemblGenomes-Gn; EBG00000036404.
DR   EnsemblGenomes-Gn; EBG00000036405.
DR   EnsemblGenomes-Gn; EBG00000036406.
DR   EnsemblGenomes-Gn; EBG00000036407.
DR   EnsemblGenomes-Gn; EBG00000036408.
DR   EnsemblGenomes-Gn; EBG00000036409.
DR   EnsemblGenomes-Gn; EBG00000036410.
DR   EnsemblGenomes-Gn; EBG00000036411.
DR   EnsemblGenomes-Gn; EBG00000036412.
DR   EnsemblGenomes-Gn; EBG00000036413.
DR   EnsemblGenomes-Gn; EBG00000036414.
DR   EnsemblGenomes-Gn; EBG00000036415.
DR   EnsemblGenomes-Gn; EBG00000036416.
DR   EnsemblGenomes-Gn; EBG00000036417.
DR   EnsemblGenomes-Gn; EBG00000036418.
DR   EnsemblGenomes-Gn; EBG00000036419.
DR   EnsemblGenomes-Gn; EBG00000036420.
DR   EnsemblGenomes-Gn; EBG00000036421.
DR   EnsemblGenomes-Gn; EBG00000036422.
DR   EnsemblGenomes-Gn; EBG00000036423.
DR   EnsemblGenomes-Gn; EBG00000036424.
DR   EnsemblGenomes-Gn; EBG00000036425.
DR   EnsemblGenomes-Gn; EBG00000036426.
DR   EnsemblGenomes-Gn; EBG00000036427.
DR   EnsemblGenomes-Gn; EBG00000036428.
DR   EnsemblGenomes-Gn; EBG00000036429.
DR   EnsemblGenomes-Gn; EBG00000622860.
DR   EnsemblGenomes-Gn; EBG00001089758.
DR   EnsemblGenomes-Gn; EBG00001089759.
DR   EnsemblGenomes-Gn; EBG00001089760.
DR   EnsemblGenomes-Gn; EBG00001089761.
DR   EnsemblGenomes-Gn; EBG00001089762.
DR   EnsemblGenomes-Gn; EBG00001089763.
DR   EnsemblGenomes-Gn; EBG00001089764.
DR   EnsemblGenomes-Gn; EBG00001089765.
DR   EnsemblGenomes-Gn; EBG00001089766.
DR   EnsemblGenomes-Gn; EBG00001089767.
DR   EnsemblGenomes-Gn; EBG00001089768.
DR   EnsemblGenomes-Gn; EBG00001089769.
DR   EnsemblGenomes-Gn; EBG00001089770.
DR   EnsemblGenomes-Gn; EBG00001089771.
DR   EnsemblGenomes-Gn; EBG00001089772.
DR   EnsemblGenomes-Gn; EBG00001089773.
DR   EnsemblGenomes-Gn; EBG00001089774.
DR   EnsemblGenomes-Gn; EBG00001089775.
DR   EnsemblGenomes-Gn; EBG00001089776.
DR   EnsemblGenomes-Gn; EBG00001089777.
DR   EnsemblGenomes-Gn; EBG00001089778.
DR   EnsemblGenomes-Gn; EBG00001089779.
DR   EnsemblGenomes-Gn; EBG00001089780.
DR   EnsemblGenomes-Gn; EBG00001089781.
DR   EnsemblGenomes-Gn; EBG00001089782.
DR   EnsemblGenomes-Gn; EBG00001089783.
DR   EnsemblGenomes-Gn; EBG00001089784.
DR   EnsemblGenomes-Gn; EBG00001089785.
DR   EnsemblGenomes-Gn; EBG00001089786.
DR   EnsemblGenomes-Gn; EBG00001089787.
DR   EnsemblGenomes-Gn; EBG00001089788.
DR   EnsemblGenomes-Gn; EBG00001089789.
DR   EnsemblGenomes-Gn; EBG00001089790.
DR   EnsemblGenomes-Gn; EBG00001089791.
DR   EnsemblGenomes-Gn; EBG00001089792.
DR   EnsemblGenomes-Gn; EBG00001089793.
DR   EnsemblGenomes-Gn; EBG00001089794.
DR   EnsemblGenomes-Gn; EBG00001089795.
DR   EnsemblGenomes-Gn; EBG00001089796.
DR   EnsemblGenomes-Gn; EBG00001089797.
DR   EnsemblGenomes-Gn; EBG00001089798.
DR   EnsemblGenomes-Gn; EBG00001089799.
DR   EnsemblGenomes-Gn; EBG00001089800.
DR   EnsemblGenomes-Gn; EBG00001089801.
DR   EnsemblGenomes-Gn; EBG00001089802.
DR   EnsemblGenomes-Gn; EBG00001089803.
DR   EnsemblGenomes-Gn; EBG00001089804.
DR   EnsemblGenomes-Gn; EBG00001089805.
DR   EnsemblGenomes-Gn; EBG00001089806.
DR   EnsemblGenomes-Gn; EBG00001089807.
DR   EnsemblGenomes-Gn; EBG00001089808.
DR   EnsemblGenomes-Gn; EBG00001089809.
DR   EnsemblGenomes-Gn; EBG00001089810.
DR   EnsemblGenomes-Gn; EBG00001089811.
DR   EnsemblGenomes-Gn; EBG00001089812.
DR   EnsemblGenomes-Gn; EBG00001089813.
DR   EnsemblGenomes-Gn; EBG00001089814.
DR   EnsemblGenomes-Gn; EBG00001089815.
DR   EnsemblGenomes-Gn; EBG00001089816.
DR   EnsemblGenomes-Gn; EBG00001089817.
DR   EnsemblGenomes-Gn; EBG00001089818.
DR   EnsemblGenomes-Gn; EBG00001089819.
DR   EnsemblGenomes-Gn; EBG00001089820.
DR   EnsemblGenomes-Gn; EBG00001089821.
DR   EnsemblGenomes-Gn; EBG00001089822.
DR   EnsemblGenomes-Gn; EBG00001089823.
DR   EnsemblGenomes-Gn; EBG00001089824.
DR   EnsemblGenomes-Gn; EBG00001089825.
DR   EnsemblGenomes-Gn; EBG00001089826.
DR   EnsemblGenomes-Gn; EBG00001089827.
DR   EnsemblGenomes-Gn; EBG00001089828.
DR   EnsemblGenomes-Gn; EBG00001089829.
DR   EnsemblGenomes-Gn; EBG00001089830.
DR   EnsemblGenomes-Gn; EBG00001089831.
DR   EnsemblGenomes-Gn; EBG00001089832.
DR   EnsemblGenomes-Gn; EBG00001089833.
DR   EnsemblGenomes-Gn; EBG00001089834.
DR   EnsemblGenomes-Gn; EBG00001089835.
DR   EnsemblGenomes-Gn; EBG00001089836.
DR   EnsemblGenomes-Gn; EBG00001089837.
DR   EnsemblGenomes-Gn; EBG00001089838.
DR   EnsemblGenomes-Gn; EBG00001089839.
DR   EnsemblGenomes-Gn; EBG00001089840.
DR   EnsemblGenomes-Gn; EBG00001089841.
DR   EnsemblGenomes-Gn; EBG00001089842.
DR   EnsemblGenomes-Gn; EBG00001089843.
DR   EnsemblGenomes-Gn; EBG00001089844.
DR   EnsemblGenomes-Gn; EBG00001089845.
DR   EnsemblGenomes-Gn; EBG00001089846.
DR   EnsemblGenomes-Gn; EBG00001089847.
DR   EnsemblGenomes-Gn; EBG00001089848.
DR   EnsemblGenomes-Gn; EBG00001089849.
DR   EnsemblGenomes-Gn; EBG00001089850.
DR   EnsemblGenomes-Gn; EBG00001089851.
DR   EnsemblGenomes-Gn; EBG00001089852.
DR   EnsemblGenomes-Gn; EBG00001089853.
DR   EnsemblGenomes-Gn; EBG00001089854.
DR   EnsemblGenomes-Gn; EBG00001089855.
DR   EnsemblGenomes-Gn; EBG00001089856.
DR   EnsemblGenomes-Gn; EBG00001089857.
DR   EnsemblGenomes-Gn; EBG00001089858.
DR   EnsemblGenomes-Gn; EBG00001089859.
DR   EnsemblGenomes-Gn; EBG00001089860.
DR   EnsemblGenomes-Gn; EBG00001089861.
DR   EnsemblGenomes-Gn; EBG00001089862.
DR   EnsemblGenomes-Gn; EBG00001089863.
DR   EnsemblGenomes-Gn; EBG00001089864.
DR   EnsemblGenomes-Gn; EBG00001089865.
DR   EnsemblGenomes-Gn; EBG00001089866.
DR   EnsemblGenomes-Gn; EBG00001089867.
DR   EnsemblGenomes-Gn; EBG00001089868.
DR   EnsemblGenomes-Gn; EBG00001089869.
DR   EnsemblGenomes-Gn; EBG00001089870.
DR   EnsemblGenomes-Gn; EBG00001089871.
DR   EnsemblGenomes-Gn; EBG00001089872.
DR   EnsemblGenomes-Gn; EBG00001089873.
DR   EnsemblGenomes-Gn; EBG00001089874.
DR   EnsemblGenomes-Gn; EBG00001089875.
DR   EnsemblGenomes-Gn; EBG00001089876.
DR   EnsemblGenomes-Gn; EBG00001089877.
DR   EnsemblGenomes-Gn; EBG00001089878.
DR   EnsemblGenomes-Gn; EBG00001089879.
DR   EnsemblGenomes-Gn; EBG00001089880.
DR   EnsemblGenomes-Gn; EBG00001089881.
DR   EnsemblGenomes-Gn; EBG00001089882.
DR   EnsemblGenomes-Gn; EBG00001089883.
DR   EnsemblGenomes-Gn; EBG00001089884.
DR   EnsemblGenomes-Gn; EBG00001089885.
DR   EnsemblGenomes-Gn; EBG00001089886.
DR   EnsemblGenomes-Gn; EBG00001089887.
DR   EnsemblGenomes-Gn; EBG00001089888.
DR   EnsemblGenomes-Gn; EBG00001089889.
DR   EnsemblGenomes-Gn; EBG00001089890.
DR   EnsemblGenomes-Gn; EBG00001089891.
DR   EnsemblGenomes-Gn; EBG00001089892.
DR   EnsemblGenomes-Gn; EBG00001089893.
DR   EnsemblGenomes-Gn; EBG00001089894.
DR   EnsemblGenomes-Gn; EBG00001089895.
DR   EnsemblGenomes-Gn; EBG00001089896.
DR   EnsemblGenomes-Gn; EBG00001089897.
DR   EnsemblGenomes-Gn; EBG00001089898.
DR   EnsemblGenomes-Gn; EBG00001089899.
DR   EnsemblGenomes-Gn; EBG00001089900.
DR   EnsemblGenomes-Gn; EBG00001089901.
DR   EnsemblGenomes-Gn; EBG00001089902.
DR   EnsemblGenomes-Gn; EBG00001089903.
DR   EnsemblGenomes-Gn; EBG00001089904.
DR   EnsemblGenomes-Gn; EBG00001089905.
DR   EnsemblGenomes-Gn; EBG00001089906.
DR   EnsemblGenomes-Gn; EBG00001089907.
DR   EnsemblGenomes-Gn; EBG00001089908.
DR   EnsemblGenomes-Gn; EBG00001089909.
DR   EnsemblGenomes-Gn; EBG00001089910.
DR   EnsemblGenomes-Gn; EBG00001089911.
DR   EnsemblGenomes-Gn; EBG00001089912.
DR   EnsemblGenomes-Gn; EBG00001089913.
DR   EnsemblGenomes-Gn; EBG00001089914.
DR   EnsemblGenomes-Gn; EBG00001089915.
DR   EnsemblGenomes-Gn; EBG00001089916.
DR   EnsemblGenomes-Gn; EBG00001089917.
DR   EnsemblGenomes-Gn; EBG00001089918.
DR   EnsemblGenomes-Gn; EBG00001089919.
DR   EnsemblGenomes-Gn; EBG00001089920.
DR   EnsemblGenomes-Gn; EBG00001089921.
DR   EnsemblGenomes-Gn; EBG00001089922.
DR   EnsemblGenomes-Gn; EBG00001089923.
DR   EnsemblGenomes-Gn; EBG00001089924.
DR   EnsemblGenomes-Gn; EBG00001089925.
DR   EnsemblGenomes-Gn; EBG00001089926.
DR   EnsemblGenomes-Gn; EBG00001089927.
DR   EnsemblGenomes-Gn; EBG00001089928.
DR   EnsemblGenomes-Gn; EBG00001089929.
DR   EnsemblGenomes-Gn; EBG00001089930.
DR   EnsemblGenomes-Gn; EBG00001089931.
DR   EnsemblGenomes-Gn; EBG00001089932.
DR   EnsemblGenomes-Gn; EBG00001089933.
DR   EnsemblGenomes-Gn; EBG00001089934.
DR   EnsemblGenomes-Gn; EBG00001089935.
DR   EnsemblGenomes-Gn; EBG00001089936.
DR   EnsemblGenomes-Gn; EBG00001089937.
DR   EnsemblGenomes-Gn; EBG00001089938.
DR   EnsemblGenomes-Gn; EBG00001089939.
DR   EnsemblGenomes-Gn; EBG00001089940.
DR   EnsemblGenomes-Gn; EBG00001089941.
DR   EnsemblGenomes-Gn; EBG00001089942.
DR   EnsemblGenomes-Gn; EBG00001089943.
DR   EnsemblGenomes-Gn; EBG00001089944.
DR   EnsemblGenomes-Gn; EBG00001089945.
DR   EnsemblGenomes-Gn; EBG00001089946.
DR   EnsemblGenomes-Gn; EBG00001089947.
DR   EnsemblGenomes-Gn; EBG00001089948.
DR   EnsemblGenomes-Gn; EBG00001089949.
DR   EnsemblGenomes-Gn; EBG00001089950.
DR   EnsemblGenomes-Gn; EBG00001089951.
DR   EnsemblGenomes-Gn; EBG00001089952.
DR   EnsemblGenomes-Gn; EBG00001089953.
DR   EnsemblGenomes-Gn; EBG00001089954.
DR   EnsemblGenomes-Gn; EBG00001089955.
DR   EnsemblGenomes-Gn; EBG00001089956.
DR   EnsemblGenomes-Gn; EBG00001089957.
DR   EnsemblGenomes-Gn; EBG00001089958.
DR   EnsemblGenomes-Gn; EBG00001089959.
DR   EnsemblGenomes-Gn; EBG00001089960.
DR   EnsemblGenomes-Gn; EBG00001089961.
DR   EnsemblGenomes-Gn; EBG00001089962.
DR   EnsemblGenomes-Gn; EBG00001089963.
DR   EnsemblGenomes-Gn; EBG00001089964.
DR   EnsemblGenomes-Gn; EBG00001089965.
DR   EnsemblGenomes-Gn; EBG00001089966.
DR   EnsemblGenomes-Gn; EBG00001089967.
DR   EnsemblGenomes-Gn; EBG00001089968.
DR   EnsemblGenomes-Gn; EBG00001089969.
DR   EnsemblGenomes-Gn; EBG00001089970.
DR   EnsemblGenomes-Gn; EBG00001089971.
DR   EnsemblGenomes-Gn; EBG00001089972.
DR   EnsemblGenomes-Gn; EBG00001089973.
DR   EnsemblGenomes-Gn; EBG00001089974.
DR   EnsemblGenomes-Gn; EBG00001089975.
DR   EnsemblGenomes-Gn; EBG00001089976.
DR   EnsemblGenomes-Gn; EBG00001089977.
DR   EnsemblGenomes-Gn; EBG00001089978.
DR   EnsemblGenomes-Gn; EBG00001089979.
DR   EnsemblGenomes-Gn; EBG00001089980.
DR   EnsemblGenomes-Gn; EBG00001089981.
DR   EnsemblGenomes-Gn; EBG00001089982.
DR   EnsemblGenomes-Gn; EBG00001089983.
DR   EnsemblGenomes-Gn; EBG00001089984.
DR   EnsemblGenomes-Gn; EBG00001089985.
DR   EnsemblGenomes-Gn; EBG00001089986.
DR   EnsemblGenomes-Gn; EBG00001089987.
DR   EnsemblGenomes-Gn; EBG00001089988.
DR   EnsemblGenomes-Gn; EBG00001089989.
DR   EnsemblGenomes-Gn; EBG00001089990.
DR   EnsemblGenomes-Gn; EBG00001089991.
DR   EnsemblGenomes-Gn; EBG00001089992.
DR   EnsemblGenomes-Gn; EBG00001089993.
DR   EnsemblGenomes-Gn; EBG00001089994.
DR   EnsemblGenomes-Gn; EBG00001089995.
DR   EnsemblGenomes-Gn; EBG00001089996.
DR   EnsemblGenomes-Gn; EBG00001089997.
DR   EnsemblGenomes-Gn; EBG00001089998.
DR   EnsemblGenomes-Gn; EBG00001089999.
DR   EnsemblGenomes-Gn; EBG00001090000.
DR   EnsemblGenomes-Gn; EBG00001090001.
DR   EnsemblGenomes-Gn; EBG00001090002.
DR   EnsemblGenomes-Gn; EBG00001090003.
DR   EnsemblGenomes-Gn; EBG00001090004.
DR   EnsemblGenomes-Gn; EBG00001090005.
DR   EnsemblGenomes-Gn; EBG00001090006.
DR   EnsemblGenomes-Gn; EBG00001090007.
DR   EnsemblGenomes-Gn; EBG00001090008.
DR   EnsemblGenomes-Gn; EBG00001090009.
DR   EnsemblGenomes-Gn; EBG00001090010.
DR   EnsemblGenomes-Gn; EBG00001090011.
DR   EnsemblGenomes-Gn; EBG00001090012.
DR   EnsemblGenomes-Gn; EBG00001090013.
DR   EnsemblGenomes-Gn; EBG00001090014.
DR   EnsemblGenomes-Gn; EBG00001090015.
DR   EnsemblGenomes-Gn; EBG00001090016.
DR   EnsemblGenomes-Gn; EBG00001090017.
DR   EnsemblGenomes-Gn; EBG00001090018.
DR   EnsemblGenomes-Gn; EBG00001090019.
DR   EnsemblGenomes-Gn; EBG00001090020.
DR   EnsemblGenomes-Gn; EBG00001090021.
DR   EnsemblGenomes-Gn; EBG00001090022.
DR   EnsemblGenomes-Gn; EBG00001090023.
DR   EnsemblGenomes-Gn; EBG00001090024.
DR   EnsemblGenomes-Tr; EBG00000036302-1.
DR   EnsemblGenomes-Tr; EBG00000036303-1.
DR   EnsemblGenomes-Tr; EBG00000036304-1.
DR   EnsemblGenomes-Tr; EBG00000036305-1.
DR   EnsemblGenomes-Tr; EBG00000036306-1.
DR   EnsemblGenomes-Tr; EBG00000036307-1.
DR   EnsemblGenomes-Tr; EBG00000036308-1.
DR   EnsemblGenomes-Tr; EBG00000036309-1.
DR   EnsemblGenomes-Tr; EBG00000036310-1.
DR   EnsemblGenomes-Tr; EBG00000036311-1.
DR   EnsemblGenomes-Tr; EBG00000036312-1.
DR   EnsemblGenomes-Tr; EBG00000036313-1.
DR   EnsemblGenomes-Tr; EBG00000036314-1.
DR   EnsemblGenomes-Tr; EBG00000036315-1.
DR   EnsemblGenomes-Tr; EBG00000036316-1.
DR   EnsemblGenomes-Tr; EBG00000036317-1.
DR   EnsemblGenomes-Tr; EBG00000036318-1.
DR   EnsemblGenomes-Tr; EBG00000036319-1.
DR   EnsemblGenomes-Tr; EBG00000036320-1.
DR   EnsemblGenomes-Tr; EBG00000036321-1.
DR   EnsemblGenomes-Tr; EBG00000036322-1.
DR   EnsemblGenomes-Tr; EBG00000036323-1.
DR   EnsemblGenomes-Tr; EBG00000036324-1.
DR   EnsemblGenomes-Tr; EBG00000036325-1.
DR   EnsemblGenomes-Tr; EBG00000036326-1.
DR   EnsemblGenomes-Tr; EBG00000036327-1.
DR   EnsemblGenomes-Tr; EBG00000036328-1.
DR   EnsemblGenomes-Tr; EBG00000036329-1.
DR   EnsemblGenomes-Tr; EBG00000036330-1.
DR   EnsemblGenomes-Tr; EBG00000036331-1.
DR   EnsemblGenomes-Tr; EBG00000036332-1.
DR   EnsemblGenomes-Tr; EBG00000036333-1.
DR   EnsemblGenomes-Tr; EBG00000036334-1.
DR   EnsemblGenomes-Tr; EBG00000036335-1.
DR   EnsemblGenomes-Tr; EBG00000036336-1.
DR   EnsemblGenomes-Tr; EBG00000036337-1.
DR   EnsemblGenomes-Tr; EBG00000036338-1.
DR   EnsemblGenomes-Tr; EBG00000036339-1.
DR   EnsemblGenomes-Tr; EBG00000036340-1.
DR   EnsemblGenomes-Tr; EBG00000036341-1.
DR   EnsemblGenomes-Tr; EBG00000036342-1.
DR   EnsemblGenomes-Tr; EBG00000036343-1.
DR   EnsemblGenomes-Tr; EBG00000036344-1.
DR   EnsemblGenomes-Tr; EBG00000036345-1.
DR   EnsemblGenomes-Tr; EBG00000036346-1.
DR   EnsemblGenomes-Tr; EBG00000036347-1.
DR   EnsemblGenomes-Tr; EBG00000036348-1.
DR   EnsemblGenomes-Tr; EBG00000036349-1.
DR   EnsemblGenomes-Tr; EBG00000036350-1.
DR   EnsemblGenomes-Tr; EBG00000036351-1.
DR   EnsemblGenomes-Tr; EBG00000036352-1.
DR   EnsemblGenomes-Tr; EBG00000036353-1.
DR   EnsemblGenomes-Tr; EBG00000036354-1.
DR   EnsemblGenomes-Tr; EBG00000036355-1.
DR   EnsemblGenomes-Tr; EBG00000036356-1.
DR   EnsemblGenomes-Tr; EBG00000036357-1.
DR   EnsemblGenomes-Tr; EBG00000036358-1.
DR   EnsemblGenomes-Tr; EBG00000036359-1.
DR   EnsemblGenomes-Tr; EBG00000036360-1.
DR   EnsemblGenomes-Tr; EBG00000036361-1.
DR   EnsemblGenomes-Tr; EBG00000036362-1.
DR   EnsemblGenomes-Tr; EBG00000036363-1.
DR   EnsemblGenomes-Tr; EBG00000036364-1.
DR   EnsemblGenomes-Tr; EBG00000036365-1.
DR   EnsemblGenomes-Tr; EBG00000036366-1.
DR   EnsemblGenomes-Tr; EBG00000036367-1.
DR   EnsemblGenomes-Tr; EBG00000036368-1.
DR   EnsemblGenomes-Tr; EBG00000036369-1.
DR   EnsemblGenomes-Tr; EBG00000036370-1.
DR   EnsemblGenomes-Tr; EBG00000036371-1.
DR   EnsemblGenomes-Tr; EBG00000036372-1.
DR   EnsemblGenomes-Tr; EBG00000036373-1.
DR   EnsemblGenomes-Tr; EBG00000036374-1.
DR   EnsemblGenomes-Tr; EBG00000036375-1.
DR   EnsemblGenomes-Tr; EBG00000036376-1.
DR   EnsemblGenomes-Tr; EBG00000036377-1.
DR   EnsemblGenomes-Tr; EBG00000036378-1.
DR   EnsemblGenomes-Tr; EBG00000036379-1.
DR   EnsemblGenomes-Tr; EBG00000036380-1.
DR   EnsemblGenomes-Tr; EBG00000036381-1.
DR   EnsemblGenomes-Tr; EBG00000036382-1.
DR   EnsemblGenomes-Tr; EBG00000036383-1.
DR   EnsemblGenomes-Tr; EBG00000036384-1.
DR   EnsemblGenomes-Tr; EBG00000036385-1.
DR   EnsemblGenomes-Tr; EBG00000036386-1.
DR   EnsemblGenomes-Tr; EBG00000036387-1.
DR   EnsemblGenomes-Tr; EBG00000036388-1.
DR   EnsemblGenomes-Tr; EBG00000036389-1.
DR   EnsemblGenomes-Tr; EBG00000036390-1.
DR   EnsemblGenomes-Tr; EBG00000036391-1.
DR   EnsemblGenomes-Tr; EBG00000036392-1.
DR   EnsemblGenomes-Tr; EBG00000036393-1.
DR   EnsemblGenomes-Tr; EBG00000036394-1.
DR   EnsemblGenomes-Tr; EBG00000036395-1.
DR   EnsemblGenomes-Tr; EBG00000036396-1.
DR   EnsemblGenomes-Tr; EBG00000036397-1.
DR   EnsemblGenomes-Tr; EBG00000036398-1.
DR   EnsemblGenomes-Tr; EBG00000036399-1.
DR   EnsemblGenomes-Tr; EBG00000036400-1.
DR   EnsemblGenomes-Tr; EBG00000036401-1.
DR   EnsemblGenomes-Tr; EBG00000036402-1.
DR   EnsemblGenomes-Tr; EBG00000036403-1.
DR   EnsemblGenomes-Tr; EBG00000036404-1.
DR   EnsemblGenomes-Tr; EBG00000036405-1.
DR   EnsemblGenomes-Tr; EBG00000036406-1.
DR   EnsemblGenomes-Tr; EBG00000036407-1.
DR   EnsemblGenomes-Tr; EBG00000036408-1.
DR   EnsemblGenomes-Tr; EBG00000036409-1.
DR   EnsemblGenomes-Tr; EBG00000036410-1.
DR   EnsemblGenomes-Tr; EBG00000036411-1.
DR   EnsemblGenomes-Tr; EBG00000036412-1.
DR   EnsemblGenomes-Tr; EBG00000036413-1.
DR   EnsemblGenomes-Tr; EBG00000036414-1.
DR   EnsemblGenomes-Tr; EBG00000036415-1.
DR   EnsemblGenomes-Tr; EBG00000036416-1.
DR   EnsemblGenomes-Tr; EBG00000036417-1.
DR   EnsemblGenomes-Tr; EBG00000036418-1.
DR   EnsemblGenomes-Tr; EBG00000036419-1.
DR   EnsemblGenomes-Tr; EBG00000036420-1.
DR   EnsemblGenomes-Tr; EBG00000036421-1.
DR   EnsemblGenomes-Tr; EBG00000036422-1.
DR   EnsemblGenomes-Tr; EBG00000036423-1.
DR   EnsemblGenomes-Tr; EBG00000036424-1.
DR   EnsemblGenomes-Tr; EBG00000036425-1.
DR   EnsemblGenomes-Tr; EBG00000036426-1.
DR   EnsemblGenomes-Tr; EBG00000036427-1.
DR   EnsemblGenomes-Tr; EBG00000036428-1.
DR   EnsemblGenomes-Tr; EBG00000036429-1.
DR   EnsemblGenomes-Tr; EBG00000622860-1.
DR   EnsemblGenomes-Tr; EBT00001692001.
DR   EnsemblGenomes-Tr; EBT00001692002.
DR   EnsemblGenomes-Tr; EBT00001692003.
DR   EnsemblGenomes-Tr; EBT00001692004.
DR   EnsemblGenomes-Tr; EBT00001692005.
DR   EnsemblGenomes-Tr; EBT00001692006.
DR   EnsemblGenomes-Tr; EBT00001692007.
DR   EnsemblGenomes-Tr; EBT00001692008.
DR   EnsemblGenomes-Tr; EBT00001692009.
DR   EnsemblGenomes-Tr; EBT00001692010.
DR   EnsemblGenomes-Tr; EBT00001692011.
DR   EnsemblGenomes-Tr; EBT00001692012.
DR   EnsemblGenomes-Tr; EBT00001692013.
DR   EnsemblGenomes-Tr; EBT00001692014.
DR   EnsemblGenomes-Tr; EBT00001692015.
DR   EnsemblGenomes-Tr; EBT00001692016.
DR   EnsemblGenomes-Tr; EBT00001692017.
DR   EnsemblGenomes-Tr; EBT00001692018.
DR   EnsemblGenomes-Tr; EBT00001692019.
DR   EnsemblGenomes-Tr; EBT00001692020.
DR   EnsemblGenomes-Tr; EBT00001692021.
DR   EnsemblGenomes-Tr; EBT00001692022.
DR   EnsemblGenomes-Tr; EBT00001692023.
DR   EnsemblGenomes-Tr; EBT00001692024.
DR   EnsemblGenomes-Tr; EBT00001692025.
DR   EnsemblGenomes-Tr; EBT00001692026.
DR   EnsemblGenomes-Tr; EBT00001692027.
DR   EnsemblGenomes-Tr; EBT00001692028.
DR   EnsemblGenomes-Tr; EBT00001692029.
DR   EnsemblGenomes-Tr; EBT00001692030.
DR   EnsemblGenomes-Tr; EBT00001692031.
DR   EnsemblGenomes-Tr; EBT00001692032.
DR   EnsemblGenomes-Tr; EBT00001692033.
DR   EnsemblGenomes-Tr; EBT00001692034.
DR   EnsemblGenomes-Tr; EBT00001692035.
DR   EnsemblGenomes-Tr; EBT00001692036.
DR   EnsemblGenomes-Tr; EBT00001692037.
DR   EnsemblGenomes-Tr; EBT00001692038.
DR   EnsemblGenomes-Tr; EBT00001692039.
DR   EnsemblGenomes-Tr; EBT00001692040.
DR   EnsemblGenomes-Tr; EBT00001692041.
DR   EnsemblGenomes-Tr; EBT00001692042.
DR   EnsemblGenomes-Tr; EBT00001692043.
DR   EnsemblGenomes-Tr; EBT00001692044.
DR   EnsemblGenomes-Tr; EBT00001692045.
DR   EnsemblGenomes-Tr; EBT00001692046.
DR   EnsemblGenomes-Tr; EBT00001692047.
DR   EnsemblGenomes-Tr; EBT00001692048.
DR   EnsemblGenomes-Tr; EBT00001692049.
DR   EnsemblGenomes-Tr; EBT00001692050.
DR   EnsemblGenomes-Tr; EBT00001692051.
DR   EnsemblGenomes-Tr; EBT00001692052.
DR   EnsemblGenomes-Tr; EBT00001692053.
DR   EnsemblGenomes-Tr; EBT00001692054.
DR   EnsemblGenomes-Tr; EBT00001692055.
DR   EnsemblGenomes-Tr; EBT00001692056.
DR   EnsemblGenomes-Tr; EBT00001692057.
DR   EnsemblGenomes-Tr; EBT00001692058.
DR   EnsemblGenomes-Tr; EBT00001692059.
DR   EnsemblGenomes-Tr; EBT00001692060.
DR   EnsemblGenomes-Tr; EBT00001692061.
DR   EnsemblGenomes-Tr; EBT00001692062.
DR   EnsemblGenomes-Tr; EBT00001692063.
DR   EnsemblGenomes-Tr; EBT00001692064.
DR   EnsemblGenomes-Tr; EBT00001692065.
DR   EnsemblGenomes-Tr; EBT00001692066.
DR   EnsemblGenomes-Tr; EBT00001692067.
DR   EnsemblGenomes-Tr; EBT00001692068.
DR   EnsemblGenomes-Tr; EBT00001692069.
DR   EnsemblGenomes-Tr; EBT00001692070.
DR   EnsemblGenomes-Tr; EBT00001692071.
DR   EnsemblGenomes-Tr; EBT00001692072.
DR   EnsemblGenomes-Tr; EBT00001692073.
DR   EnsemblGenomes-Tr; EBT00001692074.
DR   EnsemblGenomes-Tr; EBT00001692075.
DR   EnsemblGenomes-Tr; EBT00001692076.
DR   EnsemblGenomes-Tr; EBT00001692077.
DR   EnsemblGenomes-Tr; EBT00001692078.
DR   EnsemblGenomes-Tr; EBT00001692079.
DR   EnsemblGenomes-Tr; EBT00001692080.
DR   EnsemblGenomes-Tr; EBT00001692081.
DR   EnsemblGenomes-Tr; EBT00001692082.
DR   EnsemblGenomes-Tr; EBT00001692083.
DR   EnsemblGenomes-Tr; EBT00001692084.
DR   EnsemblGenomes-Tr; EBT00001692085.
DR   EnsemblGenomes-Tr; EBT00001692086.
DR   EnsemblGenomes-Tr; EBT00001692087.
DR   EnsemblGenomes-Tr; EBT00001692088.
DR   EnsemblGenomes-Tr; EBT00001692089.
DR   EnsemblGenomes-Tr; EBT00001692090.
DR   EnsemblGenomes-Tr; EBT00001692091.
DR   EnsemblGenomes-Tr; EBT00001692092.
DR   EnsemblGenomes-Tr; EBT00001692093.
DR   EnsemblGenomes-Tr; EBT00001692094.
DR   EnsemblGenomes-Tr; EBT00001692095.
DR   EnsemblGenomes-Tr; EBT00001692096.
DR   EnsemblGenomes-Tr; EBT00001692097.
DR   EnsemblGenomes-Tr; EBT00001692098.
DR   EnsemblGenomes-Tr; EBT00001692099.
DR   EnsemblGenomes-Tr; EBT00001692100.
DR   EnsemblGenomes-Tr; EBT00001692101.
DR   EnsemblGenomes-Tr; EBT00001692102.
DR   EnsemblGenomes-Tr; EBT00001692103.
DR   EnsemblGenomes-Tr; EBT00001692104.
DR   EnsemblGenomes-Tr; EBT00001692105.
DR   EnsemblGenomes-Tr; EBT00001692106.
DR   EnsemblGenomes-Tr; EBT00001692107.
DR   EnsemblGenomes-Tr; EBT00001692108.
DR   EnsemblGenomes-Tr; EBT00001692109.
DR   EnsemblGenomes-Tr; EBT00001692110.
DR   EnsemblGenomes-Tr; EBT00001692111.
DR   EnsemblGenomes-Tr; EBT00001692112.
DR   EnsemblGenomes-Tr; EBT00001692113.
DR   EnsemblGenomes-Tr; EBT00001692114.
DR   EnsemblGenomes-Tr; EBT00001692115.
DR   EnsemblGenomes-Tr; EBT00001692116.
DR   EnsemblGenomes-Tr; EBT00001692117.
DR   EnsemblGenomes-Tr; EBT00001692118.
DR   EnsemblGenomes-Tr; EBT00001692119.
DR   EnsemblGenomes-Tr; EBT00001692120.
DR   EnsemblGenomes-Tr; EBT00001692121.
DR   EnsemblGenomes-Tr; EBT00001692122.
DR   EnsemblGenomes-Tr; EBT00001692123.
DR   EnsemblGenomes-Tr; EBT00001692124.
DR   EnsemblGenomes-Tr; EBT00001692125.
DR   EnsemblGenomes-Tr; EBT00001692126.
DR   EnsemblGenomes-Tr; EBT00001692127.
DR   EnsemblGenomes-Tr; EBT00001692128.
DR   EnsemblGenomes-Tr; EBT00001692129.
DR   EnsemblGenomes-Tr; EBT00001692130.
DR   EnsemblGenomes-Tr; EBT00001692131.
DR   EnsemblGenomes-Tr; EBT00001692132.
DR   EnsemblGenomes-Tr; EBT00001692133.
DR   EnsemblGenomes-Tr; EBT00001692134.
DR   EnsemblGenomes-Tr; EBT00001692135.
DR   EnsemblGenomes-Tr; EBT00001692136.
DR   EnsemblGenomes-Tr; EBT00001692137.
DR   EnsemblGenomes-Tr; EBT00001692138.
DR   EnsemblGenomes-Tr; EBT00001692139.
DR   EnsemblGenomes-Tr; EBT00001692140.
DR   EnsemblGenomes-Tr; EBT00001692141.
DR   EnsemblGenomes-Tr; EBT00001692142.
DR   EnsemblGenomes-Tr; EBT00001692143.
DR   EnsemblGenomes-Tr; EBT00001692144.
DR   EnsemblGenomes-Tr; EBT00001692145.
DR   EnsemblGenomes-Tr; EBT00001692146.
DR   EnsemblGenomes-Tr; EBT00001692147.
DR   EnsemblGenomes-Tr; EBT00001692148.
DR   EnsemblGenomes-Tr; EBT00001692149.
DR   EnsemblGenomes-Tr; EBT00001692150.
DR   EnsemblGenomes-Tr; EBT00001692151.
DR   EnsemblGenomes-Tr; EBT00001692152.
DR   EnsemblGenomes-Tr; EBT00001692153.
DR   EnsemblGenomes-Tr; EBT00001692154.
DR   EnsemblGenomes-Tr; EBT00001692155.
DR   EnsemblGenomes-Tr; EBT00001692156.
DR   EnsemblGenomes-Tr; EBT00001692157.
DR   EnsemblGenomes-Tr; EBT00001692158.
DR   EnsemblGenomes-Tr; EBT00001692159.
DR   EnsemblGenomes-Tr; EBT00001692160.
DR   EnsemblGenomes-Tr; EBT00001692161.
DR   EnsemblGenomes-Tr; EBT00001692162.
DR   EnsemblGenomes-Tr; EBT00001692163.
DR   EnsemblGenomes-Tr; EBT00001692164.
DR   EnsemblGenomes-Tr; EBT00001692165.
DR   EnsemblGenomes-Tr; EBT00001692166.
DR   EnsemblGenomes-Tr; EBT00001692167.
DR   EnsemblGenomes-Tr; EBT00001692168.
DR   EnsemblGenomes-Tr; EBT00001692169.
DR   EnsemblGenomes-Tr; EBT00001692170.
DR   EnsemblGenomes-Tr; EBT00001692171.
DR   EnsemblGenomes-Tr; EBT00001692172.
DR   EnsemblGenomes-Tr; EBT00001692173.
DR   EnsemblGenomes-Tr; EBT00001692174.
DR   EnsemblGenomes-Tr; EBT00001692175.
DR   EnsemblGenomes-Tr; EBT00001692176.
DR   EnsemblGenomes-Tr; EBT00001692177.
DR   EnsemblGenomes-Tr; EBT00001692178.
DR   EnsemblGenomes-Tr; EBT00001692179.
DR   EnsemblGenomes-Tr; EBT00001692180.
DR   EnsemblGenomes-Tr; EBT00001692181.
DR   EnsemblGenomes-Tr; EBT00001692182.
DR   EnsemblGenomes-Tr; EBT00001692183.
DR   EnsemblGenomes-Tr; EBT00001692184.
DR   EnsemblGenomes-Tr; EBT00001692185.
DR   EnsemblGenomes-Tr; EBT00001692186.
DR   EnsemblGenomes-Tr; EBT00001692187.
DR   EnsemblGenomes-Tr; EBT00001692188.
DR   EnsemblGenomes-Tr; EBT00001692189.
DR   EnsemblGenomes-Tr; EBT00001692190.
DR   EnsemblGenomes-Tr; EBT00001692191.
DR   EnsemblGenomes-Tr; EBT00001692192.
DR   EnsemblGenomes-Tr; EBT00001692193.
DR   EnsemblGenomes-Tr; EBT00001692194.
DR   EnsemblGenomes-Tr; EBT00001692195.
DR   EnsemblGenomes-Tr; EBT00001692196.
DR   EnsemblGenomes-Tr; EBT00001692197.
DR   EnsemblGenomes-Tr; EBT00001692198.
DR   EnsemblGenomes-Tr; EBT00001692199.
DR   EnsemblGenomes-Tr; EBT00001692200.
DR   EnsemblGenomes-Tr; EBT00001692201.
DR   EnsemblGenomes-Tr; EBT00001692202.
DR   EnsemblGenomes-Tr; EBT00001692203.
DR   EnsemblGenomes-Tr; EBT00001692204.
DR   EnsemblGenomes-Tr; EBT00001692205.
DR   EnsemblGenomes-Tr; EBT00001692206.
DR   EnsemblGenomes-Tr; EBT00001692207.
DR   EnsemblGenomes-Tr; EBT00001692208.
DR   EnsemblGenomes-Tr; EBT00001692209.
DR   EnsemblGenomes-Tr; EBT00001692210.
DR   EnsemblGenomes-Tr; EBT00001692211.
DR   EnsemblGenomes-Tr; EBT00001692212.
DR   EnsemblGenomes-Tr; EBT00001692213.
DR   EnsemblGenomes-Tr; EBT00001692214.
DR   EnsemblGenomes-Tr; EBT00001692215.
DR   EnsemblGenomes-Tr; EBT00001692216.
DR   EnsemblGenomes-Tr; EBT00001692217.
DR   EnsemblGenomes-Tr; EBT00001692218.
DR   EnsemblGenomes-Tr; EBT00001692219.
DR   EnsemblGenomes-Tr; EBT00001692220.
DR   EnsemblGenomes-Tr; EBT00001692221.
DR   EnsemblGenomes-Tr; EBT00001692222.
DR   EnsemblGenomes-Tr; EBT00001692223.
DR   EnsemblGenomes-Tr; EBT00001692224.
DR   EnsemblGenomes-Tr; EBT00001692225.
DR   EnsemblGenomes-Tr; EBT00001692226.
DR   EnsemblGenomes-Tr; EBT00001692227.
DR   EnsemblGenomes-Tr; EBT00001692228.
DR   EnsemblGenomes-Tr; EBT00001692229.
DR   EnsemblGenomes-Tr; EBT00001692230.
DR   EnsemblGenomes-Tr; EBT00001692231.
DR   EnsemblGenomes-Tr; EBT00001692232.
DR   EnsemblGenomes-Tr; EBT00001692233.
DR   EnsemblGenomes-Tr; EBT00001692234.
DR   EnsemblGenomes-Tr; EBT00001692235.
DR   EnsemblGenomes-Tr; EBT00001692236.
DR   EnsemblGenomes-Tr; EBT00001692237.
DR   EnsemblGenomes-Tr; EBT00001692238.
DR   EnsemblGenomes-Tr; EBT00001692239.
DR   EnsemblGenomes-Tr; EBT00001692240.
DR   EnsemblGenomes-Tr; EBT00001692241.
DR   EnsemblGenomes-Tr; EBT00001692242.
DR   EnsemblGenomes-Tr; EBT00001692243.
DR   EnsemblGenomes-Tr; EBT00001692244.
DR   EnsemblGenomes-Tr; EBT00001692245.
DR   EnsemblGenomes-Tr; EBT00001692246.
DR   EnsemblGenomes-Tr; EBT00001692247.
DR   EnsemblGenomes-Tr; EBT00001692248.
DR   EnsemblGenomes-Tr; EBT00001692249.
DR   EnsemblGenomes-Tr; EBT00001692250.
DR   EnsemblGenomes-Tr; EBT00001692251.
DR   EnsemblGenomes-Tr; EBT00001692252.
DR   EnsemblGenomes-Tr; EBT00001692253.
DR   EnsemblGenomes-Tr; EBT00001692254.
DR   EnsemblGenomes-Tr; EBT00001692255.
DR   EnsemblGenomes-Tr; EBT00001692256.
DR   EnsemblGenomes-Tr; EBT00001692257.
DR   EnsemblGenomes-Tr; EBT00001692258.
DR   EnsemblGenomes-Tr; EBT00001692259.
DR   EnsemblGenomes-Tr; EBT00001692260.
DR   EnsemblGenomes-Tr; EBT00001692261.
DR   EnsemblGenomes-Tr; EBT00001692262.
DR   EnsemblGenomes-Tr; EBT00001692263.
DR   EnsemblGenomes-Tr; EBT00001692264.
DR   EnsemblGenomes-Tr; EBT00001692265.
DR   EnsemblGenomes-Tr; EBT00001692266.
DR   EnsemblGenomes-Tr; EBT00001692267.
DR   EuropePMC; PMC1084347; 15757514.
DR   EuropePMC; PMC1183210; 15955239.
DR   EuropePMC; PMC1405898; 16467478.
DR   EuropePMC; PMC1418941; 16552063.
DR   EuropePMC; PMC1482720; 16677374.
DR   EuropePMC; PMC149678; 12574266.
DR   EuropePMC; PMC1635569; 17054788.
DR   EuropePMC; PMC1698409; 17050815.
DR   EuropePMC; PMC1779527; 16737554.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC1797103; 17056689.
DR   EuropePMC; PMC1855899; 17351047.
DR   EuropePMC; PMC1890555; 17506902.
DR   EuropePMC; PMC1976330; 17941709.
DR   EuropePMC; PMC2063500; 17718910.
DR   EuropePMC; PMC2223761; 17873042.
DR   EuropePMC; PMC2228313; 17915007.
DR   EuropePMC; PMC2241610; 18070365.
DR   EuropePMC; PMC2446816; 18441064.
DR   EuropePMC; PMC2446876; 18400915.
DR   EuropePMC; PMC2566221; 18676672.
DR   EuropePMC; PMC2612248; 18981247.
DR   EuropePMC; PMC2669165; 19412337.
DR   EuropePMC; PMC2747862; 19633111.
DR   EuropePMC; PMC275418; 14592990.
DR   EuropePMC; PMC2782684; 19019141.
DR   EuropePMC; PMC2805327; 19897651.
DR   EuropePMC; PMC2808357; 20098708.
DR   EuropePMC; PMC2812512; 20126629.
DR   EuropePMC; PMC2884548; 20433696.
DR   EuropePMC; PMC2884935; 17446284.
DR   EuropePMC; PMC2974192; 20623278.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3068680; 20378655.
DR   EuropePMC; PMC308975; 14662916.
DR   EuropePMC; PMC3158064; 21876740.
DR   EuropePMC; PMC3163573; 21824423.
DR   EuropePMC; PMC3205445; 21864671.
DR   EuropePMC; PMC3209187; 21908635.
DR   EuropePMC; PMC3220660; 21942987.
DR   EuropePMC; PMC3273018; 22179243.
DR   EuropePMC; PMC3416539; 22636772.
DR   EuropePMC; PMC3421808; 22718945.
DR   EuropePMC; PMC3457417; 22837330.
DR   EuropePMC; PMC3502965; 23052305.
DR   EuropePMC; PMC3592242; 23315730.
DR   EuropePMC; PMC3641635; 23493634.
DR   EuropePMC; PMC3681947; 23785398.
DR   EuropePMC; PMC3993690; 24574290.
DR   EuropePMC; PMC4001111; 24742173.
DR   EuropePMC; PMC4010983; 24659774.
DR   EuropePMC; PMC4076223; 24979038.
DR   EuropePMC; PMC4172979; 25276419.
DR   EuropePMC; PMC4209514; 25349632.
DR   EuropePMC; PMC4279260; 25579622.
DR   EuropePMC; PMC4281788; 25734131.
DR   EuropePMC; PMC4399054; 25667270.
DR   EuropePMC; PMC4495197; 26002893.
DR   EuropePMC; PMC4524134; 25841005.
DR   EuropePMC; PMC4587872; 26416807.
DR   EuropePMC; PMC4609730; 26292302.
DR   EuropePMC; PMC4651076; 26386062.
DR   EuropePMC; PMC4807491; 26831468.
DR   EuropePMC; PMC4916391; 27329757.
DR   EuropePMC; PMC4959244; 27037122.
DR   EuropePMC; PMC5145215; 27930729.
DR   EuropePMC; PMC5220591; 28154459.
DR   EuropePMC; PMC5320567; 28348814.
DR   EuropePMC; PMC5320650; 28348875.
DR   EuropePMC; PMC5332415; 28303131.
DR   EuropePMC; PMC5382810; 28663823.
DR   EuropePMC; PMC546176; 15640440.
DR   EuropePMC; PMC5597208; 28902868.
DR   EuropePMC; PMC5680696; 29102123.
DR   EuropePMC; PMC5708253; 29148397.
DR   EuropePMC; PMC5729918; 29208163.
DR   EuropePMC; PMC5794082; 29389941.
DR   EuropePMC; PMC5817949; 29432584.
DR   EuropePMC; PMC5824047; 29263202.
DR   EuropePMC; PMC5885012; 29488865.
DR   EuropePMC; PMC6033998; 30008706.
DR   EuropePMC; PMC6256402; 30457532.
DR   EuropePMC; PMC6267907; 30497396.
DR   EuropePMC; PMC6297237; 30581915.
DR   EuropePMC; PMC6352002; 30696532.
DR   EuropePMC; PMC6408774; 30849935.
DR   EuropePMC; PMC6620841; 31346516.
DR   EuropePMC; PMC99098; 11752244.
DR   GOA; P0A3F6.
DR   GOA; P0ADB6.
DR   GOA; P0ADB9.
DR   GOA; P0ADN8.
DR   GOA; P0C1Y6.
DR   GOA; P0CJ67.
DR   GOA; P61468.
DR   GOA; P64648.
DR   GOA; Q8X3T0.
DR   GOA; Q8X479.
DR   GOA; Q8X485.
DR   GOA; Q8X490.
DR   GOA; Q8X4B4.
DR   GOA; Q8X4J1.
DR   GOA; Q8X4J8.
DR   InterPro; IPR002696; Membr_insert_effic_factor.
DR   InterPro; IPR004673; L-rhamnose-proton_sym_RhaT.
DR   InterPro; IPR009624; UPF0253.
DR   InterPro; IPR010089; Flavoprotein_WrbA-like.
DR   InterPro; IPR012556; Entericidin.
DR   InterPro; IPR019689; Toxin_GhoT/OrtT.
DR   InterPro; IPR020870; UPF0387_membrane.
DR   InterPro; IPR020910; UPF0370.
DR   InterPro; IPR024530; QSregVF_b.
DR   InterPro; IPR031434; MGTL.
DR   InterPro; IPR032831; LPAM_2.
DR   InterPro; IPR037513; NQO.
DR   InterPro; IPR038570; HicA_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00116; C0465.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00119; C0299.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00122; GadY.
DR   RFAM; RF00124; IS102.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00262; sar.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00372; sroH.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01804; Lambda_thermo.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02083; OrzO-P.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02111; IS009.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; BA000007.
DR   SILVA-SSU; BA000007.
DR   StrainInfo; 278620; 0.
DR   UniProtKB/Swiss-Prot; P0A3F6; DSDX_ECO57.
DR   UniProtKB/Swiss-Prot; P0A8K6; YAEP_ECO57.
DR   UniProtKB/Swiss-Prot; P0AD41; YPEB_ECO57.
DR   UniProtKB/Swiss-Prot; P0ADB6; ECNA_ECO57.
DR   UniProtKB/Swiss-Prot; P0ADB9; ECNB_ECO57.
DR   UniProtKB/Swiss-Prot; P0ADN8; YIFL_ECO57.
DR   UniProtKB/Swiss-Prot; P0ADX0; YHEV_ECO57.
DR   UniProtKB/Swiss-Prot; P0C1Y6; YOHO_ECO57.
DR   UniProtKB/Swiss-Prot; P0C265; YIBT_ECO57.
DR   UniProtKB/Swiss-Prot; P0CJ67; HICA_ECO57.
DR   UniProtKB/Swiss-Prot; P61468; YIDD_ECO57.
DR   UniProtKB/Swiss-Prot; P64648; GHOT_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X3J8; YJDP_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X3T0; RHAT_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X3T5; YCIZ_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X479; YTJA_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X485; SYME_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X490; YPFN_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X4B4; NQOR_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X4C9; YICS_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X4G0; LPMG_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X4G6; YOBH_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X4J1; YSAB_ECO57.
DR   UniProtKB/Swiss-Prot; Q8X4J8; ARNE_ECO57.
XX
CC   On May 10, 2018 this sequence version replased gi: 47118301
CC   This update is obtained as follows: the Sakai genome was
CC   resequenced by illumina MiSeq and PacBio RS II sequencers and 78
CC   sites of single base error, 11 sites of insertion (10 one-base
CC   insertions and a 141-base insertion) and 16 sites of deletion (14
CC   one-base deletions, a three-base deletion and a six-base deletion)
CC   were corrected. Annotation was performed using DFAST
CC   auto-annotation system with manual curation.
CC   This work was done in collaboration with Tetsuya Hayashi, Makoto
CC   Ohnishi, Keisuke Nakayama (Miyazaki Medical College), Kozo Makino,
CC   Ken Kurokawa, Katsushi Yokoyama, Masashi Tanaka, Takeshi Honda,
CC   Teruo Yasunaga, Hideo Shinagawa (Osaka University), Takahiro
CC   Murata (Shinshu University), Chang-Gyun Han, Eiichi Ohtsubo, Toru
CC   Tobe, Chihiro Sasakawa (University of Tokyo), Hideto Takami (Japan
CC   Marine Science and Technology Center), Naotake Ogasawara (Nara
CC   Institute of Science and Technology), Satoru Kuhara (Kuyshu
CC   University), and supported by the Research for the Future Program
CC   of the Japan Society for the Promotion of Science.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5498578
FT                   /organism="Escherichia coli O157:H7 str. Sakai"
FT                   /strain="Sakai"
FT                   /sub_strain="RIMD 0509952"
FT                   /mol_type="genomic DNA"
FT                   /serovar="O157:H7"
FT                   /db_xref="taxon:386585"
FT   CDS_pept        190..273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrL"
FT                   /locus_tag="ECs_0001"
FT                   /product="thr operon leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33424"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33424"
FT                   /db_xref="GOA:Q8XA85"
FT                   /db_xref="InterPro:IPR011720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA85"
FT                   /protein_id="BAB33424.1"
FT                   /translation="MKRISTTITTTITTTITITITTGNGAG"
FT   CDS_pept        354..2816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="ECs_0002"
FT                   /product="aspartokinase I"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33425"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33425"
FT                   /db_xref="GOA:Q8XA84"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA84"
FT                   /protein_id="BAB33425.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTISGQDALPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASRIPADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASRDEDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMS
FT                   RARISVVLITQSSSEYSISFCVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLN
FT                   LENWQEELAQAKEPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHLLRHAAEKSRRKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGI
FT                   LSGSLSYIFGKLDEGMSFSEATTLAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELADIEIEPVLPAEFNAEGDVAAFMANLSQLDDLFAARVAKARDEGKVLRYVGNIDEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   CDS_pept        2818..3750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="ECs_0003"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33426"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33426"
FT                   /db_xref="GOA:Q8XA82"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA82"
FT                   /protein_id="BAB33426.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVESAETFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
FT   CDS_pept        3751..5037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="ECs_0004"
FT                   /product="L-threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33427"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33427"
FT                   /db_xref="GOA:Q8XA80"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA80"
FT                   /protein_id="BAB33427.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDE
FT                   MLKLDFVTRSAKILSAFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHIAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQEARNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   FLHDGQWSPKATQATLSNAMDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTM
FT                   RELKELGYTSEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKE
FT                   LAERADLPLLSHNLPADFAALRKLMMNHQ"
FT   CDS_pept        5251..5547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="ECs_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33428"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33428"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA78"
FT                   /protein_id="BAB33428.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMATQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAHHDHHGGHGPGKHHR"
FT   CDS_pept        complement(5700..6476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="ECs_0006"
FT                   /product="peroxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33429"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33429"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA76"
FT                   /protein_id="BAB33429.1"
FT                   /translation="MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQ
FT                   ISTLMRISDKLAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQG
FT                   DNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTGFNSEGYFFDEASSSNGELVFKRYEQR"
FT   CDS_pept        complement(6546..7976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="ECs_0007"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33430"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33430"
FT                   /db_xref="GOA:Q8XA75"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA75"
FT                   /protein_id="BAB33430.1"
FT                   /translation="MPDFFSFINSVLWGSVMIYLLFGAGCWFTFRTGFVQFRYIRQFGK
FT                   SLKNSIHPQPGGLTSFQSLCTSLAARVGSGNLAGVALAITAGGPGAVFWMWVAAFIGMA
FT                   TSFAECSLAQLYKERDVNGQFRGGPAWYMARGLGMRWMGVLFAVFLLIAYGIIFSGVQA
FT                   NAVARALSFSFDFPPLVTGIILAVFALLAIIRGLHGVARLMQGFVPLMAIIWVLTSLVI
FT                   CVINIGQLPHVIWSIFESAFGWQEAAGGAAGYTLSQAITNGFQRSMFSNEAGMGSTPNA
FT                   AAAAASWPPHPAAQGIVQMIGIFIDTLVICTASAMLILLAGNGTTYMPLEGIQLIQKAM
FT                   RVLMGSWGAEFVTLVVILFAFSSIVANYIYAENNLFFLRLNNPKAIWCLRICTFATVIG
FT                   GTLLSLPLMWQLADIIMACMAITNLTAILLLSPVVHTIASDYLRQRKLGVRPVFDPLRY
FT                   PDIGRQLSRDAWDDVSQE"
FT   CDS_pept        8255..9208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="ECs_0008"
FT                   /product="transaldolase B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33431"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33431"
FT                   /db_xref="GOA:P0A871"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A871"
FT                   /protein_id="BAB33431.1"
FT                   /translation="MTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSNDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWYKANTDKKEYAPAEDPGVVSVSEIYQYYKEHGYETVV
FT                   MGASFRNIGEILELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPARITESEF
FT                   LWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDLL"
FT   CDS_pept        9323..9910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="ECs_0009"
FT                   /product="molybdochelatase incorporating molybdenum into
FT                   molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33432"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33432"
FT                   /db_xref="GOA:P0AF04"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AF04"
FT                   /protein_id="BAB33432.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETR
FT                   LIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVP
FT                   YCIQLLEGPYVETAPEVVAAFRPKSARRDVSE"
FT   CDS_pept        complement(9945..10511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="satP"
FT                   /locus_tag="ECs_0010"
FT                   /product="succinate-acetate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33433"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33433"
FT                   /db_xref="GOA:P0AC99"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AC99"
FT                   /protein_id="BAB33433.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLG
FT                   LWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGESH"
FT   CDS_pept        complement(10660..11373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="ECs_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33434"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33434"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58316"
FT                   /protein_id="BAB33434.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMR
FT                   NELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSSYRVTIPAV
FT                   LQIACLRRMVSATQV"
FT   CDS_pept        complement(11399..11803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="ECs_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33436"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33436"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA68"
FT                   /protein_id="BAB33436.1"
FT                   /translation="MKSVFTISASLAISLMLCCTAQANDHKLLGVIAMPRNETNALALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
FT   CDS_pept        12180..14096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ECs_0014"
FT                   /product="chaperone Hsp70"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33437"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33437"
FT                   /db_xref="GOA:P0A6Z0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6Z0"
FT                   /protein_id="BAB33437.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVE
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVR
FT                   DAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   CDS_pept        14185..15315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ECs_0015"
FT                   /product="chaperone Hsp40"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33438"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33438"
FT                   /db_xref="GOA:Q8XA65"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA65"
FT                   /protein_id="BAB33438.1"
FT                   /translation="MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGG
FT                   GRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPT
FT                   CHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDT
FT                   GDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIE
FT                   VPTLDGRVKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQL
FT                   LQELQESFGGPTGEHNSPRSKSFFDGVKKFFDDLTR"
FT   CDS_pept        complement(15419..15628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="ECs_0016"
FT                   /product="regulatory protein MokC for HokC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33439"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33439"
FT                   /db_xref="GOA:A0A0H3JC36"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC36"
FT                   /protein_id="BAB33439.1"
FT                   /translation="MLNTCRVPLTDRKVKEKRAMKQHKVMIVALIVICITAVVAALVTR
FT                   KDLCEVHIRTGQTEVAVFTAYESE"
FT   CDS_pept        16157..17323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="ECs_0017"
FT                   /product="pH-dependent sodium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33440"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33440"
FT                   /db_xref="GOA:Q8XA63"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA63"
FT                   /protein_id="BAB33440.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAILAMMMANSGATSGWYHDFLETP
FT                   VQLRVGSLEINKNMLLWINDALMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYADPITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIIIIALFYTNDLSMASLGVAAVAIAVLAVLNLCGVRRTGVYILVGVVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTL
FT                   DGLTSILPLGIIAGLLIGKPLGISLFCWLALRLKLAHLPEGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGSVDPELINWAKLGILVGSISSAVIGYSWLRVRLRPSV"
FT   CDS_pept        17389..18288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="ECs_0018"
FT                   /product="transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33441"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33441"
FT                   /db_xref="GOA:Q8X4Y0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4Y0"
FT                   /protein_id="BAB33441.2"
FT                   /translation="MSHINYNHLYYFWHVYKEGSVVGAAEALYLTPQTITGQIRALEER
FT                   LQGKLFKRKGRGLEPSELGELVYRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADVLS
FT                   KRLVSSVLNAAVVEGEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLFSV
FT                   RIGECGVSFWCTNPPPEKPFPACLEERRLLIPGRRSMLGRKLLNWFNSQGLNVEILGEF
FT                   DDAALMKAFGAMHNAIFVAPTLYAYDFYADKTVVEIGRVENVMEEYHAIFAERMIQHPA
FT                   VQRICNTDYSALFSPAVR"
FT   CDS_pept        complement(18326..19286)
FT                   /transl_table=11
FT                   /locus_tag="ECs_0019"
FT                   /note="hypothetical protein"
FT                   /pseudogene="unknown"
FT   CDS_pept        complement(19299..21749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0022"
FT                   /product="fimbrial assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33445"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33445"
FT                   /db_xref="GOA:Q8XA56"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA56"
FT                   /protein_id="BAB33445.1"
FT                   /translation="MLRTTRWVAAIIFLYSFPGYAEETFDTHFMIGGMKGEKVSEYHFD
FT                   NKQPLPGNYELDFYVNNQWRGKQDITIPESPVKPCLPKVLLTKLGVKTGNLNTEDNCIL
FT                   LDKAVHGGQYQWDISEHRLNLTVPQAYINELERGYVPPESWDRGIDAFYTSYNLSQYRS
FT                   YDSNNNSNTASYGRFNSGLNLFSWQLHSDASYSKPDDMKGTWQSNTLYLEHGWSQILST
FT                   VQIGENYTSSLIFDSLRFSGIRLFRDMQMLPDSMQSFTPLVQGVAQSNALITVSQNGYI
FT                   IYQKEVPPGPFTIADLQLSGSGSDLDVSIKEADGSVRSFLVPYSSVPNMLQPGISNFDF
FT                   IAGRSKIYGVKNQEDFLEANYIYGLNNLLTLYGGTILSDNYNAITLGNGWNTPLGAISF
FT                   DATRSSSKLNNDITHEGTSYQVAYNKYLVQTATRFSVAAWRYASQDYRTFSDHLYENDK
FT                   INHQSDYDDFYDIGRKNSLSANIMQPLSNNLGNVSLSALWRNYWGRSGNAKDYQFSYSN
FT                   SWQRISYTFSASQSYDENDKEEERFNLFISIPFYWGDDIAKTRHQINLSNSTSFSKDGY
FT                   SSNNTGITGIAGEHDQLNYGIYVNQQQQNNDTSLGTNLSWRTPIATIDGSYSHSKNAWQ
FT                   SGGSISSGLVVWPGGINITNQLSDTFAILDAPGLEGAHINGQKYNRTNSKGQVVYDLMI
FT                   PHRENHLVLDTANSESETELQGNRQIIAPYRGAVSYVQFTTDQRKPWYIQALRPDGSPL
FT                   TFGYDVLDLQENNIGVVGQGSRLFIRVDEIPTGIKVALNDEQNLFCTITFQHVIDENKT
FT                   YICQ"
FT   CDS_pept        complement(21762..22445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0023"
FT                   /product="fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33446"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33446"
FT                   /db_xref="GOA:Q8XA54"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA54"
FT                   /protein_id="BAB33446.1"
FT                   /translation="MRIITALLMSFFILPVHAGVVIYGTRIIYPEKNREVLVQLMNQSK
FT                   NASLIQAWIDDGNTTIAPEKIQVTFILTPPVSRVAGGSGQQLKIRKMPNNLPHNKESLF
FT                   YLNVLDIPPNNPQNAGKNKIKLALQNRIKLLWRPSGIAPVDKKSLSQLNIKKKNNAISI
FT                   NNETANWITVTTIKAQNVKVNNESILLPPFSHNDITLKNNHASEYELTVVDDYGNNIHS
FT                   KIAAR"
FT   CDS_pept        complement(22495..23028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0024"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33447"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33447"
FT                   /db_xref="GOA:Q8XA52"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA52"
FT                   /protein_id="BAB33447.1"
FT                   /translation="MKKYIIPFVATTLMFSATTFAKDVDQGTLTIRGEVVDTTCYFVNG
FT                   DSTTDIVVEDVVTSAMNQLINNEIYTLKTGSTSHDLEIQCDGNTAPSIEVLASEFDANN
FT                   FTLNKGTAENIGFAIFLDDGTLTRMRPGLKTPLKDNGSGQYFLNLNAQYARTSGNPVTK
FT                   GSVESTVTIKISAD"
FT   CDS_pept        complement(23330..24751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espX1"
FT                   /locus_tag="ECs_0025"
FT                   /product="T3SS effector-like protein EspX"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33448"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33448"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA51"
FT                   /protein_id="BAB33448.1"
FT                   /translation="MTDGISTSPHCLYKSNIVDDVIINKTRQNELVKVFCEYKTEFLIL
FT                   FDDFFRSQDLPKPSPVLHHFFQYTHLRDAHFYRCKLIEHTVQFSFFKHKGITLLRLDVF
FT                   DDRTSECLSEEIKIYQECHEKFIKFLKANFNQEIYPELYTPEIFYEACRNLQSFYDHQE
FT                   TSQNAKYSAIVKKKSYFNKEIRNLIKKNIYPELYNEQCNKIPASSTDDNQKITWQNFKT
FT                   SNAAYSQLCEKLSLLKSSPSRLIEKSAYCSNENMITDKFDVVFSYCGDNVKEFILLLPY
FT                   NKSLEMHELNEQNIQYLTALNINIHKLLLSNITIEKSNLSYGYYFGCVLSNISCFESDL
FT                   SNTIFSNGEINNLFIKKSNIFGTSFTNTMIKNLRCEDIMPGRWTTQLVNKHLGYRYTGV
FT                   FKTLASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELKKFMHDYDKTSPEMRKYLQS
FT                   INESMFLMKKISHQD"
FT   CDS_pept        complement(25221..25484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="ECs_0026"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33449"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33449"
FT                   /db_xref="GOA:P0A7U9"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7U9"
FT                   /protein_id="BAB33449.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   CDS_pept        25819..26760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ECs_0028"
FT                   /product="bifunctional riboflavin kinase/FAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33451"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33451"
FT                   /db_xref="GOA:P0AG42"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG42"
FT                   /protein_id="BAB33451.1"
FT                   /translation="MKLIRGIHNLSQAPQEGCVLTIGNFDGVHRGHRALLQGLQEEGRK
FT                   RNLPVMVMLFEPQPLELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTA
FT                   QNFISDLLVKHLRVKFLAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVR
FT                   ISSTAVRQALADDNLALAESLLGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVK
FT                   GVYAVEVLGLGEKPLPGVANIGTRPTVAGIRQQLEVHLLDVAMDLYGRHIQVVLRKKIR
FT                   NEQRFASLDELKAQIARDELTAREFFGLTKPA"
FT   CDS_pept        26803..29619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="ECs_0029"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33452"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33452"
FT                   /db_xref="GOA:Q8XA49"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA49"
FT                   /protein_id="BAB33452.1"
FT                   /translation="MSDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAK
FT                   KGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGYDSPYVPGWDCHGLPIEL
FT                   KVEQEYGKPDEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEA
FT                   NIIRALGKIIGNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFQAVDQDAL
FT                   KAKFGVSNVNGPISLVIWTTTPWTLPANRAISIAPDFDYALVQIDGQAVILAKDLVESV
FT                   MQRIGVTDYTILGTVKGAELELLRFAHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGP
FT                   DDYVIGQKYGLETANPVGPDGTYLPGTYPTLDGVNVFKANDIVVALLQEKGALLHVEKM
FT                   QHSYPCCWRHKTPIIFRATPQWFVSMDQKGLRAQSLKEIKGVQWIPDWGQARIESMVAN
FT                   RPDWCISRQRTWGVPMSLFVHKDTEELHPRTLELMEEVAKRVEVDGIQAWWDLDAKEIL
FT                   GDEADQYVKVPDTLDVWFDSGSTHSSVVDVRPEFAGHAADMYLEGSDQHRGWFMSSLMI
FT                   STAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYT
FT                   GEMAVSDEILKRAADSYRRIRNTARFLLANLNGFDPAKDMVKPEEMVVLDRWAVGCAKA
FT                   AQEDILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAKADSVARRSCQTALY
FT                   HIAEALVRWMAPILSFTADEVWGYLPGEREKYVFTGEWYEGLFGLADSEAMNDAFWDEL
FT                   LKVRGEVNKVIEQARADKKVGGSLEAAVTLYTEPELAAKLTALGDELRFVLLTSGATVA
FT                   DYNDAPADAQQSEVLKGLKVALSKAEGEKCPRCWHYTQDVGKVAEHAEICGRCVSNVAG
FT                   DGEKRKFA"
FT   CDS_pept        29619..30113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="ECs_0030"
FT                   /product="prolipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33453"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33453"
FT                   /db_xref="GOA:Q8XA48"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA48"
FT                   /protein_id="BAB33453.1"
FT                   /translation="MSQSICSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVPLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGISVTLVVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK
FT                   Q"
FT   CDS_pept        30201..30650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="ECs_0031"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33454"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33454"
FT                   /db_xref="GOA:P0AEM2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEM2"
FT                   /protein_id="BAB33454.1"
FT                   /translation="MSESVQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLS
FT                   EGLEQHLLGLKVGDKTTFSLEPDAAFGVPSPDLIQYFSRREFMDAGEPEIGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVLEIDPALEA"
FT   CDS_pept        30652..31602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="ECs_0032"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33455"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33455"
FT                   /db_xref="GOA:P62625"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62625"
FT                   /protein_id="BAB33455.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGS
FT                   KNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR
FT                   LQQLGGGEAIPLEGREENIVFEVPKELRVDIREVD"
FT   CDS_pept        31668..32582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihC"
FT                   /locus_tag="ECs_0033"
FT                   /product="ribonucleoside hydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33456"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33456"
FT                   /db_xref="GOA:Q8XA41"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA41"
FT                   /protein_id="BAB33456.1"
FT                   /translation="MRLPIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKT
FT                   TRNALQLLHFWNAEIPLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPLGIPAF
FT                   LAIRDALMRAPEPVTLVAIGPLTNIALLLSQCPECKPYIRRLVIMGGSAGRGNCTPNAE
FT                   FNIAADPEAAACVFRSGIEIVMCGLDVTNQAILTPDYLSTLPQLNRTGKMLHALFSHYR
FT                   SGSMQSGLRMHDLCAIAWLVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANV
FT                   QVALDLNVKGFQQWVAEVLALVP"
FT   CDS_pept        32749..33570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="ECs_0034"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33457"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33457"
FT                   /db_xref="GOA:P58209"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58209"
FT                   /protein_id="BAB33457.1"
FT                   /translation="MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLL
FT                   GSDAGELAGAGKTGVTVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTT
FT                   GFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERLEITHKASSRMTFANGAVRSALWLSGKENGLFDMRDVLDLNNL"
FT   CDS_pept        34026..35174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ECs_0035"
FT                   /product="carbamoyl phosphate synthetase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33458"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33458"
FT                   /db_xref="GOA:P0A6F2"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6F2"
FT                   /protein_id="BAB33458.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVT
FT                   TAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQ
FT                   TSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTAK"
FT   CDS_pept        35192..38413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="ECs_0036"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33459"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33459"
FT                   /db_xref="GOA:P63737"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63737"
FT                   /protein_id="BAB33459.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNAEFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLAEQGVTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKHGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIK"
FT   CDS_pept        complement(38421..38639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_5362"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X446"
FT                   /protein_id="BBE29392.1"
FT                   /translation="MTRFEAIKQGHIKIVDISIVCNFTVDKCELNPAYVIKNIDSPKDL
FT                   LNGQKKRSSSENRISYSIKLADEKYPP"
FT   CDS_pept        38674..39069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="ECs_0037"
FT                   /product="cai operon transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33460"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33460"
FT                   /db_xref="GOA:Q8XA37"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA37"
FT                   /protein_id="BAB33460.2"
FT                   /translation="MCEGYVEKPLYLLIAEWMMAENRWVIAREISIHFDIEHSKAVNTL
FT                   TYILSEVTEISCEVKMIPNKLEGRGCQCQRLVKVVDIDEQIYARLRNNSREKLVGVRKT
FT                   PRIPAVPLTELNREQKWQMMLSKSMRR"
FT   CDS_pept        complement(39188..39778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="ECs_0038"
FT                   /product="carnitine operon protein CaiE"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33461"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33461"
FT                   /db_xref="GOA:Q8XA36"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA36"
FT                   /protein_id="BAB33461.2"
FT                   /translation="MSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLIVQAGANIQDGCIMHGYTDTDTIVGENGHIGHGAILHGCVIGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFHGEKRQLLMGTPARAVRSVSDDELHWKRLNTKEYQDLV
FT                   GRCHASLHETQPLRQMEENRPRLQGTTDVTPKR"
FT   CDS_pept        complement(39784..40569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="ECs_0039"
FT                   /product="carnitinyl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33462"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33462"
FT                   /db_xref="GOA:Q8XA35"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA35"
FT                   /protein_id="BAB33462.2"
FT                   /translation="MSESLHLTRNGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDP
FT                   QLRVAIITGAGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGY
FT                   AFGGGFELALAADFIVCADNASFALPEAKLGIVPDSGGVLRLPKILPPAIVNEMVMTGR
FT                   RMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAALKEIYRTTSEMPVEES
FT                   YSYIRSGVLKHYPSVLHSEDAIEGPLAFAEKRDPVWKGR"
FT   CDS_pept        complement(40678..42231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="ECs_0040"
FT                   /product="crotonobetaine/carnitine-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33463"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33463"
FT                   /db_xref="GOA:Q8XA34"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA34"
FT                   /protein_id="BAB33463.2"
FT                   /translation="MDIIGGQHLRQMWDDLADVYGHKTALICESSGGVVNRYSYLELNQ
FT                   EINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLREESAWI
FT                   LQNSQACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSSFTQLKNQQPAT
FT                   LCYAPPLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQCALRDDDVYLTVMP
FT                   AFHIDCQCTAAMAAFSAGATFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQPP
FT                   SANDRQHRLREVMFYLNLSEQEKDTFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWP
FT                   SIGRAGFCYDAEIRDDHNRPLPAGEIGEICIKGVPGKTIFKEYFLNPKATAKVLEADGW
FT                   LHTGDTGYRDEEGFFYFIDRRCNMIKRGGENVSCVELENIIATHPKIQDIVVVGIKDSI
FT                   RDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSYLEIRKDLPRNCSGKIIRKNLK
FT                   "
FT   CDS_pept        complement(42305..43522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="ECs_0041"
FT                   /product="crotonobetainyl CoA:carnitine CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33464"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33464"
FT                   /db_xref="GOA:Q8XA32"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA32"
FT                   /protein_id="BAB33464.1"
FT                   /translation="MDHLPMPKFGPLAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIEN
FT                   VAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARR
FT                   GITDEVLWQHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMPA
FT                   FPYTADYFSGLTATTAALAALHKARETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEMC
FT                   PRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGTPEIPEGTQLI
FT                   HRIECPYGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESI
FT                   TQWQTMDGRTCKGPNIMPKFKNNPGQIWRGMPSHGMDTAAILKNIGYSENDIQELVSKG
FT                   LAKVED"
FT   CDS_pept        complement(43651..44793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="ECs_0042"
FT                   /product="crotonobetaine reductase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33465"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33465"
FT                   /db_xref="GOA:P60586"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60586"
FT                   /protein_id="BAB33465.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRRNGKIYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKPGIKVTKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVG
FT                   IAGNHRISRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   CDS_pept        complement(44824..46338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="ECs_0043"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33466"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33466"
FT                   /db_xref="GOA:Q8XA30"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA30"
FT                   /protein_id="BAB33466.1"
FT                   /translation="MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGNEPPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKELGLAYSLFLWGPLPWATYSFLSVAFAYFFFV
FT                   RKMEVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMYLPRMLFYTDPIAKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLIDKNIINIPNLIEQYGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREVRDGEEPPLLVRIGWSILVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD"
FT   CDS_pept        46817..47587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="ECs_0044"
FT                   /product="anaerobic carnitine reduction electron transfer
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33467"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33467"
FT                   /db_xref="GOA:P60567"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60567"
FT                   /protein_id="BAB33467.2"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASAL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
FT   CDS_pept        47602..48543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="ECs_0045"
FT                   /product="electron transfer flavoprotein FixB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33468"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33468"
FT                   /db_xref="GOA:Q8XA27"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA27"
FT                   /protein_id="BAB33468.1"
FT                   /translation="MNTFSQVWVFSDTPSRLPELMNGAQALANQINAFVLNDADGAQAI
FT                   QLGANHVWKLNGKPDDRMIEDYASVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLK
FT                   AAVSNDASTVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPDASRTG
FT                   ETHTVEWQAPAVAITRTATQARQSNSVDLDKARLVVSVGRGIGSKENIALAEQLCKAIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANASQTIFAIN
FT                   KDKNAPIFQYADYGIVGDAVKILPALTAALAR"
FT   CDS_pept        48594..49880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiS"
FT                   /locus_tag="ECs_0046"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33469"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33469"
FT                   /db_xref="GOA:Q7AHT0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AHT0"
FT                   /protein_id="BAB33469.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLEHIIPGFAESAPVERLITHEKLAFMTEKSAMTMDYCNGDETSPSQRSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNLVQRDGKVVGVEADGDVIEAKTVILADGVN
FT                   SILAEKLGMAKRVKPTNVAVGVKELIELPKSVIEDRFQLQGNQGAACLFAGSPTDGLMG
FT                   GGFLYTNENTLSLGLVCGLHHLHDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYSAHVV
FT                   PEAGINMLPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAIAAGEAAAKTVLSAMKSDDF
FT                   SKQKLAEYRQHLESGPLRDMRMYQKLPAFLDNPRMFSGYPELAVGVARDLFTIDGSAPE
FT                   LMRKKILRHGKKVGFINLIKDGMKGVTVL"
FT   CDS_pept        49877..50164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="ECs_0047"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33470"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33470"
FT                   /db_xref="GOA:P68648"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68648"
FT                   /protein_id="BAB33470.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG"
FT   CDS_pept        50222..51553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="ECs_0048"
FT                   /product="MFS sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33471"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33471"
FT                   /db_xref="GOA:Q8XA25"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA25"
FT                   /protein_id="BAB33471.1"
FT                   /translation="MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYILVMIGVALEQLT
FT                   PALKLDADWIGLLGAGTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMFVS
FT                   SPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGY
FT                   WLYDVEGGWRWMLGSAAIPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVA
FT                   FDEEQPQQTRFRDLFNRRHFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGVGKNA
FT                   ALGNVVISLFFMLGCIPPMLWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMA
FT                   FAVYAFFSGGPGNLQWLYPNELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGI
FT                   SNTMLMGAGISLFGLLISVAFAPETRGMSLAQTSNMTIRGQRMG"
FT   CDS_pept        51661..52191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="ECs_0049"
FT                   /product="potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33472"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33472"
FT                   /db_xref="GOA:Q8XA24"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA24"
FT                   /protein_id="BAB33472.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMFEQARTLEGVEIRSLYQLYPDFNID
FT                   IAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGESHFEIGAHPGFDVLSQPLQATAIYCGLNWLPPFAMHCTFICDDETLEGQARHY
FT                   KQRLLEWQEAHHG"
FT   CDS_pept        52184..54046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="ECs_0050"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33473"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33473"
FT                   /db_xref="GOA:Q8XA20"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA20"
FT                   /protein_id="BAB33473.1"
FT                   /translation="MDSHTLVQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFIIGLELDPQRLWKLRAAVFGGGALQMVICGGLLGLF
FT                   CMLLGLRWQVAELIGMTLALSSTAIAMQAMNERNLMVTQMGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASSASTTMGAFALSALKVAGALVLVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLIENPLRIVILLLGFLIIKIAMLWLIARPLQVPNKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMANVLEPEWAKSLTLAVALSMAATPILLVILNRLEQSSTEEAREADEIDEEQ
FT                   PRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYICLRQAGVEKPERE
FT                   TFEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTEEGKHTGNMADEPETKPSS"
FT   CDS_pept        54127..54717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="ECs_0051"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33474"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33474"
FT                   /db_xref="GOA:Q8XA18"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA18"
FT                   /protein_id="BAB33474.2"
FT                   /translation="MDSPAEYKIFLNIILAPVDDGLRFTYSGDNFFYREISMISLIAAL
FT                   AVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTRESIGRPLPGRKNIILSSQPG
FT                   TDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFP
FT                   DYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   CDS_pept        54803..55036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0052"
FT                   /product="CcdA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33475"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33475"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA17"
FT                   /protein_id="BAB33475.1"
FT                   /translation="MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHA
FT                   ATRWREENAEAIAALNQLADETGCFSDEYRSF"
FT   CDS_pept        55039..55353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0053"
FT                   /product="CcdB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33476"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33476"
FT                   /db_xref="GOA:Q8XA16"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA16"
FT                   /protein_id="BAB33476.1"
FT                   /translation="MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFSR
FT                   IRPPERLNPILLLVDGKEYVLMTHETATVPVNALGTKFCDASAHRTLIKGALDFMLDGI
FT                   "
FT   CDS_pept        complement(55350..56198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="ECs_0054"
FT                   /product="diadenosine tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33477"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33477"
FT                   /db_xref="GOA:Q8XA15"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA15"
FT                   /protein_id="BAB33477.1"
FT                   /translation="MATYLIGDVHGCYDELIALLHKVEFTPGKDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGSLTCLRWEDKQYFVQPSNRHKDLGEGEAVA
FT                   S"
FT   CDS_pept        complement(56205..56582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ECs_0055"
FT                   /product="CO2+/MG2+ efflux protein ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33478"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33478"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62674"
FT                   /protein_id="BAB33478.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDE
FT                   NGVPFSIDIPVFRLAVPTLIH"
FT   CDS_pept        complement(56585..57406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmA"
FT                   /locus_tag="ECs_0056"
FT                   /product="ribosomal RNA small subunit methyltransferase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33479"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33479"
FT                   /db_xref="GOA:Q8XA14"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA14"
FT                   /protein_id="BAB33479.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTFNFGELAEKM
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCNVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPHPVKDVRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVEVLTGMGIDPAMRAENISVAQYCQMANYLAENAPFQES"
FT   CDS_pept        complement(57403..58392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="ECs_0057"
FT                   /product="4-hydroxy-L-threonine phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33480"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33480"
FT                   /db_xref="GOA:P58713"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58713"
FT                   /protein_id="BAB33480.1"
FT                   /translation="MVKTQRVVITPGEPAGIGPDLVVQLAQREWPVELVVCADATLLTD
FT                   RAAMLGLPLTLRPYSPNSPAQPQTTGTLTLLPVALRESVTAGQLAIENGHYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGEADVGSFITALNLAIKMIVNTQ"
FT   CDS_pept        complement(58392..59678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="ECs_0058"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33481"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33481"
FT                   /db_xref="GOA:P0ABZ8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABZ8"
FT                   /protein_id="BAB33481.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIA
FT                   KQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQ
FT                   VGNQNDASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSAD
FT                   QQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNIS
FT                   VTEVHARHILLKPSPIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAASWMQEQRASAYVKILSN"
FT   CDS_pept        complement(59731..62085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptD"
FT                   /locus_tag="ECs_0059"
FT                   /product="LPS assembly OM complex LptDE beta-barrel
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33482"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33482"
FT                   /db_xref="GOA:Q8XA13"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA13"
FT                   /protein_id="BAB33482.1"
FT                   /translation="MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQG
FT                   DTNDLPVTINANHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVSIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQ
FT                   AGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYF
FT                   NDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYY
FT                   QNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHY
FT                   QQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYV
FT                   PYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFN
FT                   ISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNV
FT                   ATSNSSIEYRRDEDRLVQLNYRYASPEYIQATLPKYYSTAEQYKNGISQVGAVASWPIA
FT                   DRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIG
FT                   FNIELRGLSSNYGLGTQEMLRSNILPYQNTL"
FT   CDS_pept        62340..63155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="ECs_0060"
FT                   /product="membrane-anchored DnaK co-chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33483"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33483"
FT                   /db_xref="GOA:Q7AHS5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AHS5"
FT                   /protein_id="BAB33483.1"
FT                   /translation="MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
FT   CDS_pept        63450..64202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY1"
FT                   /locus_tag="ECs_0061"
FT                   /product="T3SS effector-like protein EspY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33484"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33484"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA11"
FT                   /protein_id="BAB33484.1"
FT                   /translation="MKVSVPGMPATLLNMSNNDIYKMVSGDKMDMKMNIFQRLWETLRH
FT                   LFWSDKQTEAYKLLFNFVNKKAGNINASKYFTGAVNENEKEKFIHSLELFNELKTCAKN
FT                   PDEMVAKGNMSWVAQTFGDIELSVTFFIENKEICTQTLQLHKGPGNLGVDLREAYLPGV
FT                   DMRDCYLGLKTMKGHNKVLYLEPGWNANLDGATLDGATLDGATVDGATHLYDEVIIINK
FT                   ITPKKIDTEEVATKQSTAEQITDNAIIE"
FT   CDS_pept        complement(64620..65279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="ECs_0062"
FT                   /product="23S rRNA/tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33485"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33485"
FT                   /db_xref="GOA:Q8XA10"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA10"
FT                   /protein_id="BAB33485.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDDHIMVVNKPSGLLSVPGRLEEHKDS
FT                   VMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFRERVPKKQYVTRVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEARAMAPRLLLHAEMLTITHPAYGNSMTFKAPADF"
FT   CDS_pept        complement(65291..68197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapA"
FT                   /locus_tag="ECs_0063"
FT                   /product="RNA polymerase remodeling/recycling factor
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33486"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33486"
FT                   /db_xref="GOA:P60241"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60241"
FT                   /protein_id="BAB33486.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAVDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHDGWQMQVEEVKEENGLLTYIGTRLDTEESGVALREVFLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKYSSEQFRMPYSGLRGQRTSLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLDFARRSKQRLEHLCEAEWDLLVVDE
FT                   AHHLVWSEDAPSREYQAIEQLAEHVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFA
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNMLGEMIGEQDIEPLLQAANSDSEDAQSA
FT                   RQELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPERIYQEFEGDNATWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   HMVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRTIYDSVYNDLINYLASPDQTEGFDDLIKNCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQALAESIEEQDDDTNLIAFAMNLFDIIGINQDDRGDNMIVLTPSDHMLVPDFPG
FT                   LSEDGITITFDREVALAREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELIYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLNAVNRH
FT                   TGSKLVNAVQQDVHAILQLGEAQIEKSARALIDAARNEADEKLSAELSRLEALRAVNPN
FT                   IRDDELTAIESNRQQVMESLDQAGWRLDALRLIVVTHQ"
FT   CDS_pept        complement(68361..70712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="ECs_0064"
FT                   /product="DNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33487"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33487"
FT                   /db_xref="GOA:Q8XA09"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA09"
FT                   /protein_id="BAB33487.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPLQVTLAPQESVAFI
FT                   PADQVPRAQHILRGEQGFRLTPLALKDFHRQPVYGLYCRAHRQLMNYEKRLREGGVTVY
FT                   EADVRPPERYLMERFITSPVWVEGDMHNGAIVNARLKPHPDYRPPLKWVSIDIETTRHG
FT                   ELYCIGLEGCGQRIVYMLGPENGDASALDFELEYVASRPQLLEKLNAWFANYDPDVIIG
FT                   WNVVQFDLRMLQKHAERYRIPLRLGRDNSELEWREHGFKNGVFFAQAKGRLIIDGIEAL
FT                   KSAFWNFSSFSLETVAQELLGEGKSIDNPWDRMDEIDRRFAEDKPALATYNLKDCELVT
FT                   QIFHKTEIMPFLLERATVNGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPHAS
FT                   PGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAW
FT                   FSREKHCLPEIVTNIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLVS
FT                   SITMRGHQIMRQTKALIEAQGYDVIYGDTDSTFVWLKGAHSEEEATKIGRALVQHVNVW
FT                   WAETLQKQQLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGLIQEGDKQRMVFKGLE
FT                   TVRTDWTPLAQQFQQELYLRIFRNEPYQEYFRETIDKLMAGELDARLVYRKRLRRPLSE
FT                   YQRNVPPHVRAARLADEENQKRGRPLQYQNRGTIKYVWTTNGPEPLDYQRSPLDYEHYL
FT                   TRQLQPVAEGILPFIEDNFATLMTGQLGLF"
FT   CDS_pept        complement(70787..71482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="ECs_0065"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33488"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33488"
FT                   /db_xref="GOA:Q8XA08"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA08"
FT                   /protein_id="BAB33488.1"
FT                   /translation="MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSG
FT                   VDYSIMTADDMVVVSIETGEVVEGAKKPSSDTPTHRLLYQAFPSIGGIVHTHSRHATIW
FT                   AQAGQSIPATGTTHADYFYGTIPCTRKMTDAEINGEYEWETGNVIVETFEKQGIDAAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQTLLDKHYLRK
FT                   HGAKAYYGQ"
FT   CDS_pept        complement(71682..73184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="ECs_0066"
FT                   /product="L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33489"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33489"
FT                   /db_xref="GOA:P58538"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58538"
FT                   /protein_id="BAB33489.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVKALNTEAKLP
FT                   CKLVLKPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSW
FT                   MRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIS
FT                   DGDVNALVDEYESCYTMTPATQIHGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPSIAAEEKPILDVQHLGIGGKDDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALN
FT                   LNDMRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR"
FT   CDS_pept        complement(73195..74895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="ECs_0067"
FT                   /product="L-ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33490"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33490"
FT                   /db_xref="GOA:P58541"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58541"
FT                   /protein_id="BAB33490.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCTTGEEIATSVEWYPRWQKGQFCDA
FT                   PNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEAEEITRLCHAPGNVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQSAASWIELCDWVPALLSGTTRPQDIRRGRCSAGHKSLWHESWGGLPPASF
FT                   FDELDPILNRHLPSPLFTDTWTADIPVGTLCPEWAQRLGLPESVVISGGAFDCHMGAVG
FT                   AGAQPNALVKVIGTSTCDILIADKQSVGERAVKGICGQVDGSVVPGFIGLEAGQSAFGD
FT                   IYAWFGRVLGWPLEQLAAQHPELKEQIDASQKQLLPALTEAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPLLFGGLIAATAFGARAIMECFTDQGIAVNNVMAL
FT                   GGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPSAQQKMASA
FT                   VEKTLQPRSEQAQRFEQLYRRYQQWAMSAEQHYLPTSAPAQAAQAVPTL"
FT   CDS_pept        75234..76112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="ECs_0068"
FT                   /product="ara regulon transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33491"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33491"
FT                   /db_xref="GOA:P0A9E1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9E1"
FT                   /protein_id="BAB33491.1"
FT                   /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW
FT                   HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
FT                   MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   EKVNDVAVKLS"
FT   CDS_pept        76198..76962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="ECs_0069"
FT                   /product="DedA family inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33492"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33492"
FT                   /db_xref="GOA:Q8XA07"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA07"
FT                   /protein_id="BAB33492.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLVRHPLMPVYIDILRKVVGV"
FT   CDS_pept        complement(77049..77747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="ECs_0070"
FT                   /product="thiamine/thiamine pyrophosphate ABC transporter
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33493"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33493"
FT                   /db_xref="GOA:Q8XA06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA06"
FT                   /protein_id="BAB33493.1"
FT                   /translation="MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLTPASGALTIDGVDHTTTPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNA
FT                   VQQEKMHAIARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPA
FT                   LRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGKA
FT                   SASALLGITG"
FT   CDS_pept        complement(77731..79341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="ECs_0071"
FT                   /product="thiamine transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33494"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33494"
FT                   /db_xref="GOA:Q8XA05"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA05"
FT                   /protein_id="BAB33494.1"
FT                   /translation="MATRRQPLIPGWLIPGVSAATLVVAVALAAFLALWWNAPQGDWSA
FT                   VWQDSYLWHVVRFSFWQAFLSALLSVVPAIFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLCQSLGLEWTFSPYGLQGILLAHVFFNLPMASRLLLQALE
FT                   NIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVTALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAMLALIQMVCCLGLVLLSQRLSKAIAPGTTLLQGWRDP
FT                   DDRLHSRICDTMLIVLALLLLLPPLLAVIVDGVNRQLPEVLAQPVLWQALWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRARQKMLAGQALEMSGMLILAMPGIVLATGFFLLLNNTIG
FT                   LPQSADGIVIFTNALMAIPYALKVLENPMRDITARYSMLCQSLGIEGWSRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDDFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFLLFSVIEKIPGRNVKTD"
FT   CDS_pept        complement(79317..80300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiB"
FT                   /locus_tag="ECs_0072"
FT                   /product="thiamine/thiamine pyrophosphate/thiamine
FT                   monophosphate ABC transporter periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33495"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33495"
FT                   /db_xref="GOA:Q8XA04"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA04"
FT                   /protein_id="BAB33495.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDIFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
FT   CDS_pept        80672..81241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY2"
FT                   /locus_tag="ECs_0073"
FT                   /product="T3SS effector-like protein EspY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33496"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33496"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA03"
FT                   /protein_id="BAB33496.1"
FT                   /translation="MKVRNPEQISIPASNTTKDPGLTNSQIIRMANLVKKTENMNIFEE
FT                   LWETLRNLFQSDKHSQTAARQILKDAFYFQNSDDYSKYFTGAVDGKARDKLTHWLIKFN
FT                   ELKEYAKDPENMAAKASLSPEGTLCVSFFIGDEAIFTLELQLKKSTRTGGIDLSNAYFN
FT                   GVVICGIDCLEVDLSNAETNNSRWYD"
FT   CDS_pept        complement(81470..83128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgrR"
FT                   /locus_tag="ECs_0074"
FT                   /product="transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33497"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33497"
FT                   /db_xref="GOA:Q8XA02"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA02"
FT                   /protein_id="BAB33497.1"
FT                   /translation="MPSARLQQQFIRLWQCCEGKSQDTTLNELAALLSCSRRHMRTLLN
FT                   TMQDRGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKATVR
FT                   QMLVSHLGRSFRQGRHILRVLYYRPLRNLLPGSALRRSETHIARQIFSSLTRINEENGE
FT                   LEADIAHHWQQISPLHWRFFLRPGVHFHHGRELEMDDVIASLKRINTLPLYSHIADIVS
FT                   PTPWTLDIHLTQPDRWLPLLLGQVPAMILPREWETLSNFASHPIGTGPYAVIRNSTNQL
FT                   KIQAFDDFFGYRALIDEVNVWVLPEIADEPAGGLMLKGPQGEEKEIESRLEEGCYYLLF
FT                   DSRTHRGANQQVRDWVSYVLSPTNLVYFAEEQYQQLWFPAYGLLPRWHHARTITSEKPA
FT                   GLESLTLTFYQDHSEHRVIAGIMQQILASHQVTLEIKEISYDQWHEGEIESDIWLNSAN
FT                   FTLPLDFSLFAHLCEVPLLQHCIPIDWQVDAARWRNGEMNLANWCQQLVASKAMVPLIH
FT                   HWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDPE"
FT   CDS_pept        complement(83456..84061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="ECs_0075"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33498"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33498"
FT                   /db_xref="GOA:Q8XA01"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA01"
FT                   /protein_id="BAB33498.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFSQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMR"
FT   CDS_pept        complement(84072..85472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="ECs_0076"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33499"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33499"
FT                   /db_xref="GOA:Q8XA00"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA00"
FT                   /protein_id="BAB33499.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQA
FT                   EEISPQVTWGTNPGQVISVNDNIPDPASFADPVERASAEKALAYMGLKPGILLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNIK"
FT   CDS_pept        complement(85475..86566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="ECs_0077"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33500"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33500"
FT                   /db_xref="GOA:Q8X9Z9"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Z9"
FT                   /protein_id="BAB33500.2"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMTQALKVLDAVRNRFAMRITTSHYDV
FT                   GGAAIDNHGQPLPPATVEGCEQADAVLFGSVGGPKWEHLPPDQQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRHKVTSIDKANVLQSSILWREIVNEIATEYPDIELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDADDAASAIERAINRALEEGIRTGDLA
FT                   RGAAAVSTDEMGDIIARYVAEGV"
FT   CDS_pept        complement(86566..88137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="ECs_0078"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33501"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33501"
FT                   /db_xref="GOA:Q8X9Z8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Z8"
FT                   /protein_id="BAB33501.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARQVKNSRVCALARCVEKDIDVAAESLKVAEAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAAINAGA
FT                   TTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGLAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCSLEEVIMAIKVRKDILNVHTAINHQEIWRTSQLVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MDEMGYKESEYNLDNLYDAFLKLADKKGQVFDYDLEALAFIGKQQEEPEHFRLDYFSVQ
FT                   SGSNDIATAAVKLACGEEVKAEAANGNGPVDAVYQAINRITDYNVELVKYSLTAKGHGK
FT                   DALGQVDIVANYNGRRFHGVGLATDIVESSAKAMVHVLNNIWRATEVEKELQRKAQHNE
FT                   NNKETV"
FT   CDS_pept        complement(88230..88316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuL"
FT                   /locus_tag="ECs_0079"
FT                   /product="leu operon leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33502"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33502"
FT                   /db_xref="GOA:P0AD81"
FT                   /db_xref="InterPro:IPR012570"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AD81"
FT                   /protein_id="BAB33502.1"
FT                   /translation="MTHIVRFIGLLLLNASSLRGRRVSGIQH"
FT   CDS_pept        88974..89918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="ECs_0080"
FT                   /product="DNA-binding transcriptional activator LeuO"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33503"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33503"
FT                   /db_xref="GOA:A0A0H3JC02"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC02"
FT                   /protein_id="BAB33503.1"
FT                   /translation="MPEVQTDHPETAEFSKPQLRMVDLNLLTVFDAVMQEQNITRAAHV
FT                   LGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPGSG
FT                   FEPASSERVFHLCVCSPLDSILTSQIYNHIEQIAPNIHVMFKSSLNQNTEHQLRYQETE
FT                   FVISYEDFHRPEFTSVPLFKDEMVLVASKNHPTIKGPLLKHDVYNEQHAAVSLDRFASF
FT                   SQPWYDTVDKQASIAYQGMAMMSVLSVVSQTHLVAIAPRWLAEEFAESLELQVLPLPLK
FT                   LNSRTCYLSWHEAAGRDKGHQWMEEQLVSICKR"
FT   CDS_pept        90236..91960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ECs_0081"
FT                   /product="acetolactate synthase 3 large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33504"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33504"
FT                   /db_xref="GOA:A0A0H3JBR8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBR8"
FT                   /protein_id="BAB33504.2"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIGH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPANKLPYVWPESVSMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAITAGC
FT                   HQQLKETVEALNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESA
FT                   HQPLDEIRDWWQQIEQWRARQCLKYDTHSEKIKPQAVIETLWRLTKGGAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQ
FT                   ISHPQELESKLSEALEQVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   CDS_pept        91963..92454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="ECs_0082"
FT                   /product="acetolactate synthase 3 small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33505"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33505"
FT                   /db_xref="GOA:Q8X9Z5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X9Z5"
FT                   /protein_id="BAB33505.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLYKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
FT   CDS_pept        92466..92552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="ECs_0083"
FT                   /product="fruR leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33506"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33506"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Z4"
FT                   /protein_id="BAB33506.1"
FT                   /translation="MRNLQPNMSRWAFFAKSVGTWNKSSCRS"
FT   CDS_pept        92634..93638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="ECs_0084"
FT                   /product="DNA-binding transcriptional dual regulator FruR"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33507"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33507"
FT                   /db_xref="GOA:P0ACP3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACP3"
FT                   /protein_id="BAB33507.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS"
FT   CDS_pept        94240..94698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="ECs_0085"
FT                   /product="RsmH methyltransferase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33508"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33508"
FT                   /db_xref="GOA:P65435"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65435"
FT                   /protein_id="BAB33508.1"
FT                   /translation="MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL"
FT   CDS_pept        94700..95641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmH"
FT                   /locus_tag="ECs_0086"
FT                   /product="16S rRNA m(4)C1402 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33509"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33509"
FT                   /db_xref="GOA:P60391"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60391"
FT                   /protein_id="BAB33509.1"
FT                   /translation="MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAKTIDDPRFSIIHGPFSALGEYVAERDLIGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTYGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLNVLAPGGRLSIISFHSLEDRIVKRFMRENSRGPQVPAGLPMTEEQLKKLGGRQL
FT                   RALGKLMPGEEEVAENPRARSSVLRIAERTNA"
FT   CDS_pept        95638..96003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ECs_0087"
FT                   /product="membrane bound cell division leucine zipper
FT                   septum protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33510"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33510"
FT                   /db_xref="GOA:P0AEN6"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEN6"
FT                   /protein_id="BAB33510.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   CDS_pept        96019..97785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ECs_0088"
FT                   /product="cell division protein FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33511"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33511"
FT                   /db_xref="GOA:P0AD69"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AD69"
FT                   /protein_id="BAB33511.1"
FT                   /translation="MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWL
FT                   QVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERV
FT                   FPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEF
FT                   VINQGEGTGGRS"
FT   CDS_pept        97772..99259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ECs_0089"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33512"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33512"
FT                   /db_xref="GOA:Q8X9Z2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Z2"
FT                   /protein_id="BAB33512.1"
FT                   /translation="MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKGEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHE
FT                   PSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHELAGLVDQDATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYE
FT                   AAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNY
FT                   HDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDAGHAKVMEDRAEAVTCAVMQAKEN
FT                   DVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLLGVIA"
FT   CDS_pept        99256..100614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ECs_0090"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33513"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33513"
FT                   /db_xref="GOA:Q8X9Z1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X9Z1"
FT                   /protein_id="BAB33513.1"
FT                   /translation="MISVTLSQLTDILNGELQGADITLDAVTTDTRKLTPGCLFVALKG
FT                   ERFDAHDFADQAKAGGAGALLVSRPLDIDLPQLIVKDTRLAFGELAAWVRQQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNLNNDIGVPMTLLRLTPEYDYAVIELGANH
FT                   QGEIVWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADNN
FT                   DWLNWQSVIGSRKVWRFSPNAANSDFTATNIHVTSHGTEFTLQTPTGSVDVLLPLPGRH
FT                   NIANALAAAALSMSVGATLDAIKAGLANLKAVPGRLFPIQLAENQLLLDDSYNANVGSM
FT                   TAAVQVLAEMPGYRVLVVGDMAELGAESEACHVQVGEAAKAAGIDRVLSVGKQSHAIST
FT                   ASGVGEHFAEKTALITRLKSLIAEQQVITILVKGSRSAAMEEVVRALQENGTC"
FT   CDS_pept        100608..101690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ECs_0091"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33514"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33514"
FT                   /db_xref="GOA:P64258"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64258"
FT                   /protein_id="BAB33514.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   AHLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LVGYGVIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNM
FT                   NFASYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   CDS_pept        101693..103009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="ECs_0092"
FT                   /product="UDP-N-acetylmuramoyl-L-alanine:D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33515"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33515"
FT                   /db_xref="GOA:Q8X9Y9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Y9"
FT                   /protein_id="BAB33515.1"
FT                   /translation="MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLD
FT                   KLPEAVERHTGSLNDEWLMAADLIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDDECELYVLELSSFQ
FT                   LETTSSLQAVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPIR
FT                   GADERCVSFGVNMGDYHLNHQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AAGLPRASSLKALTTFTGLPHRFEVVLEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLARYLNGDNVRLYCFGRDGVQLAALRPEVAEQTETMEQAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGNEFARLAKELG"
FT   CDS_pept        103009..104253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ECs_0093"
FT                   /product="lipid II flippase FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33516"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33516"
FT                   /db_xref="GOA:P0ABG6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABG6"
FT                   /protein_id="BAB33516.1"
FT                   /translation="MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYD
FT                   RTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPM
FT                   EFWQRYSATMLLGSIILLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANY
FT                   LVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDY
FT                   ETRLEKAQAFVRGSR"
FT   CDS_pept        104250..105317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ECs_0094"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33517"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33517"
FT                   /db_xref="GOA:Q8X9Y8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Y8"
FT                   /protein_id="BAB33517.1"
FT                   /translation="MSAQGKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRM
FT                   EADLVPKHGIEIDFIRISGLRGKGIKALIAAPLRIFNAWRQARAIMKAYKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAKLGDSVTIWHQSGKGS
FT                   QQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPF
FT                   QHKDRQQYWNALPLEKAGAAKIIEQPQLSVDAVANTLAGWSRETLLTMAERARAASIPD
FT                   ATERVANEVSRAARA"
FT   CDS_pept        105371..106846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ECs_0095"
FT                   /product="UDP-N-acetylmuramate:L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33518"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33518"
FT                   /db_xref="GOA:P65471"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65471"
FT                   /protein_id="BAB33518.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLMNLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHGRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYQGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQDKEP
FT                   MRVTLNAPGRHNALNAAAAVAVATEEGIDDEAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKSGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLT
FT                   QVDTLLMLEVYPAGEAPIPGADSRSLCRTIRGRGKIDPILVPDPAQVAEMLAPVLTGND
FT                   LILVQGAGNIGKIARSLAEIKLKPQTPEEEQHD"
FT   CDS_pept        106839..107759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="ECs_0096"
FT                   /product="D-alanine:D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33519"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33519"
FT                   /db_xref="GOA:Q8X9Y6"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9Y6"
FT                   /protein_id="BAB33519.1"
FT                   /translation="MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEV
FT                   DVTQLKSMGFQKVFIALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRVEFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENAL
FT                   QDALRLAFQHDEEVLIEKWLSGPEFTVAILGEEILPSVRIQPSGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEANLQALVLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   CDS_pept        107761..108591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ECs_0097"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33520"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33520"
FT                   /db_xref="GOA:Q8X9Y5"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="PDB:4V6M"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X9Y5"
FT                   /protein_id="BAB33520.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPDRTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ"
FT   CDS_pept        108588..109850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ECs_0098"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33521"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33521"
FT                   /db_xref="GOA:P0ABH2"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABH2"
FT                   /protein_id="BAB33521.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   CDS_pept        109911..111062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ECs_0099"
FT                   /product="GTP-binding tubulin-like cell division protein
FT                   FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33522"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33522"
FT                   /db_xref="GOA:P0A9A8"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9A8"
FT                   /protein_id="BAB33522.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQ
FT                   QHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD"
FT   CDS_pept        111163..112080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="ECs_0100"
FT                   /product="UDP-3-O-acyl N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33523"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33523"
FT                   /db_xref="GOA:P0A727"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A727"
FT                   /protein_id="BAB33523.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFKPYNGFSLDFTIDFNH
FT                   PAIDSSNQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEYVTFQDDAELPLAFKAPSAVLA"
FT   CDS_pept        112311..112823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secM"
FT                   /locus_tag="ECs_0101"
FT                   /product="SecA regulator SecM"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33524"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33524"
FT                   /db_xref="GOA:P62397"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62397"
FT                   /protein_id="BAB33524.2"
FT                   /translation="MSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALSNAAEPNAPAK
FT                   ATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPV
FT                   AEESLPLQAQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISQAQGIR
FT                   AGPQRLS"
FT   CDS_pept        112885..115590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="ECs_0102"
FT                   /product="preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33525"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33525"
FT                   /db_xref="GOA:Q8X996"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X996"
FT                   /protein_id="BAB33525.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKG
FT                   KTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVL
FT                   IEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTIS
FT                   IEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGG
FT                   SWQAEVAALENPTAEQIEKIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLQ"
FT   CDS_pept        115650..116048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="ECs_0103"
FT                   /product="dGTP-preferring nucleoside triphosphate
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33526"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33526"
FT                   /db_xref="GOA:Q8X994"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X994"
FT                   /protein_id="BAB33526.1"
FT                   /translation="MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGET
FT                   PEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVESWEGEPWGKEGQPGKW
FT                   MSLVGLNADDFPPANEPVIAKLKRVYVG"
FT   CDS_pept        complement(116139..116336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="ECs_0105"
FT                   /product="DNA gyrase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33528"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33528"
FT                   /db_xref="GOA:P0A8H9"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8H9"
FT                   /protein_id="BAB33528.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSESDDWSEEPKQ"
FT   CDS_pept        complement(116346..117089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zapD"
FT                   /locus_tag="ECs_0106"
FT                   /product="cell division protein ZapD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33529"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33529"
FT                   /db_xref="GOA:Q8X988"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X988"
FT                   /protein_id="BAB33529.1"
FT                   /translation="MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFR
FT                   NVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLIS
FT                   APRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDCQVETWIASLNP
FT                   LTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRF
FT                   AIRFMPLDTENGQVPERLDFELACC"
FT   CDS_pept        complement(117089..117709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ECs_0107"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33530"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33530"
FT                   /db_xref="GOA:P0A6J0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6J0"
FT                   /protein_id="BAB33530.1"
FT                   /translation="MRYIVALTGGIGSGKSTVANAFADLGINVIDADIIARQVVEPGAP
FT                   ALHAIADHFGANMIAADGTLQRRALRERIFANPEEKNWLNALLHPLIQQETQHQIQQAT
FT                   SPYVLWVVPLLVENSLYKKANRVLVVDVSPETQLKRTMQRDDVTREHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHAHYLQLASQFVSQEKP"
FT   CDS_pept        117934..118977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="ECs_0108"
FT                   /product="GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33531"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33531"
FT                   /db_xref="GOA:Q8X984"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X984"
FT                   /protein_id="BAB33531.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWS
FT                   GVPIIAANMDTVGTFSMASALASFDILTAVHKHYSVEEWQAFINNSSADVLKHVMVSTG
FT                   TSDADFEKTKQILDLNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIISDGGC
FT                   TTPGDVAKAFGGGADFVMLGGMLAGHEESGGRIVEENGEKFMLFYGMSSESAMKRHVGG
FT                   VAEYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNNL"
FT   CDS_pept        complement(119012..120214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="ECs_0110"
FT                   /product="assembly protein in type IV pilin biogenesis
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33533"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33533"
FT                   /db_xref="GOA:Q8X977"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X977"
FT                   /protein_id="BAB33533.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQRAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWGWLLVL
FT                   FGIMLTIANKLLMRRPTWLIARQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNAGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNIAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   CDS_pept        complement(120204..121589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="ECs_0111"
FT                   /product="type II secretion system protein HofB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33534"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33534"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X975"
FT                   /protein_id="BAB33534.1"
FT                   /translation="MNIPQLTALCLRYQGVLLDASEEVVHVAVVDAPSHELLDALHFAT
FT                   TKRIEITCWTRQQMEGHASRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEP
FT                   ADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGN
FT                   AVSFRIATLPCRGGEKVVLRLLQQVSQALDVNTLGMQPLQLAGFAHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQKLNTADINICSVEDPVEIPIAGLNQTQIHPRAGLTFQGVLRALL
FT                   RQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSS
FT                   ALTLVIAQRLVRKLCPHCRRQQGEPIHIPVNVWPSPLPHWQAPGCVHCYHGFYGRTALF
FT                   EVLPITPVIRQLISANTDVESLETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMP
FT                   HGE"
FT   CDS_pept        complement(121599..122039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="ECs_0112"
FT                   /product="prepilin peptidase-dependent pilin"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33535"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33535"
FT                   /db_xref="GOA:Q8X974"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="PDB:6GMS"
FT                   /db_xref="PDB:6GV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X974"
FT                   /protein_id="BAB33535.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWARNCNIQSDSALQQACEDVFRFDDAN"
FT   CDS_pept        complement(122242..123135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="ECs_0113"
FT                   /product="quinolinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33536"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33536"
FT                   /db_xref="GOA:Q8X973"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X973"
FT                   /protein_id="BAB33536.1"
FT                   /translation="MPPRRYNPDTRRDELLERINLDIPGAVAQALREDLGGTVDANNDI
FT                   TAKLLPENSRSHATVITRENGVFCGKRWVEEVFIQLAGDDVTIIWHVDDGDVINANQPL
FT                   FELEGPSRVLLTGERTALNFVQTLSGVASKVRHYVELLEGTNTQLLDTRKTLPGLRSAL
FT                   KYAVLCGGGANHRLGLSDAFLIKENHIIASGSVRQAVEKASWLHPDAPVEVEVENLEEL
FT                   DEALKAGADIIMLDNFETEQMREAVKRTNGKALLEVSGNVTDKTLREFAETGVDFISVG
FT                   ALTKHVQALDLSMRFR"
FT   CDS_pept        123223..123774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="ECs_0114"
FT                   /product="1,6-anhydro-N-acetylmuramyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33537"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33537"
FT                   /db_xref="GOA:Q8X971"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X971"
FT                   /protein_id="BAB33537.1"
FT                   /translation="MLLEQGWLVGARRVPSPHYDCRPDDETPTLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPQAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSQYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRALIDCYPDIANNMTGHCDIAPDRKT
FT                   DPGPAFDWARFRALVSKETT"
FT   CDS_pept        123771..124625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="ECs_0115"
FT                   /product="ampicillin resistance inner membrane protein
FT                   AmpE"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33538"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33538"
FT                   /db_xref="GOA:Q8X970"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X970"
FT                   /protein_id="BAB33538.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRALQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFRTSQYQVLTRLAQFSLAREPHVDKVETPKAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
FT   CDS_pept        complement(124668..126038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="ECs_0116"
FT                   /product="phenylalanine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33539"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33539"
FT                   /db_xref="GOA:Q8X968"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X968"
FT                   /protein_id="BAB33539.2"
FT                   /translation="MEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGP
FT                   GIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVL
FT                   VAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVTVFGEMEFWFAIIKVIAV
FT                   VAMIIFGGWLLFSGNGGPQASVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGIT
FT                   AAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDT
FT                   FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSA
FT                   LVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPAL
FT                   LYPLGNWICLLFMAVVLVIMLMTPGMAISVYLIPVWLVVLGIGYLFKEKTAKAVKAH"
FT   CDS_pept        126582..127346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="ECs_0117"
FT                   /product="pyruvate dehydrogenase complex repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33540"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33540"
FT                   /db_xref="GOA:P0ACM1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACM1"
FT                   /protein_id="BAB33540.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQYDLLETR
FT                   HALEGIAAYYAALRSTDEDKERIRELHHAIELAQQSGDLDAESNAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYSRREMLPLVSSHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEILLDRSREESRRERSLRRLEQRKN"
FT   CDS_pept        127507..130170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="ECs_0118"
FT                   /product="pyruvate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33541"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33541"
FT                   /db_xref="GOA:P0AFG9"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="PDB:3LPL"
FT                   /db_xref="PDB:3LQ2"
FT                   /db_xref="PDB:3LQ4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFG9"
FT                   /protein_id="BAB33541.1"
FT                   /translation="MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEAR
FT                   KGGVNVAAGTGISNYINTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQL
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEG
FT                   IFEGAGWNVIKVMWGSRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGD
FT                   AAEGKNIAHQVKKMNMDGVRHIRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQK
FT                   LHGYLPSRQPNFTEKLELPSLQDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   CSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPEGAEEGIRKGIYKLETIEGSKGKVQLLGSGSILRHVREAAEILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   IAKFNIDADKVNPRLA"
FT   CDS_pept        130185..132077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="ECs_0119"
FT                   /product="pyruvate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33542"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33542"
FT                   /db_xref="GOA:Q8X966"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="PDB:4N72"
FT                   /db_xref="PDB:4QOY"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X966"
FT                   /protein_id="BAB33542.1"
FT                   /translation="MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGIVKEIKVSVGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAVPEAAA
FT                   AKDVNVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   TGDKVSTGSLIMVFEVAGEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVT
FT                   EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVE
FT                   GAAPAAAPAKQEAAAPAPAAKAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREF
FT                   GVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGE
FT                   IEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKIT
FT                   PVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKK
FT                   GIIELSRELMTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVS
FT                   KSAMEPVWNGKEFVPRLMLPISLSFDHRVIDGADGARFITIINNTLSDIRRLVM"
FT   CDS_pept        132285..133709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="ECs_0120"
FT                   /product="dihydrolipoyl dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33543"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33543"
FT                   /db_xref="GOA:P0A9P2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9P2"
FT                   /protein_id="BAB33543.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVINQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRIW
FT                   DSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNPKAKKK"
FT   CDS_pept        complement(133780..135633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="ECs_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33544"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33544"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X959"
FT                   /protein_id="BAB33544.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASAGLYIKSRTVEAPVETQSTQL
FT                   AVSDAAAVTLPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPT
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKTVPVTQTVTAPVIPSNTVST
FT                   ANPVITEPATTVISIEPGNPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDNYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAASQFQQRTHAAPVITRDTQRQAAAQRFNEAEHYGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVHEKMQTNPQNQQRREAARERIQPASPEQRQAVREKMQTN
FT                   PQIQQRRDAARERIQSASPEQRQVFKEKVQQRPLNQQQRDNARQRVQSASPEQRQVFRE
FT                   KVQESRPQRLNDSNHTARLNNEQRSAVRERLSERGARRLER"
FT   CDS_pept        135988..138585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="ECs_0122"
FT                   /product="bifunctional aconitate hydratase
FT                   2/2-methylisocitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33545"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33545"
FT                   /db_xref="GOA:Q8X957"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X957"
FT                   /protein_id="BAB33545.1"
FT                   /translation="MLEEYRKHVAERAAEGIAPKPLDANQMAALVELLKNPPAGEEEFL
FT                   LDLLTNRVPPGVDEAAYVKAGFLAAVAKGEAKSPLLTPEKAIELLGTMQGGYNIHPLID
FT                   ALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLNRPALA
FT                   EKLTVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPDQPGVVGPIKQ
FT                   IEALQQKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPHVPNKRGGGLCLGGKIAPI
FT                   FFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVR
FT                   AGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESDRGFSLAQKMVGRACGVKGIR
FT                   PGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVNTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
FT                   RILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLNSNIVLLKWMIAEGY
FT                   GDRRTLERRIQGMEKWLANPELLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARPL
FT                   SAVQGEKIDEVFIGSCMTNIGHFRAAGKLLDAHKGQLPTRLWVAPPTRMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAA
FT                   VAALIGKLPTPEEYQTYVAQVDKTAVDTYRYLNFNQLSQYTEKADGVIFQTAV"
FT   CDS_pept        138761..139123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="ECs_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33546"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33546"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8E6"
FT                   /protein_id="BAB33546.2"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQA
FT                   AHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
FT   CDS_pept        complement(139161..139955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="ECs_0124"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33547"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33547"
FT                   /db_xref="GOA:P0A7F7"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7F7"
FT                   /protein_id="BAB33547.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV"
FT   CDS_pept        complement(139971..140837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="ECs_0125"
FT                   /product="spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33548"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33548"
FT                   /db_xref="GOA:P66834"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66834"
FT                   /protein_id="BAB33548.1"
FT                   /translation="MAEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSTEIIQARFLASGLKCRYYNPAVHTAAFALPQYLQD
FT                   ALASQPS"
FT   CDS_pept        complement(140943..141251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="ECs_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33549"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33549"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X949"
FT                   /protein_id="BAB33549.2"
FT                   /translation="MAVCANSYALSESEAEDMADLTAVFVFLKNDCGYQNLPNGQIRRA
FT                   LVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALARDSLSLLAYVK"
FT   CDS_pept        141456..143006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="ECs_0127"
FT                   /product="multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33550"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33550"
FT                   /db_xref="GOA:Q8X947"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X947"
FT                   /protein_id="BAB33550.1"
FT                   /translation="MQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDAR
FT                   NRIQLTIGAGQSTFGEKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHG
FT                   LEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIE
FT                   DDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYP
FT                   QHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVNELPVLMGERF
FT                   EVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPAL
FT                   PSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMVGMDHSQMMGHMGHGNMNHMNHG
FT                   GKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSEN
FT                   GKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKERAYMAHCHLLEHEDTGMMLGFTV"
FT   CDS_pept        complement(143208..145598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="ECs_0128"
FT                   /product="glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33551"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33551"
FT                   /db_xref="GOA:Q8X946"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X946"
FT                   /protein_id="BAB33551.1"
FT                   /translation="MAINNTGSRRLLVTLTALFAALCGLYLLIGGGWLVAIGGSWYYPI
FT                   AGLVMLGVAWMLWRSKRAALWLYAALLLGTMIWGVWEVGFDFWALTPRSDILVFFGIWL
FT                   ILPFVWRRLVIPASGAVAALVVALLISGSILTWAGFNDPQEINGTLSADATPAEAISPV
FT                   ADQDWPAYGRNQEGQRFSPLKQINADNVHNLKEAWVFRTGDVKQPNDPGEITNEVTPIK
FT                   VGDTLYLCTAHQRLFALDAASGKEKWHYDPELKTNESFQHVTCRGVSYHEAKAETASPE
FT                   VMADCPRRIILPVNDGRLIAINAENGKLCETFANKGVLNLQSNMPDTKPGLYEPTSPPI
FT                   ITDKTIVMAGSVTDNFSTRETSGVIRGFDVNTGELLWAFDPGAKDPNAIPSDEHTFTFN
FT                   SPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATTGKLAWSYQ
FT                   TVHHDLWDMDLPAQPTLADITVNGQKVPVIYAPAKTGNIFVLDRRNGELVVPAPEKPVP
FT                   QGAAKGDYVTPTQPFSELSFRPTKDLSGADMWGATMFDQLVCRVMFHQMRYEGIFTPPS
FT                   EQGTLVFPGNLGMFEWGGISVDPNREVAIANPMALPFVSKLIPRGPGNPMEQPKDAKGT
FT                   GTESGIQPQYGVPYGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEVVWKKRIGTPQDS
FT                   MPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQGRLPAGG
FT                   QATPMTYEVNGKQYVVISAGGHGSFGTKMGDYIVAYALPDDVK"
FT   CDS_pept        145804..146340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="ECs_0129"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33552"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33552"
FT                   /db_xref="GOA:Q8X945"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X945"
FT                   /protein_id="BAB33552.2"
FT                   /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVGLLRGS
FT                   FMFMADLCREVQVSHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDS
FT                   GNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQR
FT                   YRHLPYIGKVILLDE"
FT   CDS_pept        complement(146381..147043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="can"
FT                   /locus_tag="ECs_0130"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33553"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33553"
FT                   /db_xref="GOA:Q8X938"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X938"
FT                   /protein_id="BAB33553.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGV
FT                   QAAVENPELGLINNWLLHIRDIWFKHSSLLDEMPQERRLDTLCELNVMEQVYNLGHSTI
FT                   MQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK"
FT   CDS_pept        147152..148078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="ECs_0131"
FT                   /product="ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33554"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33554"
FT                   /db_xref="GOA:Q8X4V8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4V8"
FT                   /protein_id="BAB33554.1"
FT                   /translation="MTIALELQQLKKNYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKA
FT                   LLAKLKSETFILDLAPKSPLPKLDGYQYRLVDTATLEVEVLREQGINSVFTQLSEQGIQ
FT                   VLSMRNKANRLEELFVSLVNEKQGDRA"
FT   CDS_pept        148075..148845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="ECs_0132"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33555"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33555"
FT                   /db_xref="GOA:P0AFN8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFN8"
FT                   /protein_id="BAB33555.1"
FT                   /translation="MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHV
FT                   IIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVF
FT                   AKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIN
FT                   DVPLVTTFGVLVVFIVAFYLICWSLIQRGRGLRS"
FT   CDS_pept        148950..149390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECs_0133"
FT                   /product="PTS Enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33556"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33556"
FT                   /db_xref="GOA:Q8X935"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X935"
FT                   /protein_id="BAB33556.1"
FT                   /translation="MLGWVITCHDDRAQEILDVLEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGAPEVSSIWHQQQKNPPFVLKHNLYEY"
FT   CDS_pept        149454..150683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="ECs_0134"
FT                   /product="polysaccharide deacetylase lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33557"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33557"
FT                   /db_xref="GOA:Q8X933"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X933"
FT                   /protein_id="BAB33557.1"
FT                   /translation="MYKQAVILLLMLFTASVSAALPARYMQTIENAAVWAQIGDKMVTV
FT                   GNIRAGQIIAVEPTAASYYAFNFGFDKGFIDKGHLEPVQGRQKVEDGLGDLNKPLSNQN
FT                   LVTWKDTPVYNAPSVGSAPFGVLADNLRYPILHKLKDRLNQTWYQIRIGDRLAYISALD
FT                   AQPDNGLPVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMVQLEGY
FT                   VKNKINLPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFIVTSRIKRHPQKWEPKSL
FT                   QFMSVSELNEIRDVFDFQSHTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAQFNP
FT                   HVWYLSYPFGGFNDKAVKAANDAGFHLAVTTMKGKVKPGDNPLLLKRLYILRTDSLETM
FT                   SRLVSNQPQG"
FT   CDS_pept        complement(150687..151067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="ECs_0135"
FT                   /product="aspartate 1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33558"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33558"
FT                   /db_xref="GOA:P0A792"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A792"
FT                   /protein_id="BAB33558.1"
FT                   /translation="MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPN
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   CDS_pept        151341..152237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="ECs_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33559"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33559"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X932"
FT                   /protein_id="BAB33559.1"
FT                   /translation="MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLH
FT                   LESGSFIEESLKGHSTDVLYSVQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHR
FT                   HLEADHDKLPLVVPILFYQGEATPYPLSMCWFDMFYSPELARRVYNSPFPLVDITITPD
FT                   DEIMQHRRIAILELLQKHIRQRDLMLLLEQLVTLIDEGYTSESQLVAMQNYMLQRGHTE
FT                   QADLFYGVLRDRETGGKSMMTLAQWFEEKGIEKGIQQGRQEERQEFAQRFLSKGMSRED
FT                   VAEMTNLSLAEIDRLIN"
FT   CDS_pept        complement(152536..153387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="ECs_0137"
FT                   /product="pantothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33560"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33560"
FT                   /db_xref="GOA:Q8X930"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X930"
FT                   /protein_id="BAB33560.1"
FT                   /translation="MLIIETLPLLRQQIRRLRMEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPNGTE
FT                   THTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMV
FT                   ADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKVLSSIADKLQAGERDL
FT                   DEIIAIAGQELNEKGFRADDIQIRDADTLLEVSETSKRAVILVAAWLGDARLIDNKMVE
FT                   LA"
FT   CDS_pept        complement(153399..154193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="ECs_0138"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33561"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33561"
FT                   /db_xref="GOA:Q8X929"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X929"
FT                   /protein_id="BAB33561.1"
FT                   /translation="MKPTTIASLQKCKQEKKRFATITAYDYSFAKLFAEEGLNVMLVGD
FT                   SLGMTVQGHESTLPVTVEDIAYHTTAVRRGAPNCLLLADLPFMAYATPEQAFENAATVM
FT                   RAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEASDRL
FT                   LSDALALEAAGAQLLVLECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGIT
FT                   GGHIPKFAKNFLAETGDIRAAVRQYMAEVESGVYPGEEHSFH"
FT   CDS_pept        complement(154328..155437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="ECs_0139"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33562"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33562"
FT                   /db_xref="GOA:Q8X928"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR017014"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X928"
FT                   /protein_id="BAB33562.1"
FT                   /translation="MQRKGNKLLIQLCSVILLFFTTSWYALANECYIERNAEGDYHMKI
FT                   SSTQLSLASQMVEVPTEIAEATWDVNIQLRGDAIGCKSLGDSKAVHFLNTADPSLISTY
FT                   TTTNGAALLKTTVPGIVYSVELLCLSCGAADELDLWLPAQSGADNFIPSTQTKWAYEYS
FT                   DQSWYLRFRLFITPEFKPKNGVSSGTTIAGKIASWYIGTNDQPWINFYIDNDSLKFFVD
FT                   EPTCATVALAQDQGNVSGNQVTLGNSYVSEVKNGLTREIPFSIRAEYCYASKITVKLKA
FT                   ANKPSDATLVGKTTGSASGVAVKVNSTYDNSKVLLKADGSNTVDYNFAAWSNNLLFLPF
FT                   TAQLVPDGSGNAVGVGTFSGNATFSFTYE"
FT   CDS_pept        complement(155449..156039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="ECs_0140"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33563"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33563"
FT                   /db_xref="GOA:Q8X920"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X920"
FT                   /protein_id="BAB33563.1"
FT                   /translation="MLCRHHKIVHFLGLATALITPFAYSGQDVDLTAKIVPSTCQVEVS
FT                   NNGVVDLGTVTLDYFADNVTPTTDYAGGKTFNVNVVSCDNIQTTQSQMKLDFQPQAGSL
FT                   AQANNQIFSNEYEQQATGAKNVGIVIFSAQPNQQTFNVRGTDGSSTAIYSVAPGNAVPS
FT                   TWTFYSRMQRVNNALPPESGMVRSQVIVNVSYE"
FT   CDS_pept        complement(156060..156665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="ECs_0141"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33564"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33564"
FT                   /db_xref="GOA:Q8X919"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X919"
FT                   /protein_id="BAB33564.1"
FT                   /translation="MKLKVIATLIATVAVGVSFNSNFASASTTSASLTVNSNLTMGTCS
FT                   AQIMDNSNKVINEVVFGNVYISELGAKSKVQQFKIRFSNCSGLPQNSAQIVLAPNGISC
FT                   AGSQSSSAGFSNKFTDASAATRTAVEVWTTDTPESNGSTQFHCAQKIPVPVTLPADTTT
FT                   QPYDYPLSARMTVAEGRLVTDVRPGNFRSPTTFTITYQ"
FT   CDS_pept        complement(156680..157228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadM"
FT                   /locus_tag="ECs_0142"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33565"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33565"
FT                   /db_xref="GOA:Q8X918"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X918"
FT                   /protein_id="BAB33565.2"
FT                   /translation="MKRILLTSALIGLGLPAVGSATDLNVDFTATVLATTCTITIVEDG
FT                   GPAVTGSNDEYSLTIPDVGLDKVATAAPEAQANFKLKASDCSNGYSKIFTTLTGTTVSG
FT                   KLIVNEATSGAAGVGMGIKRRDTADSTFFTPNNTDKFEWSADEKASGVPLTVALRETTA
FT                   GAGRTGAFQAKATFNFTYE"
FT   CDS_pept        complement(157242..159842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="ECs_0143"
FT                   /product="outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33566"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33566"
FT                   /db_xref="GOA:A0A0H3JFB9"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFB9"
FT                   /protein_id="BAB33566.1"
FT                   /translation="MYQFTHQKSRIPKKTLLAACCALFYSSNGAAADTVEYDSSFLMGT
FT                   GASTIDVKRYAQGNPTPPGLYNVRVFVNGQATSSLEIPFVDIGENSAAACLTHKNLAQL
FT                   HIKQPEQPVTLLAREGEEEDCLDLAKSYEKADVCFDGSDQFLDLTIPQAYVLKSYGGYV
FT                   DPSLWESGINAATLAYTLNAYHTSSDNDNSDSVYGAFNSGINLGAWHFRARGNYNWTTD
FT                   NGSDFDFQDRYLQRDIPAIRSQIIMGDAYTTGETFDSVNVRGVRLYSDSRMLPSALASY
FT                   APTIRGVANSNAKVTVTQSGYKIYETTVPPGEFVIDDISPSGFGSELVVTIEEADGSKR
FT                   TFTQPFSSVVQMQRPGVGRWDFSAGKVIDDSLRSEPNMGQASYYYGLNNLFTGYTGIQF
FT                   TDNNYLAGLLGVGINTSIGAFAVDVTHSRAEIPDDKTYQGQSYRVTWNKLFQDTGTSFN
FT                   LAAYRYSTQDYLGLHDALVLIDDAKHLSADEDKNTMQTYSRMKNQFTVSINQPLNIAYE
FT                   DYGSLFISGSWTYYWAANNSRTEYNVGYSKSVSWGSFSVNLQRSWNEDGEKDDAMYVSV
FT                   SVPIENILGGKRKSSGFRNLNTQLNTDFDGSHQLNVNSSGNTENNLVNYSVNAGYSLDK
FT                   NAGDLASVGGYLNYESGLGGISASASATSDNSQQYSISTDGGFVLHSGGLTFTNNSFSS
FT                   NDTLVLINALGAKGARINNSNNEIDRWGYAVTSSVSPYRENRVGLNIETLENDVELKST
FT                   SATTVPRSGSVVLTRFETDEGRSAVLNITAANGKSIPFAAEVYQGEVMIGSMGQGGQAF
FT                   VRGINDSGELIVRWYENNQTIDCKLHYQFPAQPQTQGSTNTLLLNNLTCQVANH"
FT   CDS_pept        complement(159884..160609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadV"
FT                   /locus_tag="ECs_0144"
FT                   /product="periplasmic pilin chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33567"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33567"
FT                   /db_xref="GOA:A0A152UP93"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UP93"
FT                   /protein_id="BAB33567.1"
FT                   /translation="MFPLVKKTVSALFVSTLLASAPAFADIIISGTRIIYNADKKDVNV
FT                   RLENKGNRPLLIQNWLDTGDDNADPSQIKVPFTATPPVSRVEPKRGQTVKVMYTGATAL
FT                   PKDRESVYWFNVLEVPPKPKDAEADKNLLQLAFRTRIKLFYRPSGLQGEPAEAPAKITW
FT                   KLNNAQLQANNPTPYYVSFNEVKLESGGKTYNVNSSMVTPFSQASFGVTSLPGSVSSGK
FT                   VVFKAINDFGGNIDGSATF"
FT   CDS_pept        complement(160696..161292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="ECs_0145"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33568"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33568"
FT                   /db_xref="GOA:A0A0H3JBS4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBS4"
FT                   /protein_id="BAB33568.1"
FT                   /translation="MKKALLAAALVMASGSALAVDGGHIDFNGMVQSGTCKVGVVDTGM
FT                   HSVTTDGVVTLDTANVTDTFAEVSATAVGLLPKEFMISVECDPGAPKNAELTMGSASYA
FT                   NTSGTLNNNMNITVNGIAPAQNVNIAVHNMKNKAGAAEIKQVHMNNSSEVQELTLDAEG
FT                   KGQYVFNASYVKAPNSPAVTAGHVTTNALYTVAYK"
FT   CDS_pept        complement(161573..162055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="ECs_0146"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihyropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33569"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33569"
FT                   /db_xref="GOA:Q8X911"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X911"
FT                   /protein_id="BAB33569.1"
FT                   /translation="MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPP
FT                   LGPQDQPDYLNAAVALETTLAPEELLNHTQQIELQQGRVRKAERWGPRTLDLDIMLFGN
FT                   ETINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGETLREILTSLAVLQPAIWY"
FT   CDS_pept        complement(162052..163449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="ECs_0147"
FT                   /product="poly(A) polymerase"
FT                   /note="ATT start"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33570"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33570"
FT                   /db_xref="GOA:P0ABF3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABF3"
FT                   /protein_id="BAB33570.2"
FT                   /translation="MFTRVANFCRKVLSREESEAEQAVARPQVTVIPREQHAISRKDIS
FT                   ENALKVMYRLNKAGYEAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGR
FT                   RFRLAHVMFGPEIIEVATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDF
FT                   TINSLYYSVADFTVRDYVGGMKDLKDGVIRLIGNPETRYREDPVRMLRAVRFAAKLGMR
FT                   ISPETAEPIPRLATLLNDIPPARLFEESLKLLQAGYGYETYKLLCEYHLFQPLFPTITR
FT                   YFTENGDSPMERIIEQVLKNTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLT
FT                   YHDAFALAMNDVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRA
FT                   AYDLLALRAEVERNAELQRLVKWWGEFQVSAPPDQKGMLNELDEEPSPRRRTRRPRKRA
FT                   PRREGTA"
FT   CDS_pept        complement(163509..164435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluQ"
FT                   /locus_tag="ECs_0148"
FT                   /product="glutamyl-Q tRNA(Asp) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33571"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33571"
FT                   /db_xref="GOA:Q8X909"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X909"
FT                   /protein_id="BAB33571.1"
FT                   /translation="MLPPYFLFKEMTDTQYIGRFAPSPSGELHFGSLIAALGSYLQARA
FT                   RHGRWLVRIEDIDPPREVPGAAETILRQLEHYGLHWDGDVLWQSQRHHAYREALAWLHE
FT                   QGLSYYCTCTRARIQSIGGIYDGHCRVLHHGPDNAAVRIRQQHPVTQFTDQLRGIIHAD
FT                   EKLAREDFIIHRRDGLFAYNLAVVVDDHFQGVSEIVRGADLIEPTVRQISLYQLFGWKV
FT                   PDYIHLPLALNPQGAKLSKQNHAPALPKGDPRPVLIAALQFLGQQAEAHWQDFSVEQIL
FT                   QSAVKNWRLTAVPESAIVNSTFSNASC"
FT   CDS_pept        complement(164472..164927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="ECs_0149"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33572"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33572"
FT                   /db_xref="GOA:P0ABS3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABS3"
FT                   /protein_id="BAB33572.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   CDS_pept        complement(165105..165809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="ECs_0150"
FT                   /product="sugar fermentation stimulation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33573"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33573"
FT                   /db_xref="GOA:P0A824"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A824"
FT                   /protein_id="BAB33573.1"
FT                   /translation="MEFSPPLQRATLIQRYKRFLADVITPDGRELTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSDNTKRKYPHTWELTQSQSGAFICVNTLWANRLTKEAILNESISELSGY
FT                   SSLKSEVKYGAERSRIDFMLQADSRPDCYIEVKSVTLAENEQGYFPDAVTERGQKHLRE
FT                   LMSVAAEGQRAVIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAE
FT                   GMALKKSLPVTL"
FT   CDS_pept        complement(165824..166354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="ECs_0151"
FT                   /product="2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33574"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33574"
FT                   /db_xref="GOA:Q8X906"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X906"
FT                   /protein_id="BAB33574.2"
FT                   /translation="MSDPQRLFFAIDLPAEIREQIIHWRATHFPLEAGRPVAADNLHLT
FT                   LAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQLAN
FT                   MLRSQAARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARGR
FT                   TRYTPLKRWVLTQ"
FT   CDS_pept        166428..168857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="ECs_0152"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33575"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33575"
FT                   /db_xref="GOA:Q8X904"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X904"
FT                   /protein_id="BAB33575.2"
FT                   /translation="MSSLPVAAVLPELLTALDYAPQVLLSAPTGAGKSTWLPLQLLAHP
FT                   GINGKIILLEPRRLAARNVAQRLAELLNEKPGDTVGYRMRAQNCVGPNTRLEVVTEGVL
FT                   TRMIQRDPELSGVGLVILDEFHERSLQADLALALLLDVQQGLRDDLKLLIMSATLDNDR
FT                   LQQMLPEAPVVISEGRSFPVERRYLPLPTHQRFDDAVAVATAEMLRQESGSLLLFLPGV
FT                   GEIQRVQEQLASRIGSDVLLCPLYGALSLNDQRKAILPAPQGMRKVVLATNIAETSLTI
FT                   EGIRLVVDCAQERVARFDPRTGLTRLITQRISQASMTQRAGRAGRLEPGICLHLIAKEQ
FT                   AERATAQSEPEILQSDLSGLLMELLQWGCSDPAQMSWLDQPPTVNLLAAKRLLQMLGAL
FT                   DGERLSAQGQKMAALGNDPRLAAMLVSAKSDDEAATAAKIAAILEEPPRMGNSDLGVAF
FT                   SRNQPAWQQRSQQLLKRLNVRGGEADSSLIAPLLAGAFADRIARRRGQDGRYQLANGMG
FT                   AMLDADDALSRHEWLIAPLLLQGSASPDARILLALPVDIDELVQRCPQLVQQSDTVEWD
FT                   DAQGTLKAWRRLQIGQLTVKVQPLAKPSEDELHQAMLNGIRDKGLSVLNWTAEAEQLRL
FT                   RLLCAGKWLPEYDWPAVDDESLLATLETWLLPHMAGVHSLRGLKSLDIYQALRGLLDWG
FT                   MQQRLDSELPAHYTVPTGSRIAIRYHEDNPPALAVRMQEMFGEATNPTIAQGRVPLVLE
FT                   LLSPAQRPLQITRDLGAFWKGAYREVQKEMKGRYPKHVWPDDPANTAPTRRTKKYS"
FT   CDS_pept        169053..171587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="ECs_0153"
FT                   /product="penicillin-binding protein 1B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33576"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33576"
FT                   /db_xref="GOA:Q8X903"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X903"
FT                   /protein_id="BAB33576.1"
FT                   /translation="MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEP
FT                   MPRKGKGKGKGRKPRGKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPA
FT                   AVYGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPD
FT                   SKEGQVRARLTFDGDHLATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFP
FT                   DLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
FT                   RSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVE
FT                   ELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPL
FT                   GVQPRGGVISPQPAFMQLVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGI
FT                   PALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATY
FT                   LTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVP
FT                   TVNLGMALGLPAVTDTWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRA
FT                   PLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLH
FT                   LAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPT
FT                   PLNLVPPEDIADMGVDYDGNFVCSGGMRVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSS
FT                   QPQQQPQQQPAQQEQKDSDGVAGWIKDMFGSN"
FT   CDS_pept        171807..174050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="ECs_0154"
FT                   /product="ferrichrome outer membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33577"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33577"
FT                   /db_xref="GOA:Q8X901"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X901"
FT                   /protein_id="BAB33577.1"
FT                   /translation="MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVELKEDTITVT
FT                   AAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALS
FT                   YTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAE
FT                   IMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDALDDDGV
FT                   YSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKT
FT                   SQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFA
FT                   TGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLDLYNPVNTDFDFNAKDPANSGPYRI
FT                   LNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNY
FT                   LFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNL
FT                   TKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYK
FT                   GNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDAL
FT                   VRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF"
FT   CDS_pept        174101..174898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="ECs_0155"
FT                   /product="iron(3+)-hydroxamate import ABC transporter
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33578"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33578"
FT                   /db_xref="GOA:Q8X8Z9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8Z9"
FT                   /protein_id="BAB33578.1"
FT                   /translation="MQEYTNHSDTTFALRNISFRVPGRTLLHPLSLTFPAGKVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRE
FT                   LVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQERGLTVIAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAEIMRGETLEMIYGIPMGILPHPAGAAPVSFVY"
FT   CDS_pept        174898..175788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECs_0156"
FT                   /product="iron(3+)-hydroxamate import ABC transporter
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33579"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33579"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8Z7"
FT                   /protein_id="BAB33579.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPESVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIR
FT                   SMNPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
FT   CDS_pept        175785..177767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="ECs_0157"
FT                   /product="iron(3+)-hydroxamate import ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33580"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33580"
FT                   /db_xref="GOA:Q8X8Z5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8Z5"
FT                   /protein_id="BAB33580.1"
FT                   /translation="MSKRIALFPALLLALLVIAATALTWMNFSQALPRSQWAQAAWSPD
FT                   IDVIEQMIFHYSLLPRLAISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGIT
FT                   VTTLWAIPGAMASQFAALAGACVVGLIVFGVAWGKRLSPVTLILAGLVVSLYCGAINQL
FT                   LVIFHHDQLQSMFLWSTGTLTQTDWGGVERLWPQLLGGVMLTLLLLRPLTLMGLDDGVA
FT                   RNLGLALSLARLAALSLAIVISALLVNAVGIIGFIGLFAPLLAKMLGARRLLPRLMLAS
FT                   LIGALILWLSDQIILWLTRVWMEVSTGSVTALIGAPLLLWLLPRLRSISAPDMKVNDRV
FT                   AAERQHVLAFALAGGVLLLMAVVVALSFGRDAHGWTWASGALLEDLMPWRWPRIMAALF
FT                   AGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGNAFGWLLPAGSIGA
FT                   AVTLLIIMIAAGRGGFSPHRMLLAGMALSTAFTMLLMMLQASGDPRMAQVLTWISGSTY
FT                   NATDAQVWRTGIVMVILLAITPLCRRWLTILPLGGDTARAVGVALTPTRIALLLLAACL
FT                   TATATMTIGPLSFVGLMAPHIARMMGFRRTMPHIVISALVGGLLLVFADWCGRMVLFPF
FT                   QIPAGLLSTFIGAPYFIYLLRKQSR"
FT   CDS_pept        complement(177802..179082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="ECs_0158"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33581"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33581"
FT                   /db_xref="GOA:Q8X4V5"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X4V5"
FT                   /protein_id="BAB33581.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPDFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVEPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGVHETLDELTTRLAEGLLEAAE
FT                   EAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFE
FT                   AGFMSVAHSMEDINNTIDAARRVFAKL"
FT   CDS_pept        179307..180728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcA"
FT                   /locus_tag="ECs_0159"
FT                   /product="H(+)/Cl(-) exchange transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33582"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33582"
FT                   /db_xref="GOA:P58244"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58244"
FT                   /protein_id="BAB33582.1"
FT                   /translation="MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTL
FT                   VGLAAVAFDKGVAWLQNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEA
FT                   GGSGIPEIEGALEDQRPVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVL
FT                   DVFRLKGDEARHTLLATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGV
FT                   IMSTIMYRIFNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLH
FT                   RVHGGNITKWVLMGGAIGGLCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVAR
FT                   VITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLA
FT                   ASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEA
FT                   EQLARSKAASASENT"
FT   CDS_pept        180810..181154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="erpA"
FT                   /locus_tag="ECs_0160"
FT                   /product="iron-sulfur cluster insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33583"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33583"
FT                   /db_xref="GOA:P0ACC5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACC5"
FT                   /protein_id="BAB33583.1"
FT                   /translation="MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
FT   CDS_pept        complement(181201..181824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="ECs_0161"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33584"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33584"
FT                   /db_xref="GOA:Q8X8Z1"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8Z1"
FT                   /protein_id="BAB33584.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRHLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
FT   CDS_pept        complement(181862..182662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="ECs_0162"
FT                   /product="vitamin B12 ABC transporter periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33585"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33585"
FT                   /db_xref="GOA:Q8X8Z0"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Z0"
FT                   /protein_id="BAB33585.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATNIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFG
FT                   INPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIP
FT                   KIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD"
FT   CDS_pept        complement(182655..183353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtn"
FT                   /locus_tag="ECs_0163"
FT                   /product="5'-methylthioadenosine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33586"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33586"
FT                   /db_xref="GOA:P0AF14"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="PDB:3DF9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AF14"
FT                   /protein_id="BAB33586.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV
FT                   ESLVQKLAHG"
FT   CDS_pept        183437..184954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="ECs_0164"
FT                   /product="deoxyguanosine triphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33587"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33587"
FT                   /db_xref="GOA:Q8X8Y9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Y9"
FT                   /protein_id="BAB33587.1"
FT                   /translation="MAQIDFRKKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAI
FT                   RRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTG
FT                   PFESIVEMSCLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAVLRLR
FT                   DGEEPLNELRRKIRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWWRGET
FT                   PETHHYLMKKPGYYLSEEAYIARLRKELNLALYSRFPLTWIMEAADDISYCVADLEDAV
FT                   EKRIFTVEQLYHHLHEAWGQHEKGSLFSLVVENAWEKSRSNSLSRSTEDQFFMYLRVNT
FT                   LNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKLYKNVAVKHVFSHPDVEQL
FT                   ELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRSPIESRLFHKLSTRHRLAYVEA
FT                   VSKLPSDSPEFPLWEYYYRCRLLQDYISGMTDLYAWDEYRRLMAVEQ"
FT   CDS_pept        185084..186508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="ECs_0165"
FT                   /product="serine endoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33588"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33588"
FT                   /db_xref="GOA:P0C0V1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0V1"
FT                   /protein_id="BAB33588.1"
FT                   /translation="MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPML
FT                   EKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGG
FT                   GQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIA
FT                   LIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYE
FT                   NFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMV
FT                   EYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLN
FT                   GKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEG
FT                   AEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVL
FT                   ALNIQRGDSTIYLLMQ"
FT   CDS_pept        186663..187820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="ECs_0166"
FT                   /product="carbohydrate diacid regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33589"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33589"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBS6"
FT                   /protein_id="BAB33589.1"
FT                   /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIG
FT                   ELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPENLRKY
FT                   GELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLGIDLNQP
FT                   RVVAIVEVDSGQLGVDSAMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPALNSFGRW
FT                   DVEDHRKRVEQLITRMKEYGQLRFRVSLGNYFTGPGSIARSYRTAKTTMVVGKQRMPES
FT                   RCYFYQDLMLPVLLDSLRGDWQANELARPLARLKAMDNNGLLRRTLAAWFRHNVQPLAT
FT                   SKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEER"
FT   CDS_pept        complement(187909..188295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="ECs_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33590"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33590"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62769"
FT                   /protein_id="BAB33590.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
FT   CDS_pept        complement(188610..189434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="ECs_0168"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33591"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33591"
FT                   /db_xref="GOA:Q8X8Y7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="PDB:3BXY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Y7"
FT                   /protein_id="BAB33591.1"
FT                   /translation="MQQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGDI
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   CDS_pept        complement(189465..192137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="ECs_0169"
FT                   /product="uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33592"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33592"
FT                   /db_xref="GOA:Q8X8Y6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Y6"
FT                   /protein_id="BAB33592.1"
FT                   /translation="MNTLPEQYANTALPTLPGQPQNPCVWPRDELTVGGIKAHIDTFQR
FT                   WLGDAFDNGISAEQLIEARTEFIDQLLQRLWIEAGFSQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATNLI
FT                   ESRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPIDDEFQLRGTLIDLRDETLFMRQPEAILRMFYTMVRNSAITGIYSTTLRQ
FT                   LRHARRHLQQPLCNIPQARKLFLSILRHPGAVRRGLLPMHRHSVLGAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFASEETRQRHPLCVNVWPRLPSTELIFIAALFHDIA
FT                   KGRGGDHSILGAQDVVHFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTENRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEEVLHQIWSRCRANYFVRHSPNQLAWHARHLLQHDLSK
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLSADRHEVIRFGLEQVLTQSSWQPPQPRRQPAKLRHFTVETEVTFLPTHTD
FT                   RKSFLELIALDQPGLLARVGKIFADLGISLHGARITTIGERVEDLFIIATADRRALNNE
FT                   LQQEVHQRLTEALNPNDKG"
FT   CDS_pept        complement(192199..192993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="ECs_0170"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33593"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33593"
FT                   /db_xref="GOA:P0AE20"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AE20"
FT                   /protein_id="BAB33593.1"
FT                   /translation="MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRIC
FT                   NDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDG
FT                   FHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE"
FT   CDS_pept        193361..194086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="ECs_0171"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33594"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33594"
FT                   /db_xref="GOA:P0A7V2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7V2"
FT                   /protein_id="BAB33594.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
FT   CDS_pept        194344..195195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="ECs_0172"
FT                   /product="translation elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33595"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33595"
FT                   /db_xref="GOA:P0A6P3"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6P3"
FT                   /protein_id="BAB33595.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   CDS_pept        195342..196067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="ECs_0173"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33596"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33596"
FT                   /db_xref="GOA:P0A7F1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7F1"
FT                   /protein_id="BAB33596.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   CDS_pept        196217..196774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="ECs_0174"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33597"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33597"
FT                   /db_xref="GOA:P0A807"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A807"
FT                   /protein_id="BAB33597.1"
FT                   /translation="MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKL
FT                   TDAAIKKIEAALADKEAELMQF"
FT   CDS_pept        196866..198062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="ECs_0175"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33598"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33598"
FT                   /db_xref="GOA:Q8X8Y1"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Y1"
FT                   /protein_id="BAB33598.1"
FT                   /translation="MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQ
FT                   CLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGA
FT                   AGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQP
FT                   IQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIA
FT                   HTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANE
FT                   ITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDASAREVARKEVMRLAS"
FT   CDS_pept        198251..199009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispU"
FT                   /locus_tag="ECs_0176"
FT                   /product="undecaprenyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33599"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33599"
FT                   /db_xref="GOA:P60474"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60474"
FT                   /protein_id="BAB33599.2"
FT                   /translation="MLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAG
FT                   AKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNV
FT                   RLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQ
FT                   GNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPD
FT                   FDEQDFEGALNAFANRERRFGGTEPGDETA"
FT   CDS_pept        199052..199879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="ECs_0177"
FT                   /product="CDP-diglyceride synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33600"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33600"
FT                   /db_xref="GOA:P0ABG2"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABG2"
FT                   /protein_id="BAB33600.2"
FT                   /translation="MLIPVVIAALFLLPPVGFAIVTLVVCMLAAWEWGQLSGFTTRSQR
FT                   VWLAVLCGLLLALMLFLLPEYHRNIHQPLVEISLWASLGWWIVALLLVLFYPGSAAIWR
FT                   NSKTLRLIFGVLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWGADSGAYMFGK
FT                   LFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLDVAPVTLLICSIVAALASV
FT                   LGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLVFRTL"
FT   CDS_pept        199891..201243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="ECs_0178"
FT                   /product="metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33601"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33601"
FT                   /db_xref="GOA:P0AEH2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEH2"
FT                   /protein_id="BAB33601.1"
FT                   /translation="MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQI
FT                   EPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGS
FT                   PLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRL"
FT   CDS_pept        201273..203705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamA"
FT                   /locus_tag="ECs_0179"
FT                   /product="BamABCDE complex OM biogenesis outer membrane
FT                   pore-forming assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33602"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33602"
FT                   /db_xref="GOA:P0A942"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A942"
FT                   /protein_id="BAB33602.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHS
FT                   AEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGI
FT                   NGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGW
FT                   TYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRW
FT                   GYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQD
FT                   GAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQ
FT                   YSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   CDS_pept        203826..204311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skp"
FT                   /locus_tag="ECs_0180"
FT                   /product="periplasmic chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33603"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33603"
FT                   /db_xref="GOA:P0AEU9"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEU9"
FT                   /protein_id="BAB33603.1"
FT                   /translation="MKKWLLAAGLGLALATSAQAADKIAIVNMGSLFQQVAQKTGVSNT
FT                   LENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQD
FT                   RARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK"
FT   CDS_pept        204315..205340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="ECs_0181"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33604"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33604"
FT                   /db_xref="GOA:P65323"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65323"
FT                   /protein_id="BAB33604.1"
FT                   /translation="MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSA
FT                   VIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHE
FT                   IQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQ
FT                   D"
FT   CDS_pept        205445..205900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="ECs_0182"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33605"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33605"
FT                   /db_xref="GOA:P0A6Q8"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6Q8"
FT                   /protein_id="BAB33605.2"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   CDS_pept        205904..206692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="ECs_0183"
FT                   /product="UDP-N-acetylglucosamine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33606"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33606"
FT                   /db_xref="GOA:Q8X8X8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8X8"
FT                   /protein_id="BAB33606.1"
FT                   /translation="MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLK
FT                   SHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMAAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLI
FT                   YRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIR"
FT   CDS_pept        206692..207840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="ECs_0184"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33607"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33607"
FT                   /db_xref="GOA:Q8X8X7"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8X7"
FT                   /protein_id="BAB33607.1"
FT                   /translation="MTEQRPLTIALVAGETSGDILGAGLIRALKERVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTKRFGELKPDVFVGIDAPDFNI
FT                   ILEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRATDLVLAFLPFEKAFYDKYNVPCRF
FT                   IGHTMADAMPLDPDKNSARDVLGIPYDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQT
FT                   YPDLEIVVPLVNAKRREQFERIKAAVAPDLSVHLLDGMGREAMVASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQKLAAA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAAQAVLELAQ"
FT   CDS_pept        207837..208433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="ECs_0185"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33608"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33608"
FT                   /db_xref="GOA:Q8X8X6"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8X6"
FT                   /protein_id="BAB33608.1"
FT                   /translation="MIEFVYPHTQLVAGVDEVGRGPLVGAVVTAAVILDPARPIAGLND
FT                   SKKLSEKRRLALCEEIKEKALSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPKLPMPAMAVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAEHGATEHHRRSFGPVKRALGLAS"
FT   CDS_pept        208470..211952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="ECs_0186"
FT                   /product="DNA polymerase III alpha subunit DnaE"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33609"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33609"
FT                   /db_xref="GOA:Q8X8X5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8X5"
FT                   /protein_id="BAB33609.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVQCDLLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSLLRGNSALVDECVAFYEEHFP
FT                   DRYFLELIRTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSSDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMSTEDYLVKRAKEGLEERLAFLFPDEEERVKRRPEYDERLETELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   AKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVITAAGLVVAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQHLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   CDS_pept        211965..212924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="ECs_0187"
FT                   /product="acetyl-CoA carboxylase carboxyl transferase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33610"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33610"
FT                   /db_xref="GOA:P0ABD6"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABD6"
FT                   /protein_id="BAB33610.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
FT   CDS_pept        213023..215164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA_1"
FT                   /locus_tag="ECs_0188"
FT                   /product="lysine decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33611"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33611"
FT                   /db_xref="GOA:Q8X8X4"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8X4"
FT                   /protein_id="BAB33611.1"
FT                   /translation="MNIIAIMGPHGVFYKDEPIKELESALVAQGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSDINQLNEYLPLYAFINTHSTMDVSVQDMRMALCFFE
FT                   YALGQAEDIAIRMRQYTDEYLDNITPPFTKALFTYVKERKYTFCTPGHMGGTAYQKSPV
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYIVTNGTST
FT                   SNKIVGMYAAPSGSTLLIDRNCHKSLAHLLMMNDVVPVWLKPTRNALGILGGIPRREFT
FT                   RDSIEEKVAATTQAQWPVHAVITNSTYDGLLYNTDWIKQTLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGERVAGKVIFETQSTHKMLAALSQASLIHIKGEYDEEAFNEAFMMHTTT
FT                   SPSYPIVASVETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDGWFFDIWQPPQ
FT                   VDEAECWPVAPGEQWHGFNDADADHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGIVVEKTGPYNLLFLFSIGIDKTKAMGLLRGLTEFKRSYDLNLRIKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRKHDLPGLMLRAFDTLPEMIMTPHQAWQRQIKGEVETI
FT                   ALEQLVGRVSANMILPYPPGVPLLMPGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIH
FT                   GAKQDEDGVYRVRVLKMAG"
FT   CDS_pept        215221..215610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="ECs_0189"
FT                   /product="lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33612"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33612"
FT                   /db_xref="GOA:Q8X8X3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8X3"
FT                   /protein_id="BAB33612.2"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFTLQSEVYREARDSWK
FT                   GDLALNGQYVIELFSFPFPPERPSRPEACGLRHLAFSVDDIDAAVAHLESHNVKCEAIR
FT                   VDPYTQKRFTFFNDPDGLPLELYEQ"
FT   CDS_pept        215675..216970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="ECs_0190"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33613"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33613"
FT                   /db_xref="GOA:Q8X8W8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8W8"
FT                   /protein_id="BAB33613.1"
FT                   /translation="MTLTLNRQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENPGGALR
FT                   AIHVHHGLSANADAWVTHCENVCQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFART
FT                   LLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGEL
FT                   AQWALAHGLRWIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAETTARSAALCAEQESL
FT                   LDELLADDLAHCQSPQGTLQIVPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQE
FT                   VALAREDASPCLRLGAFEIRRYQSQLWWIKSVTGQSENIVPWQTWLQPLELPAGQGSVQ
FT                   LNAGGDIRPPRADEAVSVRFKAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFY
FT                   GETLIAAAGGFVTQEGVAEGENGISFVWQRNA"
FT   CDS_pept        complement(217023..217283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="ECs_0191"
FT                   /product="modulator of Rho-dependent transcription
FT                   termination"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33614"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33614"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W7"
FT                   /protein_id="BAB33614.1"
FT                   /translation="MSMNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDL
FT                   VSRKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVVSES"
FT   CDS_pept        complement(217270..217470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="ECs_5365"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z6FM32"
FT                   /protein_id="BBE29393.1"
FT                   /translation="MEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAADDALSE
FT                   AVREKAAYAAANLLVSDYVNE"
FT   CDS_pept        217636..218094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="ECs_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33615"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33615"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W6"
FT                   /protein_id="BAB33615.1"
FT                   /translation="MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLL
FT                   AWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL
FT                   FTYNSRAAQIWWQQNQSKCAQFANLSVWYLDDEQLAKVSAFADRTMTL"
FT   CDS_pept        218178..218588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arfB"
FT                   /locus_tag="ECs_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33616"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33616"
FT                   /db_xref="GOA:Q8X8W5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W5"
FT                   /protein_id="BAB33616.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRSGRE"
FT   CDS_pept        218602..219312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpE"
FT                   /locus_tag="ECs_0194"
FT                   /product="lipoprotein involved with copper homeostasis and
FT                   adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33617"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33617"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W4"
FT                   /protein_id="BAB33617.1"
FT                   /translation="MVKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSW
FT                   RGVLPCADCEGIETSLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDSK
FT                   GEKSYYRAKGDALEMLDREGNPIESQFNYTLEPAQSSLPMTPMTLRGMYFYMADAATFT
FT                   DCATGKRFMVANNAELERGYLAARGHSEKPVLLSVEGHFTLEANPDTGAPTKVLAPDTA
FT                   GKFYPNQDCSSLGQ"
FT   CDS_pept        complement(219512..220336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeF"
FT                   /locus_tag="ECs_0195"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33618"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33618"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W3"
FT                   /protein_id="BAB33618.1"
FT                   /translation="MDKPKAYCRLLLPCFLLLSACTVDISQPDSSATAVDAEAKTWAVK
FT                   FQHQSSFTEQSIKEITVPDLKPGDLLFSSSLEVTSFGIRVFSTSSVSHVAIYLGENNVA
FT                   EATGAGVQIVSLKKAMKHSDKLFVLRVPDLTPQQATEITAFANKIKDSGYNYRGIVEFI
FT                   PFMVTRQMCSLNPFSEDFRQQCVSGLAKAQLSSVVEGDKKSWFCSEFVTDAFAKAGHPL
FT                   TLAQSGWISPADLMHMRIGDVSAFKPETQLQYVGHLKPGIYIKAGRFVGLTR"
FT   CDS_pept        complement(220389..222107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="ECs_0196"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33619"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33619"
FT                   /db_xref="GOA:Q8X8W2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8W2"
FT                   /protein_id="BAB33619.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GVRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGGSASHEFQVLAQSGEDDVV
FT                   FSDTSDYAANIELAEAIAPKEPRAAATQEMTLVDTPNAKTIAELVEQFNLPIKKTVKTL
FT                   LVKAVEGSSFPLVALLVRGDHELNEVKAEKLPQVASPLTFATEEEIRAVVKAGPGSLGP
FT                   VNMPIPVVIDRTVAAMSDFTAGANIDGKHYFGINWDRDVATPEVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NYDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLLDDRKERPG
FT                   VMFADMELIGIPHTIVLGDRNLDNDDIEYKYRRNGEKQLIKTGDIVEYLVKQIKG"
FT   CDS_pept        complement(222218..222925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsaA"
FT                   /locus_tag="ECs_0197"
FT                   /product="tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33620"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33620"
FT                   /db_xref="GOA:Q8X8W1"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W1"
FT                   /protein_id="BAB33620.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQA
FT                   DAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VELKEVVCHKDCVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAV
FT                   SFTAEVEKQLLTLEKRYPQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   TDAGFEVFALEPR"
FT   CDS_pept        complement(222922..223326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="ECs_0198"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33621"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33621"
FT                   /db_xref="GOA:Q8X8W0"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W0"
FT                   /protein_id="BAB33621.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQALCIGSALNITAK"
FT   CDS_pept        complement(223444..224259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="ECs_0199"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33622"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33622"
FT                   /db_xref="GOA:Q8X8V9"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8V9"
FT                   /protein_id="BAB33622.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTVLDVVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKNGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   CDS_pept        complement(224299..224952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="ECs_0200"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33623"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33623"
FT                   /db_xref="GOA:Q8X800"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X800"
FT                   /protein_id="BAB33623.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVVGLPVGVLLYVTRPGQ
FT                   IIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
FT   CDS_pept        complement(224945..225976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="ECs_0201"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33624"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33624"
FT                   /db_xref="GOA:P63356"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63356"
FT                   /protein_id="BAB33624.1"
FT                   /translation="MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKDEIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVL
FT                   GYV"
FT   CDS_pept        226164..226739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="ECs_0202"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33625"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33625"
FT                   /db_xref="GOA:P63229"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63229"
FT                   /protein_id="BAB33625.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKM
FT                   GFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFR
FT                   QVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITP
FT                   EAENAADWVLNSLADLPQAIKKQQKPAQ"
FT   rRNA            227106..228643
FT                   /gene="rrsH"
FT                   /locus_tag="ECs_R0001"
FT                   /product="16S ribosomal RNA"
FT   tRNA            228713..228789
FT                   /gene="ileV"
FT                   /locus_tag="ECs_R0024"
FT                   /product="tRNA-Ile"
FT                   /note="anticodon: gat"
FT   tRNA            228832..228907
FT                   /gene="alaV"
FT                   /locus_tag="ECs_R0025"
FT                   /product="tRNA-Ala"
FT                   /note="anticodon: tgc"
FT   rRNA            229093..231992
FT                   /gene="rrlH"
FT                   /locus_tag="ECs_R0002"
FT                   /product="23S ribosomal RNA"
FT   rRNA            232090..232200
FT                   /gene="rrfH"
FT                   /locus_tag="ECs_R0003"
FT                   /product="5S ribosomal RNA"
FT   tRNA            232258..232334
FT                   /gene="aspU"
FT                   /locus_tag="ECs_R0026"
FT                   /product="tRNA-Asp"
FT                   /note="anticodon: gtc"
FT   CDS_pept        232497..233300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="ECs_0203"
FT                   /product="2,5-diketo-D-gluconate reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33626"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33626"
FT                   /db_xref="GOA:Q8X7Z7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7Z7"
FT                   /protein_id="BAB33626.1"
FT                   /translation="MAIPAFGLGTFRLKDDVVISSVKTALELGYRAIDTAQIYDNEAAV
FT                   GLAIAESGVPRHELYITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSPNDE
FT                   VSVEEFMQALLEAKKEGLTREIGISNFTIPLMEKAIAAVGAENIATNQIELSPYLQNRK
FT                   VVAWAKQHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSS
FT                   TKRENLESNLKAQNLQLDAEDKKAIAALDCNDRLVSPEGLAPEWD"
FT   CDS_pept        complement(233297..234211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="ECs_0204"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33627"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33627"
FT                   /db_xref="GOA:Q8X7Z6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Z6"
FT                   /protein_id="BAB33627.1"
FT                   /translation="MKATSEELAIFVSVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRVQSILQEMAAAESEIMETRNTPRGLLRIDAATPVV
FT                   LHFLMPLIKPFRERYPEVTLSLVSSETIINLIERKVDVAIRAGTLTDSSLRARPLFNSY
FT                   RKIIASPDYISRYGKPETIDDLKQHVCLGFTEPASLNTWPVACSDGQLHEVKYGLSSNS
FT                   GETLKQLCLSGNGIACLSDYMIDREIARGELVELMADKVLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEHVKTAPGGAVREA"
FT   CDS_pept        234473..235252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="ECs_0205"
FT                   /product="endo/exonuclease/phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33628"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33628"
FT                   /db_xref="GOA:P0A8U4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8U4"
FT                   /protein_id="BAB33628.2"
FT                   /translation="MRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIRILVWNIY
FT                   KQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLPQHPSGVM
FT                   TLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLGVDVYSKQ
FT                   LLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRRRAFGRPL
FT                   DFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
FT   CDS_pept        235330..236100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="ECs_0206"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33629"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33629"
FT                   /db_xref="GOA:Q8X7Z4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Z4"
FT                   /protein_id="BAB33629.1"
FT                   /translation="MTTQSHHDHVEKQFSSQASEYLTSTVHASGRDLQLLAVCLADYPD
FT                   ASVLDMGCGAGHASFVAAQNVSTVVAYDLSAQMLDVVAQAAEVRQLKNITTRQGYAESL
FT                   PFADNAFDIVISRYSAHHWHDVGAALREVNRILKPGGRLIVMDVMSPGHPVRDIWLQTV
FT                   EALCDTSHVRNYASGEWLRLINEANLIVDNLITDKLPLEFSSWVARMRTPEALVDAIRI
FT                   YQQSASTEVRTYFALQNDGSFTSDIIMVDAHKAA"
FT   CDS_pept        complement(236148..237506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="ECs_0207"
FT                   /product="membrane-bound lytic murein transglycosylase D"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33630"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33630"
FT                   /db_xref="GOA:Q8X7Z2"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Z2"
FT                   /protein_id="BAB33630.1"
FT                   /translation="MKAKAILLASVLLVGCQSTGNVQQHAQSLSAAGQGEAAKFTSQAR
FT                   WMDDGTSIAPDGDLWAFIGDELKMGIPENDRIREQKQKYLRNKSYLHDVTLRAEPYMYW
FT                   IAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNYDAR
FT                   RDVVASTTAALNMMQRLNKMFDGDWLLTVAAYNSGEGRVMKAIKTNKARGKSTDFWSLP
FT                   LPQETKQYVPKMLALSDILKNSKRYGVRLPTTDESRALARVHLSSPVEMAKVADMAGIS
FT                   VSKLKTFNAGVKGSTLGASGPQYVMVPKKHADQLRESLASGEIAAVQSTLVADNTPLNS
FT                   RVYTVRSGDTLSSIASRLGVSTKDLQQWNKLRGSKLKPGQSLTIGAGSSAQRLANNSDS
FT                   ITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVKNNSMPDS"
FT   CDS_pept        complement(237578..238333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="ECs_0208"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33631"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33631"
FT                   /db_xref="GOA:P0AC85"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AC85"
FT                   /protein_id="BAB33631.1"
FT                   /translation="MNLNSIPAFDDNYIWVLNDEAGRCLIVDPGDAEPVLNAIAANNWQ
FT                   PEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGHEFSV
FT                   IATPGHTLGHICYFSKPYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCC
FT                   AHEYTLSNMKFALSILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDI
FT                   DLINVINEETLLQQPEERFAWLRSKKDRF"
FT   CDS_pept        238367..239089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="ECs_0209"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33632"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33632"
FT                   /db_xref="GOA:Q8X7Z0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Z0"
FT                   /protein_id="BAB33632.2"
FT                   /translation="MKPARVPQTVVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFYL
FT                   LKIGNLSAEINCEACAVSHQVNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCT
FT                   DPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWL
FT                   SLLNFEVLHASRFHVLPWNKHGGKLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNK
FT                   PRIRQAVGATRQCRKPQA"
FT   CDS_pept        complement(239086..239553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="ECs_0210"
FT                   /product="ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33633"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33633"
FT                   /db_xref="GOA:P0A7Y6"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7Y6"
FT                   /protein_id="BAB33633.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNN
FT                   RMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLW
FT                   QRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV"
FT   CDS_pept        239609..240349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECs_0211"
FT                   /product="DNA polymerase III epsilon subunit DnaQ"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33634"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33634"
FT                   /db_xref="GOA:Q8X7Y5"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Y5"
FT                   /protein_id="BAB33634.2"
FT                   /translation="MTAMSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRR
FT                   LTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAA
FT                   FDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRT
FT                   LHGALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRLVRQASKLRVVFATD
FT                   EELAAHEARLDLVQKKGGSCLWRA"
FT   tRNA            240482..240558
FT                   /gene="aspV"
FT                   /locus_tag="ECs_R0027"
FT                   /product="tRNA-Asp"
FT                   /note="anticodon: gtc"
FT   CDS_pept        240887..241687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafT"
FT                   /locus_tag="ECs_5700"
FT                   /product="lipoprotein"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3V5"
FT                   /protein_id="BBE29394.1"
FT                   /translation="MNSKKLCCICVLFSLLAGCASESSIDEKKKKAQVTQSNINKNTPQ
FT                   QLTDKDLFGNETTLAVSEEDIQAALDGDEFRVPLNSPVILVQSGNRAPETIMQEEMRKY
FT                   YTVSTFSGIPDRQKPLTCNKNKDKNENEDVARAENMNWMQALRFVAAKGHQKAIIVYQD
FT                   MLQTGKYDSALKSTVWSDYKNEKLTDAISLRYLVRFTLVDVATGEWATWSPVNYESRVI
FT                   FPPAGITKTSNKELSNDHVTEAQLFNLKQKTYVSMVKDLVSRFQ"
FT   CDS_pept        complement(241872..242168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33635"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33635"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Y3"
FT                   /protein_id="BAB33635.1"
FT                   /translation="MIIINLRLTLLFILATFTYSVQSDEFDDQTTYTQYRYFSTAIPED
FT                   IRRFMFYVDYCFVDLAFDIETDSMTAKNDIINECTPLKERNKTLKEKYKKMKR"
FT   CDS_pept        complement(242165..242614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33636"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDD6"
FT                   /protein_id="BAB33636.1"
FT                   /translation="MRKITIILLLTFSCTKGLAFDISMSKECSGVDELEFIDCVKNSFI
FT                   MSTITLKKAEANIKEKIQKWNSDEDEAIRKEAVISLKRLESSNREFIRYRFAQCSFTLT
FT                   WGARVGRLAFSRLYPCYTELNKIRAMQLNNAYISDFQNPDEISSK"
FT   CDS_pept        complement(242617..243213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33637"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33637"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7X8"
FT                   /protein_id="BAB33637.2"
FT                   /translation="MLWTENDAENTSQWNGYPLQIGRFRKDKAMPALISGEKSTALVTP
FT                   PQWRNKAFNGLKDPERNYWAKEQITGSPEENIKAAITYLMMKLSNTKEESTIDQYDSTL
FT                   YSAIVQKGDLADNIRKERKTTIPNLTKNNPGKNLDKIHPGDILYYQKASMKVIITGWKP
FT                   ITIKNVAMNYNGGGDPKYAIKLQFVYTLLTKNRVL"
FT   CDS_pept        complement(243292..243513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33638"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7X5"
FT                   /protein_id="BAB33638.1"
FT                   /translation="MANNILHSSTSDSESKNTSTDSTLFNEKFPFQLRQDFASRITEDE
FT                   SDFFKWKKIRELAFVSNHKEWNKYDLLI"
FT   CDS_pept        complement(243534..244013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0216"
FT                   /product="type VI secretion system effector Hcp1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33639"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33639"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7X3"
FT                   /protein_id="BAB33639.1"
FT                   /translation="MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFM
FT                   HGLNRDQNVNHHHLTIKKPIDKASPLLGKAICDNELLTCDFSFYRTNKFGINELFYKIK
FT                   LTGAKISDIHVSISHIVVDNSVQPEESVSFSYESIIWEHCSAGTSAYSLWEDRLF"
FT   CDS_pept        complement(243979..245388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33640"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33640"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBT0"
FT                   /protein_id="BAB33640.1"
FT                   /translation="MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLV
FT                   ESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPA
FT                   RTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLL
FT                   YFMQNTRKRLEPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVR
FT                   SLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAAT
FT                   VWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALK
FT                   TRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESL
FT                   LTQYQDARAQKQNTDALEKQINERLEGVLSRWLLLKNNTIPTIKKALNFNNIHEYKGVL
FT                   NGEFNLFNTKW"
FT   CDS_pept        complement(245399..248833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impL"
FT                   /locus_tag="ECs_0218"
FT                   /product="type VI secretion system protein ImpL"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33641"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33641"
FT                   /db_xref="GOA:A0A0H3JDE0"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDE0"
FT                   /protein_id="BAB33641.2"
FT                   /translation="MLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAAWGIIA
FT                   LVWLTVRVMKRLQLLEKQQKQQREEAIDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLW
FT                   QLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGARGTEQRLYLTPHVGKQAVIFDIDGT
FT                   LCAPADADILHRRLWEHALGWLKEKRARQPLNGIILTLDLPDLLTADKRHREHLLQTLR
FT                   SRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVTFTRRAHENDDW
FT                   RTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSRQMQGSREPLVSLLEGLLDGEN
FT                   MNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYFTRSLFPQAL
FT                   LAEPNLATESRAWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKA
FT                   FMDVPPPQGEDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTY
FT                   LQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRW
FT                   SEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKL
FT                   PVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGLQSYF
FT                   VKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDNLNI
FT                   RNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDYQL
FT                   LTRLGHEFAPENITLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLR
FT                   LDQNSSDPIFATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFN
FT                   EQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVII
FT                   REDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQLVDYSQGRN
FT                   YTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTV
FT                   RFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY"
FT   CDS_pept        complement(248970..250381)
FT                   /transl_table=11
FT                   /locus_tag="ECs_0219"
FT                   /note="hypothetical protein"
FT                   /pseudogene="unknown"
FT   CDS_pept        complement(250386..251129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0222"
FT                   /product="type VI secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33645"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33645"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V9"
FT                   /protein_id="BAB33645.1"
FT                   /translation="MSRLRVFRQTGWFIAGLMTGLPATAAPAEASSMAGVAVAVATTTP
FT                   PDATATLQAMQSCRRESAALERLDCYDHLLAPLSPSGFDGALVKAGFVGEAWTRATEQE
FT                   KRREGNTTELLVTQVPGERPTVVITTPAIGHVPPRPVLMFSCVDNITRMQVALMHPLDV
FT                   HDIAVTLNADSRALRSHWFVRENGTLLESSRGLSGIDEIKQLFGAKTLTVDTGADNAAG
FT                   KLTFNIDGLARAIAPLRDACHWAGE"
FT   CDS_pept        complement(251126..253897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0223"
FT                   /product="ATP-dependent Clp proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33646"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33646"
FT                   /db_xref="GOA:Q8X7V7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V7"
FT                   /protein_id="BAB33646.1"
FT                   /translation="MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQM
FT                   LAMPRSDLRVITRQGDIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEGWLLAS
FT                   AEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPD
FT                   ADGKGAGTLTDASDTLLARYAKNMTEDARNGRLAPVLCRDHEIDLMIDILCRRRKNNPV
FT                   VVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGL
FT                   MAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPNAAEATIILRGLSAVYERSHGVLIDDDALQAAATLSERY
FT                   LSGRQLPDKAIDVLDTACARVAINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRT
FT                   DTSRMTEVLVQYDETLTALDELEAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADT
FT                   VEDTQPESESESEQDNTGAVPADETDREQPEETAETVSPVQRLAQLTAELDALHNDRLL
FT                   VSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHLL
FT                   TARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVS
FT                   RLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGE
FT                   GRLIDCKNIVFFLTSNLGYQVIVEHADDPETMQEALYPVLADFFKPALLARMEVVPYLP
FT                   LSKETLATIIAGKLARLDNVLRSRFGAEVVIEPEVTDEIMSRVTRAENGARMLESVIDG
FT                   DMLPPLSLLLLQKMAANTAIARIRLSAVDGAFTADVEDAQNDESVTKDETVL"
FT   CDS_pept        complement(253906..254667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impK"
FT                   /locus_tag="ECs_0224"
FT                   /product="type VI secretion system protein ImpK"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33647"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33647"
FT                   /db_xref="GOA:Q8X7V4"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V4"
FT                   /protein_id="BAB33647.1"
FT                   /translation="MDEGSLSLPPFTGYDEKSLRDYHLALHGNSLNPMIDAATPLLGMV
FT                   MRLSTMNSQTMPEHLFAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNG
FT                   WSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIREPKRYQDLLEFLWLCFSLGFRGRY
FT                   KVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTVKHIFCGG
FT                   VVVLALFYLFYLLRLDSQTQDILHQLNKLLR"
FT   CDS_pept        complement(254672..256003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impJ"
FT                   /locus_tag="ECs_0225"
FT                   /product="type VI secretion system protein ImpJ"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33648"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33648"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V2"
FT                   /protein_id="BAB33648.1"
FT                   /translation="MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWG
FT                   FTELTLNNELLAQGKIMIDSASGTLPDGTVFSIPDQDALPDPLHPQNFPDERSRNIYLA
FT                   LPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGDARTLTLGQLTPRIMSGAEDMSAY
FT                   ITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAIGGRASDLANRIG
FT                   SPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAELLGELMTFTEPSR
FT                   LPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSELLQ
FT                   SATFVLAVAANMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYH
FT                   SGFSYFELDKSGQAWTEMAAAGAVALHVSGSFPDLNMQLWAIRG"
FT   CDS_pept        complement(256006..256530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0226"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33649"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33649"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V0"
FT                   /protein_id="BAB33649.1"
FT                   /translation="MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSE
FT                   ITVTLLTEPDTNTNAEGESAAVDVQLVYLTDDSKLQAADYDQIASTPLPDVLGKNYIDH
FT                   QDFNLLPDTIKTLPPIKLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLVHVR
FT                   QSSIEMKKEDE"
FT   CDS_pept        complement(256527..257807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="ECs_0227"
FT                   /product="type VI secretion system protein ImpI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33650"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33650"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V9Q1"
FT                   /protein_id="BAB33650.1"
FT                   /translation="MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSV
FT                   QDRQQSIPAQAFTVILHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMV
FT                   RVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLSTEGAPHYPGMTHRHQLADTVVNGF
FT                   SADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDHN
FT                   DDISAAEMAQRHLAVTPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGLLDLQQQR
FT                   NSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEAN
FT                   RAAIVESLRVLLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQ
FT                   GFEMLFNEVYAQVYDRVLREKQREPEA"
FT   CDS_pept        complement(257832..258914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impH"
FT                   /locus_tag="ECs_0228"
FT                   /product="type VI secretion system protein ImpH"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33651"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33651"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7U7"
FT                   /protein_id="BAB33651.1"
FT                   /translation="MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAEL
FT                   LHRLAKGEKGTPELSLRDDPAQETLRFSADASLAFPCSDISALKRDTSGAFRMTTTFMG
FT                   LQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMFSHRLTQFVWHIWRKYRYHISFRNGG
FT                   VDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEIICGLVSHCFDLSE
FT                   VTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSIT
FT                   SLTRKQFLSFLPSGENFLPLTTFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLG
FT                   WTSFLGTPEERPSVTIRVRS"
FT   CDS_pept        complement(258878..260728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0229"
FT                   /product="type VI secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33652"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33652"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7U6"
FT                   /protein_id="BAB33652.1"
FT                   /translation="MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERL
FT                   LEGVAFLTGNLRQKIEDEFPELTHGLIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLI
FT                   PRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLCRDIWLLPVRLEQIENRSTTRNGV
FT                   INITFSVAPGTDFRTLDLNKLRFWLGNDDNYTRDQLYLWFCEYLQGADLTVGEQHIRLP
FT                   EFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEFF
FT                   TLQLRFSRPLPVDIRLRRDSLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQH
FT                   YDVFSVNSVVSQVQDMFRKKDLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRT
FT                   KTSLFHRGFDHTLAFIHADGSYPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTG
FT                   KNAAVASFRNITRPTQPLWPVIDGSLHWSLLSAMNLNYLSLLDTDALKQVIANFDRHAI
FT                   HHPQTARLSQQKLDAIERLETRPVDRLFTGIPVRGLASTLYLHPEPFVCEGEMYLLGTV
FT                   LSHFLSLYASVNSFHMLTVVNTESQETWKWTERIGQHPLI"
FT   CDS_pept        complement(260732..261145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0230"
FT                   /product="type VI secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33653"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33653"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7U0"
FT                   /protein_id="BAB33653.1"
FT                   /translation="MILDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILN
FT                   TRSGSCRGAPELGIDEPEGAENFRESMSRAIEQCIERYEPRISHAEVQAVVSSASSPLD
FT                   MTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD"
FT   CDS_pept        complement(261236..262627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impC"
FT                   /locus_tag="ECs_0231"
FT                   /product="type VI secretion system protein ImpC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33654"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33654"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7T9"
FT                   /protein_id="BAB33654.1"
FT                   /translation="MSLQEEELVSSHAGQPEQESSLLDQIMAQTRIQPGSEGYDVARQG
FT                   VTAFIASILQSTASAEPVNKLAVDSMIADIDERISRQMDVIIHAPAFQQVESFWRSLKT
FT                   MVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQSGFYKHVYSSGFGQFGGEPIAAVL
FT                   GAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELPNIKDLYAIFEGP
FT                   AYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNTA
FT                   WMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREF
FT                   ELAEEGFITLTMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAH
FT                   YIKVLQREQLGSWKERSDLERELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEG
FT                   EPGWY"
FT   CDS_pept        complement(262678..262902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33655"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33655"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7T7"
FT                   /protein_id="BAB33655.1"
FT                   /translation="MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTL
FT                   DRRISDLLDEIIHFCEFQQSASHWQRVLH"
FT   CDS_pept        complement(262937..263437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impB"
FT                   /locus_tag="ECs_0233"
FT                   /product="type VI secretion system protein ImpB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33656"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33656"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7T5"
FT                   /protein_id="BAB33656.1"
FT                   /translation="MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNT
FT                   QETSSLDERQAVSVNKHNFGAVMAEAAIGLNFTVPATLKGSTTDDEMNVALNIKSLDDF
FT                   SPDSVARQVPEVNKLLELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGQV
FT                   SNK"
FT   CDS_pept        264134..264652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0234"
FT                   /product="Hcp-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33657"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33657"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC35"
FT                   /protein_id="BAB33657.1"
FT                   /translation="MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFL
FT                   HNVTVPTDPQSGQPAGQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVE
FT                   GKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGA
FT                   DDWRAPLEA"
FT   CDS_pept        264862..267003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vgrE"
FT                   /locus_tag="ECs_0236"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33659"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33659"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC38"
FT                   /protein_id="BAB33659.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVFFHLNQSLSSLFSLALSLVSQQF
FT                   LSLEFQQILDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQKLYSMKVCPPLWRTGL
FT                   RQNFRIFQNEDIASILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAQKSTDQSLVLCDTVLYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
FT                   NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTT
FT                   LDNHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   SNQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYKGSGFNELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNH
FT                   AEKIGNNQAITVTNNQILNIGVNQIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALT
FT                   VGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQ
FT                   TAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPV
FT                   PDAPVPKDLPPGMPDMRQF"
FT   CDS_pept        267079..271293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsC"
FT                   /locus_tag="ECs_0237"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33660"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33660"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XED9"
FT                   /protein_id="BAB33660.2"
FT                   /translation="MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITY
FT                   ANPVNPVLGAKVLPGETDLALPGPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRL
FT                   QIRDEGLILNDNGGRSIHFEPLFPGEISYSRSESFWLARGGVAEQHSSQPLSALWQVLP
FT                   EDVRLSPHMYLATNSLQGPWWILNWPERVPGADEVLPPEPPAYRVLTGVVDGFGRTLAF
FT                   HRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSLV
FT                   FPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGT
FT                   QVRGFAYDAEHAGRMVAHHYAGRPESRYRYDDTGRVTELVNPEGLDYRFEYGQDRVTIT
FT                   DSLNRREVLYTEGEGGLKRVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMA
FT                   SGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPDGLRSSREYDEKGRLAAETSRSGETTRY
FT                   SYDDPASELPTGIQDATGSTKQMAWSRYGQLLTFTDCSGYTTRYEYDRYGQQIAVHREE
FT                   GISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTAIVAPDGSRSEIQYDAWGKAVST
FT                   TQGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKL
FT                   TQSEDEGLVTLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGY
FT                   DDKGRLTGERQTVENPETGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLA
FT                   GMKLGGTPLVEYMRDRLHRETARSFGGEAYELATAWNTSGQLRSRHLNLPQLDRDYDWN
FT                   DNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPELHPDS
FT                   TLTAWPDNRIAEDAHYVYRYDEYGRLAEKTDRIPEGVIRMHDERTHHYHYDSQHRLVFH
FT                   TRIQHGEPQVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTV
FT                   QTQQTRIQTVYQPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGR
FT                   LERELRQGSVSEESQQWLAQCGLTAEQMAAQLEAEYIPERKLHLYHCDHRGLPLALISP
FT                   EGETAWQGEYDEWGNLLGETSAQHLQQSLRLPGQQYDEESGLYYNRNRYYDPLQGRYIT
FT                   QDPIGLEGGWNLYQYPLNPIEHIDPLGLALDLNYYSPSDPIYKGSLNVREFPTGFTVGG
FT                   HGSPTSMSDDRIKKGSDLTIKQLASDIRANPKYHEGMPVVLFSCETGKGKNSFAQKLAN
FT                   ELDATVIAPDEIIWIWPDGNYAIMGQTARITIGGKDNGVFELVPDEKQPGDFHKFTPTG
FT                   SK"
FT   CDS_pept        271362..271907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibG"
FT                   /locus_tag="ECs_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33661"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33661"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7S7"
FT                   /protein_id="BAB33661.2"
FT                   /translation="MDNSKHSDEAEKLLAELSARKGEGEGEGEGEGEGEGEGEPKSTVS
FT                   VFYLQPEEVNTLSHQAKRGDGEAGFRLFLYYKLSNYDEEKSSQWLKIAANNGHATAQYR
FT                   LYVELQEQGETKEANEWLQKIKLAASNNDSSAIWFLVNCYKNQGNKKEALQWAYKLKAS
FT                   KQPLDADRLIEELTKEQK"
FT   repeat_region   272534..273799
FT                   /note="ISEc1 Family: ISAs1 partial"
FT   CDS_pept        272653..273789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="ECs_0241"
FT                   /product="H repeat-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33664"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33664"
FT                   /db_xref="GOA:Q8X4R7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4R7"
FT                   /protein_id="BAB33664.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHLDFLRQYGDFENAIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAPPELLNILD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCEVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPKMTV
FT                   RYYISSADLTAGKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS"
FT   CDS_pept        273792..275552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0242"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33665"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33665"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7R9"
FT                   /protein_id="BAB33665.1"
FT                   /translation="MPWLHRETARSFGGAGSTAGYEQVTAYTLTGQLQSRHLNLPQLDC
FT                   DYDWNDNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPE
FT                   LHPDSTLTAWPDNRIAEDAHYVYRYDEYGRLTEKTDRIPEGVIRMHDERTHHYHYDNQH
FT                   RLVFYTRIQYGEPLVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEVTWYGWDGD
FT                   RLTTVQTGTTRIQTVYRPGSFTPLIRIETENGEREKAQRRSLAEKLQQEGSEDGHGVVF
FT                   PAELVRMLDRLEEEIRADRVSSESRAWLAQCGLTVEQLEKQVEPEYTPARTLHLYHCDH
FT                   RGLPLALISEDGNTAWSAEYDEWGNQLNEENPHHLHQPYRLPGQQHDEESGLYYNRHRY
FT                   YDPLQGRYITPDPIGLRGGWNMYQYPLNPIQVIDPMGLDAIENMTSGGLIYAVSGVPGL
FT                   IVANSITNSAYQFGYDMDAIVGGAHNGAADAMRYCYLMCRMTKTFGSTIADVIGKNHEA
FT                   AGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNIGQLFGLDGIKADNPIKA
FT                   KQGSSDASNY"
FT   CDS_pept        275536..275706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33666"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33666"
FT                   /db_xref="GOA:A0A0H3JDG1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDG1"
FT                   /protein_id="BAB33666.1"
FT                   /translation="MLQIIRGKLVIFLITLCLFVVYLGFDNNSNSDIVFYGHKTPKSVE
FT                   IYLSEKILFIK"
FT   CDS_pept        275754..276017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33667"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7R7"
FT                   /protein_id="BAB33667.1"
FT                   /translation="MVNNYKTHCGVVDINLNFFNDILYSVRLKNISKLENMEFCATKQR
FT                   VYFSDKNKKASYKIINYGDYYDVDYYDNNLKNEVFDWIGKWS"
FT   repeat_region   276083..277387
FT                   /note="ISEc26 Family: ISAs1"
FT   CDS_pept        276198..277370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yncI"
FT                   /locus_tag="ECs_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33668"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33668"
FT                   /db_xref="GOA:Q8X7R5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7R5"
FT                   /protein_id="BAB33668.1"
FT                   /translation="MSIQSLLDYISVIPDIRQQGKVKHKLSDILFLTVCAVIAGADEWQ
FT                   EIEDFGHERLEWLKKYGDFDNGIPVDDTIARVVSNIDSLAFEKIFIEWMQECHEITDGE
FT                   IIAIDGKTIRGSFDKGKRKGAIHMVSAFSNENGVVLGQVKTEAKSNEITAIPELLNLLD
FT                   LKKNLITIDAMGCQKDIASKIKDKKADYLLAVKGNQGKLHHAFEEKFPVNVFSNYKGDS
FT                   FSTQEISHGRKETRLHIVSNVTPEFCDFEFEWKGLKKLCVALSFRQKKEDKSAEGVSIR
FT                   YYISSKDMDAKEFAHAIRAHWLIEHSLHWVLDVKMNEDASRIRRGNAAEIISGIKKMAL
FT                   NLLRDCKDIKGGVKRKRKKVALNTCYIEEVLASCSELGFRTDKMKNLTQI"
FT   CDS_pept        complement(277488..278258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="ECs_0246"
FT                   /product="NAD(P)-binding C-N hydrolase family amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33669"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33669"
FT                   /db_xref="GOA:Q8X7R4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7R4"
FT                   /protein_id="BAB33669.1"
FT                   /translation="MPGLKITLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVLPEMFT
FT                   SGFAMEAAASSLAQDDVVNWMTAKAQQCNALIAGSVALQTESGSVNRFLLVEPGGTVHF
FT                   YDKRHLFRMADEHLHYKAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLAIYVA
FT                   NWPAPRSLHWQALLTARAIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADA
FT                   HQATRIDAELSMVALREYREKFPAWRDADEFRLR"
FT   CDS_pept        278439..278885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ivy"
FT                   /locus_tag="ECs_0247"
FT                   /product="inhibitor of c-type lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33670"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33670"
FT                   /db_xref="GOA:P0AD60"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AD60"
FT                   /protein_id="BAB33670.2"
FT                   /translation="MFKAITTVAALVIATSAMAQDDLTISSLAKGETTKAAFNQMVQGH
FT                   KLPAWVMKGGTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSNQMTGLFSTI
FT                   DEKTSQEKLTWLNVNDALSIDGKTVLFAALTGSLENHPDGFNFK"
FT   CDS_pept        complement(278928..281372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="ECs_0248"
FT                   /product="acyl coenzyme A dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33671"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33671"
FT                   /db_xref="GOA:Q8X7R2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7R2"
FT                   /protein_id="BAB33671.2"
FT                   /translation="MMILSILATVVLLGALFYHRVSLFISSLILLAWTAALGVAGLWSA
FT                   WVLVPLAIILVPFNFAPMRKSMISAPVFRGFRKVMPPMSRTEKEAIDAGTTWWEGDLFQ
FT                   GKPDWKKLHNYPQPRLTAEEQAFLDGPVEEACRMANDFQITHELADLPPELWAYLKEHR
FT                   FFAMIIKKEYGGLEFSAYAQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTDEQK
FT                   DHYLPRLARGQEIPCFALTSPEAGSDAGAIPDTGIVCMGEWQGQQVLGMRLTWNKRYIT
FT                   LAPIATVLGLAFKLSDPEKLLGGAEDLGITCALIPTTTPGVEIGRRHFPLNVPFQNGPT
FT                   LGKDVFVPIDYIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGVKSVALATGAYAHI
FT                   RRQFKISIGKMEGIEEPLARIAGNAYVMDAAASLITYGIMLGEKPAVLSAIVKYHCTHR
FT                   GQQSIIDAMDITGGKGIMLGQSNFLARAYQGAPIAITVEGANILTRSMMIFGQGAIRCH
FT                   PYVLEEMEAAKNNDVNVFDKLLFKHIGHVGSNKVRSFWLGLTRGLTSSTPTGDATKRYY
FT                   QHLNRLSANLALLSDVSMAVLGGSLKRRERISARLGDILSQLYLASAVLKRYDDEGRNE
FT                   ADLPLVHWGVQDALYQAEQAMDDLLQNFPNRVVAGLLNVVIFPTGRHYLAPSDKLDHKV
FT                   AKILQVPNATRSRIGRGQYLTPSEHNPVGLLEEALVDVIAADPIHQRICKELGKNLPFT
FT                   RLDELAHNALAKGLIDKDEAAILVKAEESRLRSINVDDFDPEELATKPVKLPEKVRKVE
FT                   AA"
FT   CDS_pept        281612..282190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="ECs_0249"
FT                   /product="D-sedoheptulose 7-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33672"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33672"
FT                   /db_xref="GOA:P63225"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63225"
FT                   /protein_id="BAB33672.1"
FT                   /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRY
FT                   VEAVGREGDVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVP
FT                   HFGYADRIQEIHIKVIHILIQLIEKEMVK"
FT   CDS_pept        282295..283062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="ECs_0250"
FT                   /product="type 2 glutamine amidotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33673"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33673"
FT                   /db_xref="GOA:Q8X7R0"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7R0"
FT                   /protein_id="BAB33673.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLTGYKSLETGNFRPVGKTDSEKAFCWLLYKLTQRYPRTPGNMAAVFKYIASLA
FT                   DELRQKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWRLFCLGERVV"
FT   CDS_pept        complement(283033..283773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="ECs_0251"
FT                   /product="L,D-transpeptidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33674"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33674"
FT                   /db_xref="GOA:P0AAA0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAA0"
FT                   /protein_id="BAB33674.1"
FT                   /translation="MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLK
FT                   PDSRYYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYV
FT                   VSKPLSHEVVQPQLASNYTLPEAK"
FT   CDS_pept        complement(283929..284189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafQ"
FT                   /locus_tag="ECs_0252"
FT                   /product="predicted toxin of the YafQ-DinJ toxin-antitoxin
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33675"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33675"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBT6"
FT                   /protein_id="BAB33675.1"
FT                   /translation="MNSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHP
FT                   LQGSWKGYRDAHVEPDWILIYKLTDKLLRFERTGTHAALFG"
FT   CDS_pept        complement(284208..284468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinJ"
FT                   /locus_tag="ECs_0253"
FT                   /product="antitoxin of YafQ-DinJ toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33676"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33676"
FT                   /db_xref="GOA:Q8X7Q6"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Q6"
FT                   /protein_id="BAB33676.1"
FT                   /translation="MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREK
FT                   ALPFDLREPNQLTIQSIKNSEAGVDVHKAKDADDLFDKLGV"
FT   CDS_pept        284654..285427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafL"
FT                   /locus_tag="ECs_0254"
FT                   /product="endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33677"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33677"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Q5"
FT                   /protein_id="BAB33677.2"
FT                   /translation="MHDQPLLSMSLPSIPSFVLSGLLLICLPFSSFASATTSHISFSYA
FT                   ARQRMQNRARLLKQYQTHLKKQVSYIVEGNAESRRALRQHNREQIKQHPEWFPAPLKAS
FT                   DRRWQALAENNHFLSSDHLHNITEVAIHRLEQQLGKPYVWGGTRPDKGFDCSGLVFYAY
FT                   NKILEAKLPRTANEMYHYHRATIVANNDLRRGDLLFFHIHSREIADHMGVYLGDGQFIE
FT                   SPRTGETIRVSRLAEPFWQDHFLGARRILTEETIL"
FT   CDS_pept        285603..285899
FT                   /transl_table=11
FT                   /gene="yafM"
FT                   /locus_tag="ECs_0255"
FT                   /note="hypothetical protein"
FT                   /pseudogene="unknown"
FT   CDS_pept        complement(286245..287984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="ECs_0256"
FT                   /product="flagellar export pore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33680"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33680"
FT                   /db_xref="GOA:Q8X7Q2"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Q2"
FT                   /protein_id="BAB33680.2"
FT                   /translation="MLSRSDLLTLLTINFIVVTKGAERISEVSARFTLDAMPGKQMAID
FT                   ADLNAGLINQAQAQTRRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIG
FT                   IFKYNLSADAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRHQLL
FT                   ASPSVLYTATGIMFVLAVVPGMPHLPFLLFSALLGFTGWRMSKQPQAAEAEEKSLETLT
FT                   RTITETSEQQVSWETIPLIEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGV
FT                   LLPEIRIRENFRLKPSQYAIFINGIKADEADIPADKLMALPSSETYGEIDGVLGNDPAY
FT                   GMPVTWIQPAQKAKALNMGYQVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLSS
FT                   MAPRLAEDLSAALNYSQLLKVYRALLTEGVSLRDIVTIATVLVASSAVTKDHILLAADV
FT                   RLALRRSITHPFVRKQELTVYTLNNELENLLTNVVNQAQQGGKVMLDSVPVDPNMLNQF
FT                   QSTMPQVKEQMKAAGKDPVLLVPPQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMG
FT                   ALS"
FT   CDS_pept        288079..288714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="ECs_0257"
FT                   /product="flagellar system protein MbhA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33679"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33679"
FT                   /db_xref="GOA:Q8X7Q3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Q3"
FT                   /protein_id="BAB33679.2"
FT                   /translation="MAVPEETEKKARDVNEKTALLKKKSATELGELATSINTIARDAHM
FT                   EANLEMEIVPQGLRVLIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITG
FT                   HTDAMAYKNNIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSA
FT                   GNRRIEIMVLTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR"
FT   CDS_pept        288785..289840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="ECs_0258"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33681"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33681"
FT                   /db_xref="GOA:Q8X7Q1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7Q1"
FT                   /protein_id="BAB33681.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDE
FT                   AYLDVTDSVHCHGSATLIAQEIRQTIFSELQLTASAGVTPVKFLAKIASDMNKPNGQFV
FT                   ITPAEVSAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVILLKRFGKFGRIL
FT                   WERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDL
FT                   LIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLD
FT                   PQMERQLVLGL"
FT   CDS_pept        289892..290185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafN"
FT                   /locus_tag="ECs_0259"
FT                   /product="antitoxin of the YafO-YafN toxin-antitoxin
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33682"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33682"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Q0"
FT                   /protein_id="BAB33682.1"
FT                   /translation="MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASA
FT                   FEALMDMLAEQEEKKPIKARFRPSAARLEEITRRAEKYLNDMTDDDFNDFKE"
FT   CDS_pept        290188..290586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafO"
FT                   /locus_tag="ECs_0260"
FT                   /product="mRNA interferase toxin of the YafO-YafN
FT                   toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33683"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33683"
FT                   /db_xref="InterPro:IPR020353"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7P9"
FT                   /protein_id="BAB33683.1"
FT                   /translation="MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYD
FT                   DSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRTNDESHLVYCQGAFDEQAWLLIAIL
FT                   KPEPHKLARDNNQMHKIGKMAEAFRMRF"
FT   CDS_pept        290671..291048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="ECs_0261"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33684"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33684"
FT                   /db_xref="GOA:Q8X7P8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7P8"
FT                   /protein_id="BAB33684.2"
FT                   /translation="MMTASQHYSPQQIAAWAQIDESRWKEKLAKSQVRVAVINAQPVGF
FT                   ISRIEHYIDMLFVDPEYTRRGVASALLKPWIKSESELTVDASITAKPFFERYGFQTVKQ
FT                   QRVECRGAWFTNFSMRYKPQH"
FT   CDS_pept        291355..291621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfJ"
FT                   /locus_tag="ECs_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33685"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33685"
FT                   /db_xref="GOA:Q8X7P0"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7P0"
FT                   /protein_id="BAB33685.1"
FT                   /translation="MEWYMGKYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQR
FT                   VVGMPDLHPGRGYPIGAAFFSVGRFYPTRRRGNGAGNRNGPLL"
FT   CDS_pept        291590..292090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="ECs_0263"
FT                   /product="peptide chain release factor RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33686"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33686"
FT                   /db_xref="GOA:Q8X7N9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7N9"
FT                   /protein_id="BAB33686.1"
FT                   /translation="MLETETGRYSDTLRSALISLDGDNAWALSESWCGTIQWICLSPYR
FT                   PHHGRKNWFLGIGRFTADEQEQSDAIRYETLRPSGPGGQHVNKTDSAVRATHLATGISV
FT                   KVQSERSQHANKRLARLLIAWKLEQQQQENSAVLKSQRRMFHHQIERGNPRRTFTGMAF
FT                   IEG"
FT   CDS_pept        complement(292147..293604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="ECs_0264"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33687"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33687"
FT                   /db_xref="GOA:Q8X7N8"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7N8"
FT                   /protein_id="BAB33687.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEYIVGWAKEKGF
FT                   HVERDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNNDTVHDFTKDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLADENVVHGPLEVLLTMTEEAGMDGAFGLQSNWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLHLDREAVPAGFETFKLTLKGLKGGHSGGEIHV
FT                   GLGNANKLLVRFLAGHAEELDLRLIDFNGGTLRNAIPREAFATIAVAADKVDALKSLVN
FT                   TYQEILKNELAEKEKNLALLLDSVANDKAALIAKSRDTFIRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMTDNNVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGAYPGW
FT                   QPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHS
FT                   PDEQVHIESVGHYWTLLTELLKEIPAK"
FT   CDS_pept        293865..294323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="ECs_0265"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33688"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33688"
FT                   /db_xref="GOA:P0A9M6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9M6"
FT                   /protein_id="BAB33688.1"
FT                   /translation="MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR"
FT   CDS_pept        294415..295659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="ECs_0266"
FT                   /product="fermentation-respiration switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33689"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33689"
FT                   /db_xref="GOA:Q8X7N7"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7N7"
FT                   /protein_id="BAB33689.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIP
FT                   HWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQ
FT                   AMVWQQKACAEEDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
FT                   LPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRG
FT                   IAMLTIDMPSVGFSSKWKLTQDSCLLHQRVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD
FT                   KGLQEITDWIEKRLC"
FT   CDS_pept        295717..296118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="ECs_0267"
FT                   /product="transcriptional regulator Crl"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33690"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33690"
FT                   /db_xref="GOA:Q8X7N6"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7N6"
FT                   /protein_id="BAB33690.1"
FT                   /translation="MTLPSGHPKSRLIKKFTVLGPYIREGKCEDNRFFFDCLAVCVNVK
FT                   PAPEVREFWGWWMELEAQESRFTYSYQFGLFDKAGDWKSVPVKDTEVVERLEHTLREFH
FT                   EKLRELLTTLNLKLEPADDFRDEPVKLTA"
FT   CDS_pept        complement(296157..297212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="ECs_0268"
FT                   /product="outer membrane phosphoporin protein E"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33691"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33691"
FT                   /db_xref="GOA:Q8X7N5"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7N5"
FT                   /protein_id="BAB33691.1"
FT                   /translation="MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMS
FT                   DNDSKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKY
FT                   KDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVI
FT                   DGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSR
FT                   GTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLR
FT                   PSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINND
FT                   DIVAVGMTYQF"
FT   CDS_pept        297500..298603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="ECs_0269"
FT                   /product="gamma-glutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33692"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33692"
FT                   /db_xref="GOA:P0A7B7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7B7"
FT                   /protein_id="BAB33692.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIAAGSKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVD
FT                   EGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAG
FT                   HHSQEIDAILGYEYGPVAVHRDDMITR"
FT   CDS_pept        298615..299868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="ECs_0270"
FT                   /product="gamma-glutamylphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33693"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33693"
FT                   /db_xref="GOA:Q8X7N4"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7N4"
FT                   /protein_id="BAB33693.1"
FT                   /translation="MLEQMGIAAKQASYKLAQLSSREKNRVLEKIADELEAQSEIILNA
FT                   NAQDVADARANGLSEAMLDRLALTPARLKGIADDVRQVCNLADPVGQVIDGGVLDSGLR
FT                   LERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAVILRGGKETCRTNAATVVVIQDAL
FT                   KSCGLPAGAVQAIDNPDRALVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIYVDESAEIAEALKVIVNAKTQRPSTCNTVETLLVNKNIAYSFLPALSKQMAESG
FT                   VTLHADASALAQLQTGPAKVVAVKAEEYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQH
FT                   SDAILTRDMRNAQRFVNEVDSSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGL
FT                   EALTTYKWIGIGDYTIRA"
FT   tRNA            299983..300058
FT                   /gene="thrW"
FT                   /locus_tag="ECs_R0028"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon: cgt"
FT   misc_feature    300042..310627
FT                   /product="prophage Sp1, lambda-like phage"
FT   CDS_pept        complement(300073..301047)
FT                   /transl_table=11
FT                   /gene="intD"
FT                   /locus_tag="ECs_0271"
FT                   /note="integrase"
FT                   /pseudogene="unknown"
FT   CDS_pept        complement(300938..301183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0272"
FT                   /product="phage early gene regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33695"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33695"
FT                   /db_xref="InterPro:IPR020952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFJ5"
FT                   /protein_id="BAB33695.1"
FT                   /translation="MCDTKRSIGRKCESGLAANVPLRGVFVQDYDSHTQPKLTNRRIQM
FT                   DAQTRRRERRAEKQAQWKADRILASTFRRNATKRHY"
FT   CDS_pept        complement(301423..301812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33696"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33696"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7M6"
FT                   /protein_id="BAB33696.1"
FT                   /translation="MKKAAILIDAGFFMQRVHATHRKHFAEHELTAQCIMKVIWSMVLS
FT                   HLNGKRQSQERREPLELYRIYFYDCPPLDIQTRLPLPEPGNKTPGRKNFKLEKSYILRT
FT                   ELHEELRKTRKTPIVFILKLIGATH"
FT   CDS_pept        complement(301940..302653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0274"
FT                   /product="phage repressor protein CI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33697"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33697"
FT                   /db_xref="GOA:Q8X7M5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7M5"
FT                   /protein_id="BAB33697.1"
FT                   /translation="MSAKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ
FT                   SGVGALFNGINALNAYNAALLAKILNVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY
FT                   PVFSHVQAGMFSPELRTFTKGDAEKWVSTTKKASGSAFWLEVEGNSMTAPTGSKPSFPD
FT                   GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV
FT                   VGKVIASQWPEETFG"
FT   CDS_pept        302754..302954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0275"
FT                   /product="phage repressor Cro"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33698"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33698"
FT                   /db_xref="GOA:A0A0H3JDH5"
FT                   /db_xref="InterPro:IPR000655"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDH5"
FT                   /protein_id="BAB33698.1"
FT                   /translation="MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTIN
FT                   ADGSVYAEEVKPFPSNKKTTA"
FT   CDS_pept        303073..303366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0276"
FT                   /product="phage regulatory protein CII"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33699"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33699"
FT                   /db_xref="GOA:Q8X7M4"
FT                   /db_xref="InterPro:IPR007933"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7M4"
FT                   /protein_id="BAB33699.1"
FT                   /translation="MVRANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKR
FT                   DWIPKFSMLLAVLEWGVVDDDMARLARQVAAILTNKKRPAATERSEQIQMEF"
FT   CDS_pept        303399..304321
FT                   /transl_table=11
FT                   /locus_tag="ECs_0277"
FT                   /note="phage replication protein O"
FT                   /pseudogene="unknown"
FT   CDS_pept        304318..304629
FT                   /transl_table=11
FT                   /locus_tag="ECs_0279"
FT                   /note="phage repliction protein P"
FT                   /pseudogene="unknown"
FT   CDS_pept        304629..305423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0280"
FT                   /product="phage tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33703"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33703"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDH9"
FT                   /protein_id="BAB33703.1"
FT                   /translation="MAKNDFKAFATDRNANVMSQEEWEALPALISGFTAGKASSAQVNK
FT                   VIRQASFIAAALAQFVSDKTQRDVLDNGDLPGFVELLGSGFAVEYLSRKNPFGDIKSDG
FT                   TVKTALQNLGLGEGAPAIGVPFFWPSAAMPNTVIDSWSCMVFLKFNGAKFSATDYPVLA
FT                   KVFPSLVLPEARGDFIRIWDDGRGADGGRELLSWQAATNFSQFAGNIGEGAGHAINFHD
FT                   GIAGNQPGFSRFNFTSNSVGDGVNFVAVRPRNIAFNFLVRAK"
FT   CDS_pept        305423..306016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfaE"
FT                   /locus_tag="ECs_0281"
FT                   /product="phage tail fiber assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33704"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33704"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7M0"
FT                   /protein_id="BAB33704.1"
FT                   /translation="MKPVFDENGLATVPGDMRCFYYDAETSEYTGWSDEYINTGVSMPA
FT                   CSTGIDPGENIPGRVAVFTGKGWSHEEDHRNETVYSIENGAAVTVDYIGAIKDGYVTIS
FT                   PLTPYDKWDGEKWVTDTEAQHSAAVDAAEAQRQSLIDAAMASISLIQLKLQAGRKLTQA
FT                   ETTRLNAVLDYIDAVTATDTSTAPDVIWPELPEA"
FT   CDS_pept        complement(305988..306431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdK"
FT                   /locus_tag="ECs_0282"
FT                   /product="phage tail fiber assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33705"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33705"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFK4"
FT                   /protein_id="BAB33705.1"
FT                   /translation="MDEYVYSARHNAFFPVDMIDKYKSEGWDLSDAKEVNQNIISEFMA
FT                   EPPQGKIRIAGDDGLPAWADIPPPTHEELIEITESERQLLINQANEYMNSKQWPGKAAI
FT                   GRLKGDELTQYNLWLDYLDALELVDTSGAPDIEWPTPPAVQAR"
FT   CDS_pept        complement(306452..306862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdL"
FT                   /locus_tag="ECs_0283"
FT                   /product="phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33706"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC56"
FT                   /protein_id="BAB33706.1"
FT                   /translation="MPFARYFCIFINVGLGEAAKRDVGTGENQIPDMASFASGNGWMKL
FT                   PNGKILQYGRGAVTPTLSTQTMRITFSIPFPKKADCAMLTHSGDGGAPLGAGRGFVMTA
FT                   EGPTLTGFNSAYRTSSTSDTVSMNYSWWAVGE"
FT   CDS_pept        306892..307446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pinE"
FT                   /locus_tag="ECs_0284"
FT                   /product="DNA-invertase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33707"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33707"
FT                   /db_xref="GOA:A0A0H3JBU1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBU1"
FT                   /protein_id="BAB33707.1"
FT                   /translation="MLIGYVRVSTNDQNTDLQRNALNCAGCELIFEDKISGTKSERPGL
FT                   KKLLRTLSAGDTLVVWKLDRLGRSMRHLVILVEELRERGVNFRSLTDAIDTSTPMGRFF
FT                   FHVMGALAEMERELIVERTKAGLEAARAQGRIGGRRPKLTPEQWAQAGRLIAAGIPRQK
FT                   VAIIYDVGVSTLYKKFPAGDK"
FT   CDS_pept        complement(307504..308277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33708"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33708"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7L0"
FT                   /protein_id="BAB33708.1"
FT                   /translation="MDITEFPSGVIEHLGWYVYRLIDPRDGSTFYVGKGKGNRVFAHMR
FT                   GEVAAADDDDLLSNKLKQIREIRLAGLEVIHVIHRHGMTDEKTAYEVEAALIDAYPGLT
FT                   NIMNGAGSNEFGAAHVKELIATYQPETITFHHKALMISVNRSAKDSELYDAVRFSWRIN
FT                   VSRASKAEVILATVRGIVRGVFIADKWLKSTREHFPTMKYWDEDPDFEATQSSRYGFEG
FT                   REAPPEIANLYLGKKIPDELRKKGAMSPVRYSPNF"
FT   CDS_pept        309101..309844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0287"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33710"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33710"
FT                   /db_xref="GOA:Q8X7K9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K9"
FT                   /protein_id="BAB33710.1"
FT                   /translation="MATTCSVILILESFDVYFGKESVFLERGSSVLVDSSSRDFFLTYP
FT                   ERVIVADFGAEFISRYLKANNLRDISDCREYPSYLKINFADFSLIKGLISWANHCAEYI
FT                   EIFDESIAFTCLSAFSSEKQFGVFLFGCLKSTGAKVKTIIHTDLSAPWRLKDISSRLYL
FT                   SESLLKRKLKEEGVSFSKIILDERMQMAEYLLSTRCYPISKVAKVCGYASVSYFTYVFR
FT                   RYFGVSPSQYSQRSSESKILTHQGI"
FT   repeat_region   complement(309849..310318)
FT                   /note="ISEc48 Family: IS3 partial"
FT   CDS_pept        complement(309886..310239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0288"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33711"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33711"
FT                   /db_xref="GOA:A0A0H3JC58"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC58"
FT                   /protein_id="BAB33711.1"
FT                   /translation="MLGAIEKRFGDKVPEQSIQWLTDNGSAYRAHETRQFARELNLEPC
FT                   TTAISSPQSNGIAERFVKTMKEDYIAFMPKPNVRTALHNLAVAIEHYNENHPHSALGYR
FT                   SPREYRRQRVTLT"
FT   misc_feature    310628..323514
FT                   /product="prophage Sp2, P4-like phage"
FT   CDS_pept        310807..311988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intS"
FT                   /locus_tag="ECs_0289"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33712"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33712"
FT                   /db_xref="GOA:A0A0H3JBU2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBU2"
FT                   /protein_id="BAB33712.1"
FT                   /translation="MPLNDMQIRRAKPEAKAYTFGDGLGLSLLIEPNGSKSWRFRYRYA
FT                   GKPKMISLGVYPTITLADARSRRDEARKLVAEGKNPSEVRKEQKLAMQTESENAFEKIA
FT                   REWHQLKSAKWSAGYASDIMEAFKNDIFPYVGTRPVGEIKPLELLNVLRKIEKRGALEK
FT                   MRKVRQRCSEVFRYAIATGRAEYNPAADLSSALEVHQSNHFPFLKADEIPDFLRALEGY
FT                   SGSKLVQIATKLLMITGVRTIELRAALWQEFDLDNAIWEIPAERMKMRRPHLVPLSSQA
FT                   VDLLNELKIMTGNYRYVFPGRNDPNRPMSEASINQAIKRIGYGGKVTGHGFRHTLSTIL
FT                   HEQGFESAWIEIQLAHVDKNSIRGTYNHAQYFSGRKSMMDWYSNLIFERLKRS"
FT   CDS_pept        311992..312408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33713"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33713"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K6"
FT                   /protein_id="BAB33713.1"
FT                   /translation="MSQPLSEILTWDDEQWEVFVHDWLIVCKSDDYPWSERLGGAGDKG
FT                   RDVVGYKSDPNVEGYSWDNYQCKLYKKSLGFSDVVVEFGKLIYFTLNGDYPIPQKYFFV
FT                   APYDLSTTFSNLLKNKNELKKAVLDSWDSAISKK"
FT   CDS_pept        312381..312998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33714"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33714"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K5"
FT                   /protein_id="BAB33714.1"
FT                   /translation="MGFSNFKKITKKIDIPLDDEIKKYIEDFDFSIFYSLPLSLILNDI
FT                   ANTHLYFKYFNELYVVRIPPNEIPTYNSKKESVYVNALLQAYSEHGNKTYSSFLELDDP
FT                   YRRHFNNSRNDFYFASSLEVFVREVFKDDVFKALKCYISSSIEPVFYEDHNYAFIRCNA
FT                   VLKQAVLTPIAHSVLSKICEANDKKGICHHLVNDGEVIWTVR"
FT   CDS_pept        312998..313456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33715"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33715"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K4"
FT                   /protein_id="BAB33715.1"
FT                   /translation="MVRIYNSSLEVACRMAKVLVAIYPSSLSLERLICFDFILVNLKDF
FT                   LPEEISLHPPIPRRDAQLALKREIVLESLALLQGYELASKIYTHRGFVYKASEKTYAFT
FT                   NSLHNEYVAQMEHNINLVVKLYSDIPDEQLQSIIKNKIGKYDMEFNYE"
FT   CDS_pept        313449..315268
FT                   /transl_table=11
FT                   /locus_tag="ECs_0293"
FT                   /note="AAA family ATPase"
FT                   /pseudogene="unknown"
FT   CDS_pept        complement(315678..315950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0296"
FT                   /product="transcription activator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33719"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33719"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7J1"
FT                   /protein_id="BAB33719.1"
FT                   /translation="MALKCPECGTTAHARTSAYEAPSVKRSWYQCQNLECSYTFTALES
FT                   VDTIIMKPRRNEQESEKAQMPEKQQQTLNRYGSASKLSSRQQIPV"
FT   CDS_pept        complement(315956..316507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0297"
FT                   /product="phage polarity suppression protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33720"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33720"
FT                   /db_xref="InterPro:IPR010006"
FT                   /db_xref="InterPro:IPR038395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7J0"
FT                   /protein_id="BAB33720.1"
FT                   /translation="MMARVTPDQALISFRNARILWAGHSESRKAVEQQIESLLTAMEKP
FT                   ADYARQLELQREHLDVLKWQINCAARECIYSQHQLMEACTEDALSNFMQANGAALTSAL
FT                   APFLKGRGGVDVASRILRNALVRQLAITPPEIAGDYRMILDESGVMPDPMMVRDCQSSY
FT                   TPAQQLRFQQRLDYINGMQE"
FT   CDS_pept        complement(316504..317256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0298"
FT                   /product="phage capsid size determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33721"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I9"
FT                   /protein_id="BAB33721.1"
FT                   /translation="MTIPEQNNNPIVEISIPVSTQQALEKVNATKSAWLEARRQQKAAA
FT                   DNIATIRQRRAEMEATTNALNEEWRTLFRESQGVVSKEMKKLRTEIALGRETLEDFDEL
FT                   LAAQESENALLPQEAAELAGKYIHAHDTLVGIRAKQIWEDFMQSHGKALIQTLSLLKST
FT                   MGREASAVVGVVHSVNDPDTLLKDFIHKHITRPALTNDAMPEQDPVFKLAGVAPDYAAR
FT                   LDFSNKLSPAAMHKMKVRQERAEKEKAV"
FT   CDS_pept        318190..318450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0299"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33722"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33722"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I8"
FT                   /protein_id="BAB33722.1"
FT                   /translation="MRNISVSAPAPAAPLFPVSNHHERFLRLPEVMHLCGLSRSTVYDL
FT                   ISRDAFPKQIPLGGKNVAWAQSEVSAWMADRISARGRGCDA"
FT   CDS_pept        318447..319004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0300"
FT                   /product="phage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33723"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33723"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I7"
FT                   /protein_id="BAB33723.1"
FT                   /translation="MMIPAYIKYLYSGLLTVVISRYSFSAVAKSAAGIGVPYNLLATID
FT                   APCVFFYVVAQAQPFSGLWCLCLHHGSIEIMVVRAGQPSGWPVSNKAGYANPVRAATSE
FT                   IGVSGGSNNRYLLEAAIMATILTPSHPQYVFVFAAIRRADTHPRICMLRTVSCDERSAR
FT                   RLLVRDYVLSLSARLPAGEVTL"
FT   CDS_pept        319001..319222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33724"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33724"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCC3"
FT                   /protein_id="BAB33724.1"
FT                   /translation="MNQFEISYDDVVRLKHLRNVGEYVTGMAALQDCYEKPAGAQCEQL
FT                   VSLIYLMTEQLDGVVQRCHDDLMNAEVA"
FT   CDS_pept        319222..319545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33725"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33725"
FT                   /db_xref="GOA:Q8X7I6"
FT                   /db_xref="InterPro:IPR035317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I6"
FT                   /protein_id="BAB33725.1"
FT                   /translation="MICCESLLALRAALYRRAVACAWLALSNHQERYSGLTLAELEDAI
FT                   ARELEGFYLRQHGQQRGLEIACALLSDLMESGPLKACPVLSLLGMTVMDELCSRHLNKP
FT                   ALH"
FT   CDS_pept        319559..321892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0303"
FT                   /product="phage DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33726"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33726"
FT                   /db_xref="GOA:A0A0H3JC65"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC65"
FT                   /protein_id="BAB33726.1"
FT                   /translation="MSGMKVSQAEKAARGHWSRILPALGVNVLKNRHQPCPVCAGKDRF
FT                   RFDDQEGRGTWFCNQCGAGDGLALVSKVLDVGISEAADRINGIIGNLLPVSQGMLESGS
FT                   PEKEDGRKAAAVLAARLFDKSRQTTGNAYLTSKGFPALPCRELTAMHKVGGVAFRAGDL
FT                   VVPLYADGELVNLQLINANGGKCFLKGGQVKNAFYLVEGTAKAAKRLWIAEGYATALTI
FT                   NYLTGDAVMVAFSSVNFLSLASIACSEYPTHQIIIAADRDLNGAGQTRGAAVTGACNCT
FT                   MALPPVFGDWNDAFTQNGEEATRHAIHEVIKPAVASPFDTMSEAEFTALSVSEKAQRVV
FT                   DHYKNSLAVDPNGQLLSRYEAGAWKVIYYADFARDVAALFQRLDAPFSSAKIASLVETL
FT                   KLIVPQQQNPARQLIGFRNGVLDTRTGLFSPHDKKHWLRTLCEVDYTQPVDGESLETHA
FT                   PAFWRWLDRAAGFNPEKRDIILAALFMVLANRYDWQLFLEVTGPGGSGKSILAEIATML
FT                   AGEDNATSATIEMLESPRERAALIGFSLIRLPDQEKWSGDGAGLKAITGGDAVSVDPKY
FT                   QNAYSTHIPAVILAVNNNPMRFTDRSGGVSRRRVILHFPDQIAPEERDTQLKEKIASEL
FT                   AVIVRQLMQRFSDPMSARTLLQSQQNSDEALTIKRDADSAFDFCGYLEVLPDTTGMFMG
FT                   NANIVPRQPRTYLYHAYLVYMEANGYKNTLSLTMFGKGLPLMLKEYGLQYEKRRTNQGM
FT                   QTNLALREESNADWLPKCDEFAAK"
FT   CDS_pept        complement(322025..322981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33727"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33727"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I4"
FT                   /protein_id="BAB33727.1"
FT                   /translation="MTSYSNFSNQIKETINNKFDHEIHDWDIIKNSITTLINKNIHGAG
FT                   RNIVDFIDLGNWDFISNFSFDDSTRRLELEWHPNDKFHIYIESVVFVEFNDTIYAFLKG
FT                   YYHNQLSLNRIYNTKCSSCSFENSGSYMVDVYRTVKRVNETIQTPNINCYTTCILTRPA
FT                   NGHVTSTGFSRNLMDAINISLAEHKIASLHNEVMSIEEYDRDSLQEKGNTARRYLEYIL
FT                   MLVNIRIMHLNNVQYQEQMLGSLVSVIEALDYEPLMKNDVEITKDILNACSHHGGVRIE
FT                   KKDVIFSLEVIENLIKAIKKTDINKLQLDGMFKSIQK"
FT   CDS_pept        complement(323657..324556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagP"
FT                   /locus_tag="ECs_0305"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33728"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33728"
FT                   /db_xref="GOA:Q8X5E9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5E9"
FT                   /protein_id="BAB33728.2"
FT                   /translation="MKIDLNLLPIFIAVAEESNFSKAAARLGVTRSAVSQGIRRLEDAF
FT                   GTMLVMRTTRSVNLTEAGERLHKSLSLPLSGIEAAFEEMVSDHVPRGLLRIAVTSIAEE
FT                   FLSGPLIASFAAANPAVTLDIVVTDEEFDIVAAGYDAGVRLGEVIEKDMIAVPLTGRQR
FT                   EMVVASPSYLAANSTPVHPRELVNHKCIGWRQSPEVAPYRWPFEENGRAFDLAIEPQIT
FT                   TNDLRLMLRLALAGGGITIATQETFRPYIESGKLVSLLDDFLPQFPGFYLYFPQRRNIA
FT                   PKLRALIDHVKEWRQQLA"
FT   CDS_pept        324655..325377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0306"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33729"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33729"
FT                   /db_xref="GOA:Q8X6K1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6K1"
FT                   /protein_id="BAB33729.1"
FT                   /translation="MDKVILITGASSGIGEGIARELGMTGAKVLLGARRVERIEAIATE
FT                   ICRAGGIAKARELDVTDRQSMADFVQAALDSWGRVDVLINNAGVMPLSPLAAGKQDEWA
FT                   LTIDVNIKGVLWGIGAVLPVMEAQGSGQIINLGSIGALSVVPTGAVYCASKFAVRAISD
FT                   GLRQESSKIRVTCVNPGVVESELASTITHVETMKAMDAYRSVALQPADIARAVRHIIES
FT                   PESVDTTEITIRPTASAN"
FT   CDS_pept        325544..325822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0307"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33730"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33730"
FT                   /db_xref="GOA:Q8X6K0"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6K0"
FT                   /protein_id="BAB33730.1"
FT                   /translation="MSLYIKLILSIVREISVNTICSLIVVVALSLLSFSSVAKTITAVG
FT                   STINSTEKEISLQAEKQGKSYKILGAFFKNRVYMIAKLTPVSKNDAS"
FT   CDS_pept        complement(326525..327427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0309"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33732"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33732"
FT                   /db_xref="GOA:A0A0H3JBU6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBU6"
FT                   /protein_id="BAB33732.1"
FT                   /translation="MKGNVSMAKRENYNELYLFMQVVREGSFTAAAKRLGLAQSGVSRS
FT                   VRELEERLGVQLLVRTTRKLSLTQAGEQLYQKTASGFEMLDLGLATLAHYRETPSGTVR
FT                   INASQHAIDKCLLPKLAVFKQRYPDIQLELINESRFVDIIEERFDAGVRLGPEVSQGMV
FT                   AVRITPDMEMAIVGTPEHFRRYGFPQTPADLKAHPCIAYQFADGSVYQWELNQDDKKIT
FT                   HQPEGQWAFSDSYMEAEAARLGLGLAYVPVELVADDLEHGKLIRVLQRYSLRMEGLFLY
FT                   YPHRNVSPALRMVIDTLKI"
FT   CDS_pept        327673..328731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33733"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33733"
FT                   /db_xref="GOA:Q8X6J7"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6J7"
FT                   /protein_id="BAB33733.2"
FT                   /translation="MSYADSTNPNAPVSMTDKWDKTFAESQKVDHRKVSFPNRYGITLV
FT                   GDLYLPKDRGDRKLAAIAVSGPFGAVKEQSSGLYAQTLAERGFVTLAFDPSYTGESGGY
FT                   PRNVASPDINTEDFSAAVDFLGLQKEVDRNRIGLLGICGWGGMALNDAAMDTRVKAVAT
FT                   SVMYDMSRAMGHGVGDGEDRYSTADRRAVLQYLNEQRWKDAQSGTFAHGGHDINVDSNG
FT                   KVSAGERILPETLPANPHPVLKEFFDYYRMPRGFHERSVNSTGAWTATMPLSFMNMPLL
FT                   SYASEITIPTLIVTGEKAHSRYFAEDAYKAVGSKDKELVVVPGANHVDLYDNVAGKIPF
FT                   AKFEQFFQTKLK"
FT   CDS_pept        328873..330000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0311"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33734"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33734"
FT                   /db_xref="GOA:Q8X4N6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4N6"
FT                   /protein_id="BAB33734.2"
FT                   /translation="MTLCVFVLIASEFMPVSLLTPIARDLGVTEGLAGRGIAISGALAV
FT                   LTSLTLSTLAGKMNRKFLLLGMTVLMAVSGLIIALATSYLMYMVGRAMIGVAIGGFWSM
FT                   SAATAIRLVPQHQVTRALAIFNAGNALATVVAAPLGSYLGATVGWRGAFLCLVPMAVVA
FT                   FIWQCISLPSMDANKSHTSCGAVFRLFSRRMVVVGMIACGLFFMGQFALFTYVRPFLES
FT                   VTRVNSLGLSLILLIIGVAGFIGTLVVSIFLNRKCYPTLMAIPGLMAVIAIGLMLTGHH
FT                   VWMVSLLLGLWGMLATAAPTGWWTWIARTLPDNAEAGGGLMVAVIQLSIALGSTAGGIV
FT                   FDRLGWQSTFAMSSVLLLCAGVLTFVTARQKAGAL"
FT   CDS_pept        complement(330179..331135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoD"
FT                   /locus_tag="ECs_0313"
FT                   /product="moco insertion factor for PaoABC aldehyde
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33736"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33736"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6J5"
FT                   /protein_id="BAB33736.1"
FT                   /translation="MSYPLFDKDEHWHKPEQAFLTDDHRTILRFAVEALMSGKGAGLVT
FT                   LVEIRGGAARPLGAQMVVREDGRYCGFVSGGCVEAAAAFEALEMMGSGCDREIRYGEGS
FT                   PWFDIVLPCGGGITLTLHKLRSAQPLLAVLNRLEQRKPAGLRYDPQAQSLVCLPTQTRT
FT                   GWNLNGFEVGFRPCVRLMIYGRSLEAQATASLAAATGYDSHIFDLFPASASAQIDTDTA
FT                   VILLCHDLNRELPVLQAAREAKPFYLGALGSYRTHTLRLQKLHELGWSREETAQIRAPV
FT                   GIFPKARNAHTLALSVLAEVASVRLHQEEDSCLPPSS"
FT   CDS_pept        complement(331145..333343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoC"
FT                   /locus_tag="ECs_0314"
FT                   /product="moco-containing subunit of PaoABC aldehyde
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33737"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33737"
FT                   /db_xref="GOA:Q8X6J4"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6J4"
FT                   /protein_id="BAB33737.1"
FT                   /translation="MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEES
FT                   PNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLPVITASNAGALSKGDKNTARLLGGPT
FT                   IEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVSQPPEDTPDKNVG
FT                   DFDGAFSSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAK
FT                   TLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTH
FT                   RPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLAT
FT                   LDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQIDPADPTRRFSRR
FT                   QLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEPNGT
FT                   VTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTS
FT                   GVYAACVKLREMIASAVGFDPEQSQFADGKITNGTRSAILHEATAGGRLTAEESIEFGT
FT                   LSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMG
FT                   AALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV"
FT   CDS_pept        complement(333340..334296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoB"
FT                   /locus_tag="ECs_0315"
FT                   /product="FAD-containing subunit of PaoABC aldehyde
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33738"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33738"
FT                   /db_xref="GOA:Q8X6J0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6J0"
FT                   /protein_id="BAB33738.1"
FT                   /translation="MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLVAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPL
FT                   GGKHIYRKVRDRASYTFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDALFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
FT   CDS_pept        complement(334293..334982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagT"
FT                   /locus_tag="ECs_0316"
FT                   /product="xanthine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33739"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33739"
FT                   /db_xref="GOA:Q8X6I9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I9"
FT                   /protein_id="BAB33739.1"
FT                   /translation="MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAAAAVVYPHS
FT                   TLAASVPAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDALRENLHLIGTKKGCDHGQC
FT                   GACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTS
FT                   GQICSSVAVLKEIQDGIPSHVTVDLVSPPERTADEIRERMSGNICRCGAYANILAAIED
FT                   AAGEIKS"
FT   CDS_pept        335400..336014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagU"
FT                   /locus_tag="ECs_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33740"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33740"
FT                   /db_xref="GOA:P0AAA2"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAA2"
FT                   /protein_id="BAB33740.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
FT   CDS_pept        complement(336904..337614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpE"
FT                   /locus_tag="ECs_0319"
FT                   /product="ECP production pilus chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33742"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33742"
FT                   /db_xref="GOA:Q8X6I6"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I6"
FT                   /protein_id="BAB33742.2"
FT                   /translation="MFRRRGVTLTKALLTAVCMLAAPLTQAISVGNLTFSLPSETDFVS
FT                   KRVVNNNKSARIYRIAISAIDSPGSSELRTRPVDGELLFAPRQLALQAGESEYFKFYYH
FT                   GPQDNRERYYRVSFREVPTRNLTKRSPTGGEVSTEPVVVMDTILVVRPRQVQFKWSFDQ
FT                   VTGTVSNTGNTWFKLLIKPGCDSTEEEGDAWYLRPEDVVHQPELRQPGNHYLVYNDKFI
FT                   KISDSCPAKPPSAD"
FT   CDS_pept        complement(337583..339226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpD"
FT                   /locus_tag="ECs_0320"
FT                   /product="polymerized tip adhesin of ECP fibers"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33743"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33743"
FT                   /db_xref="GOA:Q8X4N4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X4N4"
FT                   /protein_id="BAB33743.1"
FT                   /translation="MRVNLLIAMIIFALIWPVTALRAAVSKTTWADAPAREFVFVENNS
FT                   DDNFFVTPGGALDPRLTGANRWTGLKYNGSGTIYQQSLGYIDNGYNTGLYTNWKFDMWL
FT                   ENSPVSSPLTGLRCINWYAGCNMTTSLILPQTTDTSGFYGATVTSGGAKWMHGMLSDAF
FT                   YQYLQQMPVGSSFTMTINACQTSVNYDASSGARCKDQASGNWYVRNVTHTKAANLRLIN
FT                   THSLAEVFINSDGVPTLGEGNADCRTQTIGSRSGLSCKMVNYTLQTNGLSNTSIHIFPA
FT                   IANSSLASAVGAYDMQFSLNGSSWKPVSNTAYYYTFNEMKSADSIYVFFSSNFFKQMVN
FT                   QGISDINTKDLFNFRFQNTTSPESGWYEFSTSNTLIIKPRDFSISIISDEYTQTPSREG
FT                   YVGSGESALDFGYIVTTSGKTAADEVLIKVTGPAQVIGGRSYCVFSSDDGKAKVPFPAT
FT                   LSFITRNGATKTYDAGCDDSWRDMTDALWLTTPWTDISGEVGQMDKTTVKFSIPMDNAI
FT                   SLRTVDDNGWFGEVSASGEIHVQATWRNIN"
FT   CDS_pept        complement(339216..341741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpC"
FT                   /locus_tag="ECs_0321"
FT                   /product="ECP production outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33744"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33744"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I4"
FT                   /protein_id="BAB33744.1"
FT                   /translation="MPLRRFSPGLKAQFAFGMVFLFVQPDASAADISAQQIGGVIIPQA
FT                   FSQALQDGMSVPLYIHLAGSQGRQDDQRIGSAFIWLDDGQLRIRKIQLEESEDNASVSE
FT                   QTRQQLMALANAPFNEALTIPLTDNAQLDLSLRQLLLQLVVKREALGTVLRSRSEDIGQ
FT                   SSVNTLSSNLSYNFGIYNNQLRNGGSNTSSYLSLNNVTALREHHVVLDGSLYGIGSGQQ
FT                   DSELYKAMYERDFAGHRFAGGTLDTWNLQSLGPMTAISAGKIYGLSWGNQASSTIFDSS
FT                   QSATPVIAFLPAAGEVHLTRDGRLLSVQNFTMGNHEVDTRGLPYGIYDVEVEVIVNGRV
FT                   ISKRTQRVNKLFSRGRGVGAPLAWQVWGGSFHMDRWSENGKKTRPAKESWLAGASTSGS
FT                   LSTLSWAATGYGYDNQAVGETRLTLPLGGAINVNLQNMLASDSSWSSIGSISATLPGGF
FT                   SSLWVNQEKTRIGNQLRRSDADNRAIGGTLNLNSLWSKLGTFSISYNDDRRYNSHYYTA
FT                   DYYQNVYSGTFGSLGLRAGIQRYNNGDSNANTGKYIALDLSLPLGNWFSAGMTHQNGYT
FT                   MANLSARKQFDEGTIRTVGANLSRAISGDTGDDKTLSGGAYAQFDARYASGTLNVNSAA
FT                   DGYVNTNLTANGSVGWQGKNIAASGRTDGNAGVIFNTGLEDDGQISAKINGRIFPLNGK
FT                   RNYLPLSPYGRYEVELQNSKNSLDSYDIVSGRKSHLTLYPGNVAVIEPEVKQMVTVSGR
FT                   IRAEDGTLLANARINNHIGRTRTDENGEFVMDVDKKYPTIDFRYSGNKTCEVALELNQA
FT                   RGAVWVGDVVCSGLSSWAAVTQTGEENES"
FT   CDS_pept        complement(341767..342435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpB"
FT                   /locus_tag="ECs_0322"
FT                   /product="ECP production pilus chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33745"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33745"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I2"
FT                   /protein_id="BAB33745.1"
FT                   /translation="MKKHLLLLALLLSGISPAQALDVGDISSFMNSDSSTLSKTIKNST
FT                   DSGRLINIRLERLSSPLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEK
FT                   ERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQANYHFQYANGTLTNTG
FT                   NATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK
FT                   "
FT   CDS_pept        complement(342493..343080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpA"
FT                   /locus_tag="ECs_0323"
FT                   /product="ECP pilin"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33746"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33746"
FT                   /db_xref="GOA:P0AAA4"
FT                   /db_xref="InterPro:IPR016514"
FT                   /db_xref="InterPro:IPR038478"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAA4"
FT                   /protein_id="BAB33746.1"
FT                   /translation="MKKKVLAIALVTVFTGMGVAQAADVTAQAVATWSATAKKDTTSKL
FT                   VVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGST
FT                   LNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGT
FT                   TNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS"
FT   CDS_pept        complement(343155..343697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpR"
FT                   /locus_tag="ECs_0324"
FT                   /product="transcriptional regulator for the ecp operon"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33747"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33747"
FT                   /db_xref="GOA:Q8X6I1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I1"
FT                   /protein_id="BAB33747.2"
FT                   /translation="MECQNRSDKYIWSPHDAYFYKGLSELIVDIDRLIYLSLEKIRKDF
FT                   VFINLNTDSLTEFINRDNEWLSAVKGKQVVLIAARKSEALANYWYYNSNIRGVVYAGLS
FT                   RDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMLPKSIARIENCSVKTVYTH
FT                   RRNAEAKLYSKLYKLVQ"
FT   CDS_pept        344522..344713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgL"
FT                   /locus_tag="ECs_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33749"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6H7"
FT                   /protein_id="BAB33749.1"
FT                   /translation="MQAASQREETEWRVQSKRGLMPAYRGEAGQQVNINIMEYSERNVR
FT                   QLTLNEQEDTSPGKLMLV"
FT   CDS_pept        complement(344783..344923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgO"
FT                   /locus_tag="ECs_5701"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="GOA:A0A2Z5XFS5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5XFS5"
FT                   /protein_id="BBE29395.1"
FT                   /translation="MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKK
FT                   R"
FT   CDS_pept        complement(344923..345189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="ECs_0327"
FT                   /product="50S ribosomal protein L31 type B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33750"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33750"
FT                   /db_xref="GOA:P0A7N3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7N3"
FT                   /protein_id="BAB33750.2"
FT                   /translation="MMKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPY
FT                   VTIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRFVSTKKGA"
FT   repeat_region   345358..347799
FT                   /note="ISEc8 Family: IS66"
FT   CDS_pept        345450..345830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0328"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33751"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33751"
FT                   /db_xref="GOA:Q7DC34"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC34"
FT                   /protein_id="BAB33751.2"
FT                   /translation="MQKNVTPGRRKGCPNYPPEFKQQLVAASCEPGISISKLALENGIN
FT                   ANLLFKWRQQWREGKLLLPSSESPQLLPVTLDAAAEQPESLAEDPETLSISCEVTFRHG
FT                   TLRFNGNVSEKLLTLLIQELKR"
FT   CDS_pept        345827..346174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0329"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33752"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33752"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC33"
FT                   /protein_id="BAB33752.1"
FT                   /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFI
FT                   FRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTQAQLAMLLEGIDWRQ
FT                   PKRLLTSLTML"
FT   CDS_pept        346224..347762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0330"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33753"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33753"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC32"
FT                   /protein_id="BAB33753.1"
FT                   /translation="MNDISSDDIFLLKQRLAEQEALIHALQEKLSNREREIDHLQAQLD
FT                   KLRRMNFGSRSEKVSRRIAQMEADLNRLQKESDTLTGRVYDPAVQRPLRQTRTRKPFPE
FT                   SLPRDEKRLLPAAPCCPNCGGSLSYLGEDTAEQLELMRSAFRVIRTVREKHACTQCDAI
FT                   VQAPAPSRPIERGIAGPGLLARVLTSKYAEHTPLYRQSEIYGRQGVELRRSLLSGWVDA
FT                   CCRLLSPLEEALHGYVMTDGKLHADDTPVQVLLPGNKKTKTGRLWAYVRDDRNAGSALA
FT                   PAVWFAYSPDRKGIHPQTHLACFSGVLQADAYAGFNELYRNGGITEAACWAHARRKIHD
FT                   VHVRIPSALTEEALEQIGQLYAIEADIRGMPAEQRLAERQRKTKPLLKSLESWLREKMK
FT                   TLSRHSELAKAFAYALNQWPALTYYANDGWVEIDNNIAENALRAVSLGRKNFLFFGSDH
FT                   GGERGALLYSLIGTCKLNDVDPESYLRHVLGVIADWPVNRVSELLPWRIALPAE"
FT   CDS_pept        complement(348574..349716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0331"
FT                   /product="NADH-dependent flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33754"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33754"
FT                   /db_xref="GOA:Q8X6H2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6H2"
FT                   /protein_id="BAB33754.1"
FT                   /translation="MTNKHPSLFSPFMLTEKIKLRNRIVMAPMTTWSANPDGTISEQEL
FT                   EFYKRRSQNVGLVITGCTYVTPSGIGFTHEFAAYDDRFINSLEKLAAAAKSGGAPAILQ
FT                   IFHAGNKAIPELVPNNDVISASASSVKSGDFMKRVVQSREMTENEIQETIRAFGDVTKR
FT                   AIKAGFDGIELHGAHGFLLQNFFSPLFNQRNDRWGGDLEGRMRFPLAVLQEVKNVVYEY
FT                   ATKPFAIGYRISPEESATGGLRIEDTYKLLDRLISSGISYIHTSLVSINDSYPVESPNG
FT                   PRTIELILNHIAGRVPVIAAGKIRTPSQAQEAISTGLPLVAIGKGLVINPEWVTLAESG
FT                   RGHEIQTTLNPQLVPELTIPDKLWDQIQASKGTGWFPLMD"
FT   CDS_pept        complement(349951..350871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycjY"
FT                   /locus_tag="ECs_0332"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33755"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33755"
FT                   /db_xref="GOA:Q8X6H1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6H1"
FT                   /protein_id="BAB33755.1"
FT                   /translation="MKTVSIKHTYWDIAADIYFPDDFNSEKKYPAIISAHPIGSCKEQT
FT                   SGSVYGAALAKAGFIVIAFDASFQGSSGGEPRYLEDPTMRVKDFSIVVDYLTSLPYVDA
FT                   GRIGVLGICGGGGYAINAAMTERRIKAIGTVTGANYGRLMREGFTAFNPIGALEAMAQQ
FT                   RTDEANGAKLRVDDLLPSSPDAALEAGLTEIDLFEATEYYRSPRGYAPNGVNRSLFSHQ
FT                   TVAVGWDAFHLAEVLLTQPIMVVVGDRVGAFGAYRDGCEIIGRAASKHKELVVVEGYSH
FT                   YDLYDKPEPVKQALDKLIPFYKTHL"
FT   CDS_pept        351028..351954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycaN"
FT                   /locus_tag="ECs_0333"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33756"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33756"
FT                   /db_xref="GOA:A0A0H3JCD5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCD5"
FT                   /protein_id="BAB33756.1"
FT                   /translation="MMKIEPSILPSLAWFALIVRAGSFSRAVSEMGITLAALSQNLKSL
FT                   EERLNTKLIYRTTRNISLTEEGQRLYEVLVSALGQIDDALKDVGDTQLEPTGLLRINSS
FT                   RVAARMLVEPHIGEFLTRYPKTKIELIMDDGLSNIIADGCDVGIRLEQGLDEHMTAVPV
FT                   SPLIKLVTVASPDYLKEHGIPETPQELSNHNCLRLRHKSSGALSAWEFSKVVGGNEEFE
FT                   IEVSGKYISNDDESMIRMALNGTGIIQHLDFAIAEHINAGKLQPILEDWAVSFPGFYIY
FT                   VSSRVRMPSKVRAFIDFMVEKRVKLEN"
FT   CDS_pept        complement(352242..352598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33757"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33757"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6G9"
FT                   /protein_id="BAB33757.1"
FT                   /translation="MNKNLILAFALFSLPVFAEEDLGPGKYVCDIRISSLDTATQILSK
FT                   SATVLDNGNNFIVQMPNGDQLYSPDLENVDDGIKQKATIGGVTFIRRPTFNDRFIVEDG
FT                   NTGFFYKMRNCEKK"
FT   CDS_pept        complement(352791..353366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0335"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33758"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33758"
FT                   /db_xref="GOA:Q8X6G4"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6G4"
FT                   /protein_id="BAB33758.1"
FT                   /translation="MQKVKLNNGIEMPLLGFGVFQMTDAAECERAVIDAINTGYRLIDT
FT                   AASYQNEPQVGNALKQSGIARNELFVTTKLWLQDTSYEGAKAQFERSLNRLQLDYVDLY
FT                   LIHQPYGDVHGAWRAMEELQQAGKIRAIGVSNFHPDRLADLIAFNNVVPAVNQVEVNPF
FT                   NQQLHAVPWMQSRGIQPEAWAPFAVTGR"
FT   CDS_pept        353932..358185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0336"
FT                   /product="invasin"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33759"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33759"
FT                   /db_xref="GOA:Q8X6G3"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6G3"
FT                   /protein_id="BAB33759.1"
FT                   /translation="MSRYKTGHKQPRFRYSVLARCVAWANISVQVLFPLAVTFTPVMAA
FT                   RAQHAVQPRLSMGNTTVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKA
FT                   NQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQ
FT                   SNIGFGWRHFSGNDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWK
FT                   KSPDIEDYQERPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAI
FT                   SAEVTYTPVPLLTLSAGHKQGKSGENDTRFGLEVNYRIGEPLAKQLDTDSIRERRVLAG
FT                   SRYDLVERNNNIVLEYRKSEVIRIALPERIEGKGGQTLSLGLVVSKATHGLKNVQWEAP
FT                   SLLAEGGKITGQGSQWQVTLPAYRPGKDNYYAISAVAYDNKGNTSKRVQTEVVITGAGM
FT                   SADRTALTLDGQSRIQMLANGNEQKPLVLSLRDAEGQPVTGMKDQIKTELTFKPAGNIV
FT                   TRSLKATKSQAKPTLGEFTETEAGVYQSVFTTGTQSGEATITVSVDGMSKTVTAELRAT
FT                   MMDVANSTLSANEPSGDVVADGQQAYTLTLTAVDSEGNPVTGEASRLRFVPQDTNGVTV
FT                   GAISEIKPGVYSAAVSSTRAGNVVVRAFSEQYQLGTLQQTLKFVAGPLDAAHSSITLNP
FT                   DKPVVGGTVTAIWTVKDAYDNPVTSLTPEAPSLAGAAAEGSTASGWTNNGDGTWTAQIT
FT                   LGSTAGELEVMPKLNGQNAAANAAKVTVVADALSSNQSKVSVAEDHVKAGESTTVTLVA
FT                   KDAHGNAISGLALSASLTGTASEGATVSSWTEKGNGSYVATLTTGGKTGELRVMPLFNG
FT                   QPAATEAAQLTVIAGEMSSANSTLVADNKAPTVKTTTELTFTVKDAYGNPVTGLKPDAP
FT                   VFSGAASTGSERPSAGNWTEKGNGVYVSTLTLGSAAGQLSVMPRVNGQNAVAQPLVLNV
FT                   AGDASKAEIRDMTVKVNNQLANGQSANQITLTVVDTYGNPLQGQEVTLTLPQGVTSKTG
FT                   NTVTTNAAGKADIELMSTVAGEHNISASVNGAQKTVTVKFNADASTGQANLQVDAAAQK
FT                   VANGKDAFTLTANVEDKNGNPVPGSLVTFNLPRGVKPLTGDNVWVKANDEGKAELQVVS
FT                   VTAGTYEITASAGNSQPSNTQTITFVADKATATVSGIEVIGNYALADGNAKQTYKVTVT
FT                   DANNNLLKDSEVTLTASPANLVLTPNGTAKTNEQGQAIFTATTTVAAKYTLTAKVSQAD
FT                   GQESTKTAESKFVADDTNAVLTASSDVTSLVADGISTAKLEVTLMSANNPVGGNMWVDI
FT                   KTPEGVTEKDYQFLPSKNDHFVSGKITRTFSTSKPGVYTFTFNALTYGGYEMKPVTVTI
FT                   TAVDADTAKGEEAMN"
FT   CDS_pept        complement(358306..359163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgA"
FT                   /locus_tag="ECs_0337"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33760"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33760"
FT                   /db_xref="GOA:Q8X6G2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6G2"
FT                   /protein_id="BAB33760.2"
FT                   /translation="MIRQKILQQLLEWIECNLEHPISIEDIAQKSGYSRRNIQLLFRNF
FT                   MHVPLGEYIRKRRLCRAAILVRLTAKSMLDIAISLHFDSQQSFSREFKKLFGCSPRVYR
FT                   HRDYWDLANIFPSFLIRQQQKTECRLVNFPETPIFGNSFKYDIEVSNKSPDEEVKLRRH
FT                   HLARCMKNFKTDTYFVSTFEPSTKSVDLLTVETFAGTVCKQTDSEMPKEWTINRGLYAS
FT                   FRYEGEWEHYPEWARNLYLMELPARGLARVNGSDIERFYYNEDFVEKDSNDVVCEIFIP
FT                   VRPV"
FT   CDS_pept        359412..360281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0338"
FT                   /product="reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33761"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33761"
FT                   /db_xref="GOA:A0A0H3JCD7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCD7"
FT                   /protein_id="BAB33761.1"
FT                   /translation="MEFSVLSNNLKMPMMGFGVFQVTDKNVCKQSVLNAIRTGYRLIDT
FT                   AAVYGNEDAVGEAVREAISEGLCTREELFITSKLWVQDMLNQDTAAAGIEASLKKSGLE
FT                   YFDLYLLHQAMRDYFSAWRALEDAYEEGKLKAIGVSNFYPHVLANFCETVRVKPMVNQV
FT                   ELHPYFAQPEALATMKYYNVQPEAWAPLGGGRHKPFENNLLQSIADAHQKSISQVILRW
FT                   NIQRGVVVIPKSTHQQRIEENFAIWDFSLTEKEMAQISSLDLGYVGESVKHFNPEFVRG
FT                   CLAVKIHD"
FT   CDS_pept        complement(360441..361034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rclC"
FT                   /locus_tag="ECs_0340"
FT                   /product="reactive chlorine species stress resistance inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33762"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33762"
FT                   /db_xref="GOA:Q8X6F8"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6F8"
FT                   /protein_id="BAB33762.1"
FT                   /translation="MEKYLHLLSRGDKIGLALIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQSANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSAREILKQGSNESSSTLKTEY"
FT   CDS_pept        complement(361391..362716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rclA"
FT                   /locus_tag="ECs_0342"
FT                   /product="pyridine nucleotide-dependent disulfide
FT                   oxidoreductase of reactive chlorine stress species RCS
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33765"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33765"
FT                   /db_xref="GOA:Q8X4N3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4N3"
FT                   /protein_id="BAB33765.2"
FT                   /translation="MNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCIN
FT                   IGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVINGQAEFINN
FT                   HSLRVHRPEGNLEIHGEKIFINTGAQTVVPPIPGITTTPGVYDSTGLLNLKELPGHLGI
FT                   LGGGYIGVEFASMFANFGSKVTILEAASLFLPREERDIADNIATILRDQGVDIILNAHV
FT                   ERISHHENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGAIVVDKRLH
FT                   TTADNIWAMGDVTGGLQFTYISLDDYRIVRDELLGEGKRSTDDRKNVPYSVFMTPPLSR
FT                   VGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRILGASLLCVDS
FT                   HEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLNDLFSLVK"
FT   CDS_pept        362942..363796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rclR"
FT                   /locus_tag="ECs_0343"
FT                   /product="reactive chlorine species-specific activator of
FT                   the rcl genes"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33766"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33766"
FT                   /db_xref="GOA:Q8X6F3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6F3"
FT                   /protein_id="BAB33766.1"
FT                   /translation="MDALSRLLMLNAPQGTIDKNCVLGSDWQLPHGAGELSVIRWHALT
FT                   QGAAKLEMPTGEIFTLRPGNVVLLPQNSAHRLSHVDNESTCIVCGTLRLQHSARYFLTS
FT                   LPETLFLAPVNHSVEYNWLREAIPFLQQESRSAMPGVDALCSQICATFFTLAVREWIAQ
FT                   VNTEKNILSLLLHPRLGAVIQQMLEMPGHAWSVESLASIAHMSRASFAQLFRDVSGTTP
FT                   LAVLTKLRLQIAAQMFSREMLPVVVIAESVGYASESSFHKAFVREFGCTPGEYRERVRQ
FT                   LAP"
FT   CDS_pept        364323..365042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="ECs_0344"
FT                   /product="cysteine-rich LutA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33767"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33767"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6E9"
FT                   /protein_id="BAB33767.1"
FT                   /translation="MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQP
FT                   AINSGYIKEAIPGMKNLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAEKV
FT                   AARMQDLTSFIVNKLGVVDVGASLQGRAVYHPSCSLARKLGVKDEPLTLLKNVRGLELL
FT                   TFAEQDTCCGFGGTFSVKMAEISGEMVKEKVAHLMEVRPEYLIGADVSCLLNISGRLQR
FT                   EGQKVKVMHIAEVLMSR"
FT   CDS_pept        365053..366480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="ECs_0345"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33768"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33768"
FT                   /db_xref="GOA:Q8X6E7"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6E7"
FT                   /protein_id="BAB33768.1"
FT                   /translation="MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GLWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFAKTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDNVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
FT   CDS_pept        366473..367168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="ECs_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33769"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33769"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6E5"
FT                   /protein_id="BAB33769.2"
FT                   /translation="MDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQ
FT                   RCDAFIQFASDVMLTRCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQ
FT                   QECNAVVWDPAKGAKNISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPESS
FT                   LFILRKSTLLPRVAQLAERLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVK
FT                   AVYLIIEDC"
FT   CDS_pept        complement(367663..368079)
FT                   /transl_table=11
FT                   /locus_tag="ECs_0348"
FT                   /note="hypothetical protein"
FT                   /pseudogene="unknown"
FT   CDS_pept        complement(368261..368473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0349"
FT                   /product="autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33772"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33772"
FT                   /db_xref="GOA:A0A0H3JCE2"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCE2"
FT                   /protein_id="BAB33772.2"
FT                   /translation="MLRDPQLLMLWLRLGDESVNASIDGAAFRVGAGVQADITKNMGAY
FT                   ASLDYTKGDDIENPLQGVVGINVTW"
FT   CDS_pept        complement(368427..369521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0350"
FT                   /product="autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33773"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33773"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFQ9"
FT                   /protein_id="BAB33773.1"
FT                   /translation="MKNSKAFYRSALATAIVMALSAPAFAADNAVSTDSVTLNKDKTTL
FT                   DQDVVISNTADKQITAVTINAADEDLNVAFAGHDITAESTADKKFVEGVKVSGNKNVVI
FT                   NATDSTITAQGEGTYVRTAMVIDSTGDVVVNGGNFVAKNEKGSATGISLEGAKGNNVTL
FT                   NGTTINAQGNKSSSNASTAIFAQKGSLLNSFEGDATDNITLAGSNIINGRIETIVTAGN
FT                   KTGIHTVNLNIKDGSVIGAANNKQTIYASASAQGTGSATQNLNLSVADSTIYSDVLALS
FT                   ESENSAATTTNVNMNVARSYWEGNAYTFNSGDKAGSNLDINLSDSSVWKGKVSGAGNAS
FT                   VSLQNESVWNVTGSSTVDALAPSG"
FT   CDS_pept        complement(369563..370324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyxA"
FT                   /locus_tag="ECs_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33774"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33774"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6D5"
FT                   /protein_id="BAB33774.1"
FT                   /translation="MRFVLFCPSGIVPAQFAALSTGSVGNVTCIGTEEELRNKLRHRPQ
FT                   SVVISAGRPAECAEMWFRFYRDHSFVVVLCVAPFFLPPDVSISGVLKNLRLLKPGMSVE
FT                   HVISIANSSGGLSGLKHAENLPVMDSYSVFMKEVNNRTKTIVMSERFPEKQKKVLSLLL
FT                   AGHSWEYSAQFLKTGIRQIWLAEQSLKKRWGIPDSMSLREALLLSSNKFHGDGNALEKT
FT                   NAMTLRENGNTNRYSVVVNAGTQVLSLHKYK"
FT   CDS_pept        complement(371105..371272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyxR"
FT                   /locus_tag="ECs_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33775"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBV2"
FT                   /protein_id="BAB33775.2"
FT                   /translation="MKKPLVIISACQFTRLALESLIPADRYIVRVYSNVTTEVEFVLKT
FT                   SCGYLLADIP"
FT   CDS_pept        complement(371781..372221)
FT                   /transl_table=11
FT                   /locus_tag="ECs_0355"
FT                   /note="invertasae"
FT                   /pseudogene="unknown"
FT   CDS_pept        372408..372542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33779"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFR4"
FT                   /protein_id="BAB33779.1"
FT                   /translation="MCVTSNVLVMFSSFEIFDVISYKVVFIVYLIDFICILSFNEVIV"
FT   CDS_pept        complement(373224..374912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="ECs_0357"
FT                   /product="choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33780"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33780"
FT                   /db_xref="GOA:Q8X6C6"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6C6"
FT                   /protein_id="BAB33780.1"
FT                   /translation="MQFDYIIIGAGSAGNVLATRLTEDPNTSVLLLEAGGPDYRFDFRT
FT                   QMPAALAFPLQGKRYNWAYETEPEPFMNNRRMECGRGKGLGGSSLINGMCYIRGNAMDL
FT                   DNWAKEPGLENWSYLDCLPYYRKAETRDVGENDYHGGDGPVSVTTSKPGVNPLFEAMIE
FT                   AGVQAGYPRTDDLNGYQQEGFGPMDRTVTPQGRRASTARGYLDQAKSRPNLTIRTHAMT
FT                   DHIIFDCKRAVGVEWLEGDSTIPTRATANKEVLLCAGAIASPQILQRSGVGNAELLAEF
FT                   DIPLVHDLPGVGENLQDHLEMYLQYECKEPVSLYPALQWWNQPKIGAEWLFGGTGVGAS
FT                   NHFEAGGFIRSREEFAWPNIQYHFLPVAINYNGSNAVKEHGFQCHVGSMRSPSRGHVRI
FT                   KSRDPHQHPAILFNYMSHEQDWQEFRDAIRITREIMHQPALDQYRGREISPGTECQTDE
FT                   QLDEFVRNHAETAFHPCGTCKMGYDEMSVVDGEGRVHGLEGLRVVDASIMPQIITGNLN
FT                   ATTIMIGEKMADMIRGKEALPRSTAGYFVANGMPVRAKKMSRDLN"
FT   CDS_pept        complement(374926..376398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="ECs_0358"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33781"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33781"
FT                   /db_xref="GOA:Q7AH91"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AH91"
FT                   /protein_id="BAB33781.2"
FT                   /translation="MSRMAEQQLYIHGGYTSATSGRTFETINPANGNVLATVQAAGRED
FT                   VDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLETLDTGKAYSETSTV
FT                   DIVTGADVLEYYAGLIPSLEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKS
FT                   APALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGVGAETGQYLTEHPGI
FT                   AKVSFTGGVASGKKVMANSAASSLKEVTMELGGKSPLIVFDDADLDLAADIAMMANFFS
FT                   SGQVCTNGTRVFVPAKCNAAFEQKILARVERIRAGDVFDPQTNFGPLVSFPHRDNVLRY
FT                   IAKGKEEGARVLCGGDVLKGDGLDNGAWVAPTVFTDCSDEMTIVREEIFGPVMSILTYE
FT                   SEDEVIRRANDTDYGLAAGIVTADLNRAHRVIHQLEAGICWINTWGESPAEMPVGGYKH
FT                   SGIGRENGVMTLQSYTQVKSIQVEMAKFQSIF"
FT   CDS_pept        complement(376412..376999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="ECs_0359"
FT                   /product="transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33782"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33782"
FT                   /db_xref="GOA:Q8X6C3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6C3"
FT                   /protein_id="BAB33782.1"
FT                   /translation="MPKLGMQSIRRRQLIDATLEAINEVGMHDATIAQIARRAGVSTGI
FT                   ISHYFRDKNGLLEATMRDITSQLRDAVLNRLHALPQGSAEQRLQAIVGGNFDETQVSSA
FT                   AMKAWLAFWASSMHQPMLYRLQQVSSRRLLSNLVSEFRRELPRHQAQEAGYGLAALIDG
FT                   LWLRAALSGKPLDKPLAHSLTRHFITQHLPTD"
FT   CDS_pept        377128..379161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="ECs_0360"
FT                   /product="choline transporter of high affinity"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33783"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33783"
FT                   /db_xref="GOA:P0ABD0"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABD0"
FT                   /protein_id="BAB33783.1"
FT                   /translation="MTDLSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGR
FT                   TLDWVSKTFGWYYLLAATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAG
FT                   IGIDLMFFSVAEPVTQYMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGY
FT                   FSYRYNLPLTIRSALYPIFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLS
FT                   VLFDIPDSMAAKAALIALSVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDT
FT                   SFLLNALVLNVGDYVNRFMGMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLAR
FT                   ISRGRTIRQFVLGTLIIPFTFTLLWLSVFGNSALYEIIHGGAAFAEEAMVHPERGFYSL
FT                   LAQYPAFTFSASVATITGLLFYVTSADSGALVLGNFTSQLKDINSDAPGWLRVFWSVAI
FT                   GLLTLGMLMTNGISALQNTTVIMGLPFSFVIFFVMAGLYKSLKVEDYRRESANRDTAPR
FT                   PLGLQDRLSWKKRLSRLMNYPGTRYTKQMMETVCYPAMEEVAQELRLRGAYVELKSLPP
FT                   EEGQQLGHLDLLVHMGEEQNFVYQIWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQG
FT                   NDLMDYSKEQVITDILDQYERHLNFIHLHREAPGHSVMFPDA"
FT   CDS_pept        379735..383718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0362"
FT                   /product="AidA-I family adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33785"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33785"
FT                   /db_xref="GOA:A0A0H3JBV3"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBV3"
FT                   /protein_id="BAB33785.1"
FT                   /translation="MNKIYRLKWNRSRNCWSVCSELGSRVKGKKSRAVLISAISLYSSL
FT                   VFADDVIVNQDKTIDFGKENQSIDYRITVTDNANLVINATDTSRPRLTLASGGGLDITG
FT                   GKVTINGPLNFLLKGTGFLNVSNAGSELYADDLYESNSGMRHDRGYFNVSNGGKIHVKG
FT                   TSRLTYLQGNVSGEGSQVNSETFFMGVYGSYGGNQYLSVNNGGEVNARKQISLGYYDQV
FT                   SDTTLAVSEGGKISAPTISLSTNSELALGAQEGSAAKAAGIIDAEKIEFVWAKTSEKKI
FT                   TLNHTDKDATISADIVSGSEGLGYINALNGTTYLTGDNSAFSGKVKIEQNGALGITQNI
FT                   GTAEINNRGKLHLKADDSMTFANKISGNGTISIDSGTVELTGNNYAFSGYIDVASGAVA
FT                   VISEDKNIGRAELDVDGKLQINANKDWVFDNDLEGRGIVEINMGNHEFSFDEFAYTDWF
FT                   QGSLAFQNTTFNLEKNAEFLQKGGITAGQGSLVTVGKGAHSISTLGFSGGTVDFGALTA
FT                   GAQMTEGTVNVSKTLDLRGEGVIQVSDSDVVRSVSRDIDSALSLTEVDDGNSTIKLVDA
FT                   QGAEVLGDAGNLQLQDKNGQILSSSAQRDIQQNGQKAAVGTYDYRLTSGVNNDGLYIGY
FT                   GLTQLDLHATDSDALVLSSNGKSENAADLSAKITGSGDLAFSSQKGQTVSLSNKDNDYT
FT                   GVTDLRSGTLLLNNDNVLGNTHELRLAAETELDMNGHSQTVGTLNGSADSLLSLNGGSL
FT                   TVTNGGTSTGSLTGSGELNIQGGTLDIAGDNSNLTANVNIANSANVLVSHAQGLGSANV
FT                   ENNGTLALNNSAEKRAAASVNYALGGNLTNNGTLMTGMSGQQAGNVLVVKGNYHGNNGQ
FT                   LVMNTVLNGDDSVTDKLVVEGDTSGTTAVTVNNAGGTGAKTLNGIELIHVDGKSEGEFV
FT                   QAGRIVAGAYDYTLARGQGANSGNWYLTSGSDSPELQPEPDPMPNPEPNPNPEPNPNPT
FT                   PTPGPDLNVDNDLRPEAGSYIANLAAANTMFTTRLHERLGNTYYTDMVTGEQKQTTMWM
FT                   RHEGGHNKWRDGSGQLKTQSNRYVLQLGGDVAQWSQNGSDRWHVGVMAGYGNSDSKTIS
FT                   SRTGYRAKASVNGYSTGLYATWYADDESRNGAYLDSWAQYSWFDNTVKGDDLQSESYKS
FT                   KGFTASLEAGYKHKLAEFNGSQGTRNEWYVQPQAQVTWMGVKADKHRESNGTLVHSNGD
FT                   GNVQTRLGVKTWLKSHHKMDDGKSREFQPFVEVNWLHNSKDFSTSMDGVSVTQDGARNI
FT                   AEIKTGVEGQLNANLNVWGNVGVQVADRGYNDTSAMVGIKWQF"
FT   CDS_pept        383860..384948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahA"
FT                   /locus_tag="ECs_0363"
FT                   /product="c-di-GMP-specific phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33786"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33786"
FT                   /db_xref="GOA:A0A152UU79"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UU79"
FT                   /protein_id="BAB33786.1"
FT                   /translation="MASHDLSVFLEEFGATVNLTLPGIVSEKERLLLKLLMEGMSVTEI
FT                   SQYRNRSAKTISHQKKQLYEKLGIQSDITFWRDIFFQYHPQVISGTGNKNNFYIPDNRC
FT                   HHIVTPEAISLALENHEFKPWIQPVFCAQTGVLTGCEVLVRWEHPQTGIIPPDQFIPLA
FT                   ESSGLIVIMTRQLMKQTADILMPVKHLLPDNFHIGINVSAGCFLAAGFEKECLNLVKKL
FT                   GNDKIKLVLELTERNPIPVTPEARAIFDSLHQHNITFALDDFGTGYATYRYLQAFPVDF
FT                   IKIDKSFVQMAGVDEISGHIVDNIVELARKPGLSIVAEGVETQEQADLMIGKGVHFLQG
FT                   YLYSPPVPGNKFISEWVMKAGG"
FT   CDS_pept        complement(384990..385921)
FT                   /transl_table=11
FT                   /gene="yahB"
FT                   /locus_tag="ECs_0364"
FT                   /note="DNA-binding transcriptional regulator"
FT                   /pseudogene="unknown"
FT   CDS_pept        complement(386013..386315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahC"
FT                   /locus_tag="ECs_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33789"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33789"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6B3"
FT                   /protein_id="BAB33789.1"
FT                   /translation="MVWAFFAALAAGWLASVSGLSAFWASVITTVPFSAVVVWQGRFWL
FT                   LSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKRDGY"
FT   CDS_pept        386778..387383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="ECs_0367"
FT                   /product="ankyrin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33790"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33790"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6B2"
FT                   /protein_id="BAB33790.1"
FT                   /translation="MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITL
FT                   ASLYQQYACVQALIDAGADINKQDHTCLNPFLISCLNGDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELARERGFEEIAQLLIAAGA"
FT   CDS_pept        387423..388286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="ECs_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33791"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33791"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6B1"
FT                   /protein_id="BAB33791.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   RLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVIDKQNIASA
FT                   VASMMGLGIGLTPSADDYLTGLALILFISGHPAGKYKEEFYLGLQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
FT   CDS_pept        388276..389823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="ECs_0369"
FT                   /product="NAD(P)-binding succinyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33792"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33792"
FT                   /db_xref="GOA:Q8X6B0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6B0"
FT                   /protein_id="BAB33792.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKSGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   ASAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
FT                   FLGRGETPVDEQGLQFARGTKEAALKAVMLSGVKQEHLDLHTLNQPLITDVRARLKPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHSDVYSNIQPDPEFRLKDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
FT   CDS_pept        389823..391241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="ECs_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33793"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33793"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A9"
FT                   /protein_id="BAB33793.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQFDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKIAAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   ITWEKMCGAMKGAVTGALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNIAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPILRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVAQQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   GENPNVTIPLLGFMGVPSAVDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
FT   CDS_pept        391267..391587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahH"
FT                   /locus_tag="ECs_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33794"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X367"
FT                   /protein_id="BAB33794.1"
FT                   /translation="MNALSGLRMAQESVGLISVAHQAFVTIAGCGVNALSGLQVAQEFV
FT                   GLISVAHQAFITIAGCGVNALSGLRMAQESVGLISVAHQAFVTIAGCGVNALSGLRMAR
FT                   EL"
FT   CDS_pept        391756..392706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="ECs_0372"
FT                   /product="carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33795"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33795"
FT                   /db_xref="GOA:Q8X6A8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A8"
FT                   /protein_id="BAB33795.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGAFFSESQRDELQKANPDWRFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTDAGDYQSVDAVIDKDLSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPEKQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
FT   CDS_pept        392716..394098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="ECs_0373"
FT                   /product="metallo-dependent hydrolase domain deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33796"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33796"
FT                   /db_xref="GOA:Q8X6A7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A7"
FT                   /protein_id="BAB33796.1"
FT                   /translation="MKENNSRREFLSQSGKMVTAAALFGTSVPLAHAAVSGTTNCEANN
FT                   TMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQNGKIVALRENKQHPDATLP
FT                   HYDAGDKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   SGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELAHRMAAQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
FT   CDS_pept        394397..394807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_5377"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X3L2"
FT                   /protein_id="BBE29396.1"
FT                   /translation="MTIKEKFSQKYPHASFCTFGDSAALADHLATLIATGVKTASCGSL
FT                   AGCIEDNAFPMIGEYKIVENSRGEPVCVIRVIGLHLLRFSDVTAELARKEGEGDLSLEY
FT                   WRNEHRRFFQAEGSYSPEMDVIFEEYALIDVV"
FT   CDS_pept        395058..396044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0374"
FT                   /product="sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33797"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33797"
FT                   /db_xref="GOA:Q8X6A6"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A6"
FT                   /protein_id="BAB33797.1"
FT                   /translation="MMNKRFVINMVSSLLLGAALISAPLQAAEKVVVNISKVDGMPWFN
FT                   RMGEGVVEAGKAFGVNASQVGPSSTDAPQQVKIIEDLIARKVNAITIVPNDANVLEPVF
FT                   KKARDAGIVVLTNESPGQPSANWDIEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGSLT
FT                   VPQHNLWADLLVKYQKEHYPDMHEVTRRMPVAESVDVSRRTTLDLMKTYPDLKAVVSFG
FT                   SNGPIGAGRAVKEKRAKNKVAVYGMMIPSQAASLIKSGDITEGITYDPASAGYALAAVA
FT                   STLLKGEEIKPGLEMQNLGKADVDMDKRIIRFHKVLLVNKDNIDSLY"
FT   CDS_pept        396399..397577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0375"
FT                   /product="ATP-binding component of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33798"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33798"
FT                   /db_xref="GOA:Q8X6A4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A4"
FT                   /protein_id="BAB33798.2"
FT                   /translation="MNHYHHGLFVNRRRLREVAQAAMTSINVTLPLDTLVSELSIARCQ
FT                   LVAICRALAQDARLIVMDEPTASLTHQEVQGLLQVVHQLRERGICVVFVSHRLEEVMEV
FT                   SDRISVLKDGELVGTFPAAEMTTKQLGFLMTGQEFEYQVRELWQGKSSTPVLEVRNLSR
FT                   HGEYLNINLRVEAGEVVSIVGLLGAGRTELCLSLFGMTRPDAGEILINGQLVTLHSNQD
FT                   AIRHGIGYVSEDRMSRGLVMAQSIEDNIISTVFHKVKDRFGFLSETKVRDLVDRLIKAL
FT                   TIKVSDPHLPVNTLSGGNAQRVSIAKWLAIGPRLLILDSPTVGVDIANKAGIYGIISDL
FT                   AAHGIAVLMICDEIEEAWYQSHRILVMQKGQITHSFLPDSSSQARIAEVVNG"
FT   CDS_pept        397570..398541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0377"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33800"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33800"
FT                   /db_xref="GOA:Q8X4N0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4N0"
FT                   /protein_id="BAB33800.1"
FT                   /translation="MAELKKRHEFWLALLIVVLFVGLAWRSDEFLTFGNLYDLANNYAM
FT                   LTILACGLFVVLISGGIDISFPAMTIIAQYGMVLLLQKIGGNFAVAFALAGCIGILLGL
FT                   INALLVNRLRVPSIIITISTLNIFYGLLLWLSKGVWLYDFPPWFEQGVMLFKYTDADGY
FT                   DYGLGLPLIAMITVVLLTAFIMNFTSVGRKIYALGGNRESASRIGFSVLKLQLFVYGYM
FT                   GLMSGAAGVVQSWTVMTVAPDSLLGYELTVLAAVVLGGTSLLGGRGTLTGTLLGVVLLA
FT                   VMQNGLNLLGVSSYWQTLITGIIIVASISATAWSQHQNRSLL"
FT   CDS_pept        398538..399494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0378"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33801"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33801"
FT                   /db_xref="GOA:Q8X4M9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4M9"
FT                   /protein_id="BAB33801.1"
FT                   /translation="MKKSWRNNVEFYLIGLLVLTVAAFSITMPEIFWSISNFQSVASQM
FT                   PVLGILALAMAVTMLCGGINLSIIATANACSLVMAWVATQYPPGIATVVATLLAGAGAA
FT                   VIIGLCNGVLIAGIRVLPILATLGMMTLLKGINILVTGGSAIANYPSWVLWLNHAQWFG
FT                   IPLPMWLFAAVALGLWILLEKTPLGKAIYLIGSNERATLYSGINTRRVLIWVYVISALL
FT                   CAVAAFLMMSKLNSAKASYGESYLLVSILAAVLGGVNPDGGSGRIIGMVLALFLLQIIE
FT                   SGFNILGISPYLTMALWGTLLLCFIQARGMLGLDRVV"
FT   CDS_pept        399581..400630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahK"
FT                   /locus_tag="ECs_0379"
FT                   /product="broad specificity NADPH-dependent aldehyde
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33802"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33802"
FT                   /db_xref="GOA:Q8X6A3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A3"
FT                   /protein_id="BAB33802.1"
FT                   /translation="MKIKAVGSYSAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLH
FT                   QVRSEWAGTVYPCVPGHEIVGRVVAVGDQVEKHAPGDLVGVGCIVDSCKHCEECEDGLE
FT                   NYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVHERYVLRIRHPQEQLAAVAPLLCAGITT
FT                   YSPLRHWQAGPGKKVGVVGIGGLGHMGIKLAHAMGAHVVAFTTSEAKREAAKALGADEV
FT                   VNSRNADEMAAHLKSFDFILNTVAAPHNLDDFTTLLKRDGTMTLVGAPATPHKSPEVFN
FT                   LIMKRRAIAGSMIGGIPETQEMLDFCAEHGIVADIEMIRADQINEAYERMLRGDVKYRF
FT                   VIDNRTLTD"
FT   CDS_pept        400873..401688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahL"
FT                   /locus_tag="ECs_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33803"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33803"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A2"
FT                   /protein_id="BAB33803.1"
FT                   /translation="MISLKAPHNNLMPYTQQSILNTVKNNQLPEDIKSSLVSCVDIFKV
FT                   LIKQYYDYPYDCRDDLVDDDKLIHLMAAVRDCEWSDDNALTINVQFNDFPGFYDWMDYP
FT                   DHPVKFVFRILENQKGTVWVYDQDDAFLDIKANVQAGRFTGLKKLVQFINSVRTDCKCI
FT                   LLEHHMPLLRLFPKGKECMHVEKWLREMSSIPETDAPIKQALAHGLLLHLKNIYPVFPE
FT                   SLVMLLLSVLDVKTYRDDARLNEGISNRVQELGDRYYPVNKHVKIRYTL"
FT   CDS_pept        complement(402366..402998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="ECs_0382"
FT                   /product="neutral amino-acid efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33805"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33805"
FT                   /db_xref="GOA:Q8X6A0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A0"
FT                   /protein_id="BAB33805.2"
FT                   /translation="MDPLHAVYLTVGLFVITFFNPGANLFVVVQTSLASGRRAGVLTGL
FT                   GVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQ
FT                   QPINAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARLMAWAGIVLASIIW
FT                   RVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQR"
FT   CDS_pept        403184..403459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="ECs_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33806"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33806"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X699"
FT                   /protein_id="BAB33806.1"
FT                   /translation="MKIISKMLVGALAFAVTNVYAAELMTKAEFEKVESQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTADIYKKK"
FT   CDS_pept        complement(403557..405143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="ECs_0384"
FT                   /product="propionate catabolism operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33807"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33807"
FT                   /db_xref="GOA:Q8X698"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X698"
FT                   /protein_id="BAB33807.1"
FT                   /translation="MAHPPRLNDDKPVIWTVSVTRLFELFRDISLEFDHLANITPIQLG
FT                   FEKAVTYIRKKLANERCDAIIAAGSNGAYLKSRLSVPVILIKPSGYDVLQALAKAGKLT
FT                   SSIGVVTYQETIPALVAFQKTFNLRLDQRSYITEEDARGQINELKANGTEAVVGAGLIT
FT                   DLAEEAGMTGIFIYSAATVRQAFSDALDMTRMSLRHNTHDATRNALRTRYVLGDMLGQS
FT                   PQMEQVRQTILLYARSSAAVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAV
FT                   NCGAIAESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLL
FT                   RVLEEKEVTRVGGHQPVPVDVRVISATHCNLEEDMRQGQFRRDLFYRLSILRLQLPPLR
FT                   ERVADILPLAESFLKVSLAALSAPFSAALRQGLQASETVLVHYDWPGNIRELRNMMERL
FT                   ALFLSVEPTPDLTPQFLQLLLPELARESAKIPAPRLLTPQQALEKFNGDKTAAANYLGI
FT                   SRTTFWRRLKS"
FT   CDS_pept        405382..406272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="ECs_0385"
FT                   /product="2-methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33808"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33808"
FT                   /db_xref="GOA:Q8X695"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X695"
FT                   /protein_id="BAB33808.1"
FT                   /translation="MSLHSPGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLS
FT                   GGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDADIGFGSSAFNVARTVKSM
FT                   IKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAKTDPDFVIMARTDALA
FT                   VEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQVPILANITEFGATPLFTT
FT                   DELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYH
FT                   YEEKLDDLFVRSQAK"
FT   CDS_pept        406428..407597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="ECs_0386"
FT                   /product="2-methylcitrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33809"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33809"
FT                   /db_xref="GOA:Q8X694"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X694"
FT                   /protein_id="BAB33809.1"
FT                   /translation="MSDTTILQNSTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYR
FT                   GYDILDLAEHCEFEEVAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRTVLEALPAAS
FT                   HPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE
FT                   TDDDSIGGHFLHLLHGEKPSQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSA
FT                   IIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVESKEVVIGFGHPVYTIAD
FT                   PRHQVIKRVAKQLSQEGGSLKMYNIADRLETVMWESKKMFPNLDWFSAVSYNMMGVPTE
FT                   MFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYVGPEDRQFVALDKRQ"
FT   CDS_pept        407631..409082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="ECs_0387"
FT                   /product="2-methylcitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33810"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33810"
FT                   /db_xref="GOA:Q8X693"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X693"
FT                   /protein_id="BAB33810.1"
FT                   /translation="MSAQINNIRPEFDREIVDIVDYVMNYEISSKVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLLGPIVPGTVVPNGVRVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRNAVASGKAPLTMKQVLTGMIKAHEIQGCIALENS
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAVRLALMAKTGEMGYPSALTAPVWGFYDVSFKGESFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVSIRTHEACIRIIDKKGPLNN
FT                   PADRDHCIQYMVAIPLLFGRLTAADYEDNVAQDKRIDALREKINCFEDPVFTADYHDPE
FT                   KRAIANAITLEFTDGTRFEEVVVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQR
FT                   ILEVSLDRARLEQMPVNEYLDLYVI"
FT   CDS_pept        409122..411008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="ECs_0388"
FT                   /product="propionate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33811"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33811"
FT                   /db_xref="GOA:Q8X692"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X692"
FT                   /protein_id="BAB33811.1"
FT                   /translation="MSFSEFYQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARW
FT                   FCEGRTNLCHNAIDRWLEKQPEALALIAVSSETEEERTFTFRQLHDEVNAVASMLRSLG
FT                   VQRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSAD
FT                   AGARGGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLAKMARVSGRDVDFASLRHQHIGA
FT                   RVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTWPDCGVWWKIVEKYQVSRMFSAPTAIRVL
FT                   KKFPTAEIRKHDLSSLEVLYLAGEPLDEPTASWVSNTLDVPVIDNYWQTESGWPIMAIA
FT                   RGLDDRPTRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDD
FT                   DRFVKTYWSLFSRPVYATFDWGIRDADGYHFILGRTDDVINVAGHRLGTREIEESISSH
FT                   PGVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDRDVAHSQEKAIMALVDSQIGNFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLNQIRQAMEE"
FT   CDS_pept        411902..413161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="ECs_0389"
FT                   /product="cytosine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33812"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33812"
FT                   /db_xref="GOA:Q8X691"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X691"
FT                   /protein_id="BAB33812.1"
FT                   /translation="MSQDNNFSQGPVPQSARKGVLALTFVMLGLTFFSASMWTGGTLGT
FT                   GLSYHDFFLAVLIGNLLLGIYTSFLGYIGAKTGLTTHLLARFSFGVKGSWLPSLLLGGT
FT                   QVGWFGVGVAMFAIPVGKATGLDINLLIAVSGLLMTVTVFFGISALTVLSLIAVPAIAC
FT                   LGGYSVWLAVNGMGGLDALKAVVPAQPLDFNVALALVVGSFISAGTLTADFVRFGRNAK
FT                   LAVLVAMVAFFLGNSLMFIFGAAGAAALGMADISDVMIAQGLLLPAIVVLGLNIWTTND
FT                   NALYASGLGFANITGMSSKTLSVINGIIGTVCALWLYNNFVGWLTFLSAAIPPVGGVII
FT                   ADYLMNRRRYEHFATTRMMSVNWVAILAVALGIAAGHWLPGIVPVNAVLGGALSYLILN
FT                   PILNRKTTAAMTHVEANSVE"
FT   CDS_pept        413151..414434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="ECs_0390"
FT                   /product="cytosine/isoguanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33813"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33813"
FT                   /db_xref="GOA:Q8X690"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X690"
FT                   /protein_id="BAB33813.1"
FT                   /translation="MSNNALQTIINARLPGKEGLWQIHLQDGKISAIDAQSGVMPITEN
FT                   SLDAEQGLVIPPFVEPHIHLDTTQTAGQPNWNQSGTLFEGIERWAERKALLTHDDVKQR
FT                   AWQTLKWQIANGIQHVRTHVDVSDATLTALKAMLEVKLEVAPWIDLQIVAFPQEGILSY
FT                   PNGEALLEEALRLGADVVGAIPHFEFTREYGVESLHKTFALAQKYDRLIDVHCDEIDDE
FT                   QSRFVETVAALAHREGMGARVTASHTTAMHSYNGAYTSRLFRLLKMSGINFVANPLVNI
FT                   HLQGRFDTYPKRRGITRVKEMLESGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQ
FT                   LMGYGQINDGLNLITHHSARTLNLQDYSIAAGNSANLIILPAENGFDALRRQVPVRYSV
FT                   RGGKVIASTQPAQTTVYLEQPEAIDYKR"
FT   CDS_pept        complement(414567..415466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynR"
FT                   /locus_tag="ECs_0391"
FT                   /product="transcriptional activator of cyn operon"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33814"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33814"
FT                   /db_xref="GOA:Q8X4M5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X4M5"
FT                   /protein_id="BAB33814.1"
FT                   /translation="MLSRHINYFLAVAEHGSFTRAASALHVSQPALSQQIRQLEESLGV
FT                   PLFDRSGRTIHLTDAGEVWRQYASRALQELGAGKRAIHDVADLTRGSLRIAVTPTFTSY
FT                   FIGPLMADFYARYPGITLQLQEMSQEKIEDLLCRDELDVGIAFAPVHLPELEAIPLLTE
FT                   SLALVVAQHHPLAACEQVALSRLHDEKLVLLSAEFATREQIDHYCEKAGLHPQVVIEAN
FT                   SISAVLELIRRTSLSTLLPAAIATQHDGLKAIPLAPPLLERTAVLLRRKNSWQTAAAKA
FT                   FLHMALEECADVGENESR"
FT   CDS_pept        415576..416235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="ECs_0392"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33815"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33815"
FT                   /db_xref="GOA:P0ABF0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABF0"
FT                   /protein_id="BAB33815.2"
FT                   /translation="MKEIIDGFLKFQREAFPKREALFKQLATQQSPRTLFISCSDSRLV
FT                   PELVTQREPGDLFVIRNAGNIVPSYGPEPGGVSASVEYAVAALRVSDIVICGHSNCGAM
FT                   TAIASCQCMDHMPAVSHWLRYADSARVVNEARPHSDLPSKAAAMVRENVIAQLANLQTH
FT                   PSVRLALEEGRIALHGWVYDIESGSIAAFDGATRQFVPLAANPRVCAIPLRQPTAA"
FT   CDS_pept        416266..416736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="ECs_0393"
FT                   /product="cyanate aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33816"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33816"
FT                   /db_xref="GOA:P58704"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58704"
FT                   /protein_id="BAB33816.1"
FT                   /translation="MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTA
FT                   ALLGQQALPADAARQVGAKLDLDEDAILLLQMIPLRGCIDDRIPTDPTMYRFYEMLQVY
FT                   GTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDGKYLPTKPF"
FT   CDS_pept        416742..417923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynX"
FT                   /locus_tag="ECs_0394"
FT                   /product="cyanate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33817"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33817"
FT                   /db_xref="GOA:Q8X687"
FT                   /db_xref="InterPro:IPR004747"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X687"
FT                   /protein_id="BAB33817.2"
FT                   /translation="MRNHQKTFTMLLVLVLIGLNMRPLLTSVGPLLPQLRQASGMSFSV
FT                   AALLTALPVVTMGGLALAGSWLHQHVSERRSVAISLLLIAVGALMRELYPQSALLLSSA
FT                   LLGGVGIGIIQAVMPSVIKRRFQQRTPLVMGLWSAALMGGGGLGAALTPWLVQHSETWY
FT                   QTLAWWALPAVVALFAWWWQSTREVASSHKTTTIPVRVVFTPRAWTLGVYFGLINGGYA
FT                   SLIAWLPAFYIEIGASAQYSGSLLALMTLGQAAGALLMPAMARHQDRRKLLMLALALQL
FT                   VGFCGFIWLPLQLPVLWAMVCGLGLGGAFPLCLLLALDHSVQPAIAGKLVAFMQGIGFI
FT                   IAGLAPWFSGVLRSISGNYLMDWAFHALCVVGLMIITLRFAPARFPQLWVKEA"
FT   CDS_pept        complement(418026..418637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="ECs_0395"
FT                   /product="galactoside O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33818"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33818"
FT                   /db_xref="GOA:Q8X686"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X686"
FT                   /protein_id="BAB33818.1"
FT                   /translation="MNMSMTERIKAGKLFTDMCEGLPEKRLRRKTLMYEFNHSHPSEVD
FT                   KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI
FT                   APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI
FT                   VTKDIPPNVVAAGVPCRVIREINDRDKQYYFRDYKVESSV"
FT   CDS_pept        complement(418703..419956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacY"
FT                   /locus_tag="ECs_0396"
FT                   /product="lactose permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33819"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33819"
FT                   /db_xref="GOA:Q8X4M4"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR018457"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X4M4"
FT                   /protein_id="BAB33819.1"
FT                   /translation="MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDT
FT                   GIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNIL
FT                   VGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFT
FT                   INNQFVFWLGSGCALILAILLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKL
FT                   WFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPL
FT                   IINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQ
FT                   FEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFT
FT                   LSGPGPLSLLRRQVNEVA"
FT   CDS_pept        complement(420008..423082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="ECs_0397"
FT                   /product="beta-D-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33820"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33820"
FT                   /db_xref="GOA:Q8X685"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X685"
FT                   /protein_id="BAB33820.1"
FT                   /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART
FT                   NRPSQQLRSLNGEWQFVWFPAPEAVPESWLECDLPDADTVVVPSNWQMHGYDAPIYTNV
FT                   TYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYG
FT                   QDSRLLSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQ
FT                   ISDFHVATLFNDDFSRAVLEAEVQMYGELRDELRVTVSLWQGETQVASGTAPFGGEIID
FT                   ERGGYADRVTLGLNVENPKLWSAEIPNIYRAVVELHTADGTLIEAEACDVGFREVRIEN
FT                   GLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLW
FT                   YTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWS
FT                   LGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTSATDIICPMYARVDEDQPFPAVP
FT                   KWSIKKWLSLPGEMRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDLVDQSL
FT                   IKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGR
FT                   TIEVTSEYLFRHSDNELLHWTVALDGKPLASGEVPLDVAPQGKQVIELPELPRLESTGQ
FT                   LWLTVHVVQPNATAWSEAGHISAWQQWRLAENLSVTLPSAPHAIPQLTTSETDFCIELD
FT                   NKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWK
FT                   AAGHYQAEAALLQCTADTLADAVLITTVHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
FT                   EVASDTPHPARIGLTCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPY
FT                   VFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDG
FT                   FHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWCQK"
FT   CDS_pept        complement(423205..424296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="ECs_0398"
FT                   /product="lactose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33821"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33821"
FT                   /db_xref="GOA:A0A0H3JCB2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCB2"
FT                   /protein_id="BAB33821.2"
FT                   /translation="MVNVKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAM
FT                   AELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVER
FT                   SGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACANVPALFLDVSDQTPINSII
FT                   FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGD
FT                   WSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTED
FT                   SSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPKTQTA
FT                   SPRALADSLMQLARQVSRLESGQ"
FT   CDS_pept        complement(424324..425277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0399"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33822"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33822"
FT                   /db_xref="GOA:Q8X683"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X683"
FT                   /protein_id="BAB33822.1"
FT                   /translation="MRPLTVAIIAVAGFSPFHLSVPFIVFSEKMAEKKRFHVIICAEKP
FT                   GNVDSADGFSVTATHDYTAVIQADIVIIPYWGTITQKPPQKLLEALTTARDNGAQIVGL
FT                   CLGTFVLGYAGLLKNKRAATHWEFEREFQARFPQTHLDINALYVDDDGIITSAGTAAAL
FT                   DCCLYIVRQHFGSDYANHIARRMVVPPYRTGGQAQFIEQPVPKNTHDERINLLLDYLRQ
FT                   NIAQQHDLDSLAQRVMMSRRTLTRHFMKATGSSIAEWLITERLRRSQELLGSSQLPVER
FT                   IAAEVGFLSPVTWRQHFKSHFGVSPAEWRKTFRGMA"
FT   CDS_pept        complement(425297..426073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33823"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33823"
FT                   /db_xref="GOA:Q8X682"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X682"
FT                   /protein_id="BAB33823.2"
FT                   /translation="MKITQIRNATQIIQYAGKTFLIDPLLAPKGSYPGFAGTARAEIRN
FT                   PTVELPCDLTTLLNVDALIVTHLHEDHWDETASRVVPKDKLIYVQNEQDAESLNKQGFT
FT                   HLTVLTDETKFGDITLHKTTGQHGSDRTYADPAMAKRLGAACGVVFQHPTEKTLYLAGD
FT                   TLWRDDVEATMLTFQPEVVVLNAGFAHVLGHGAIIMGAEDILKTHFTLPEAQIIATHME
FT                   AVNHCLLTRDALKEYARDNQIIEFVNVPEDGETLTF"
FT   CDS_pept        complement(426188..427135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpR"
FT                   /locus_tag="ECs_0401"
FT                   /product="mhp operon transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33824"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33824"
FT                   /db_xref="GOA:A0A0H3JCG6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCG6"
FT                   /protein_id="BAB33824.1"
FT                   /translation="MIFYCALSIERVFSATIKTCPNVHQVHNVVLTIEMSINMQNNEQT
FT                   EYKTVRGLTRGLMLLNMLNKLDGGASVGLLAELSGLHRTTVRRLLETLQEEGYVRRSPS
FT                   DDSFRLTIKVRQLSEGFRDEQWISALAAPLLGDLLREVVWPTDVSTLDVDAMVVRETTH
FT                   RFSRLSFHRAMVGRRLPLLKTASGLTWLAFCPEQERKELIEMLASRPGDDYQLAREPLK
FT                   LEAILARARKEGYGQNYRGWDQEEKIASIAVPLRSEQRVIGCLNLVYMASAMTIEQAAE
FT                   KHLPALQRVAKQIEEGVESQAILVAGRRSGVHLR"
FT   CDS_pept        427212..428876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpA"
FT                   /locus_tag="ECs_0402"
FT                   /product="3-(3-hydroxyphenyl)propionate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33825"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33825"
FT                   /db_xref="GOA:Q8X680"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR023786"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X680"
FT                   /protein_id="BAB33825.1"
FT                   /translation="MAIQHPDIQPAVNHSVQVAIAGAGPVGLMMANYLGQMGIDVLVVE
FT                   KLDKLIDYPRAIGIDDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFADIQPMTD
FT                   EFGWPRRNAFIQPQVDAVMLEGVSRFPNVRCLFSRELEAFSQQDDEVTLHLKTAEGLRE
FT                   IVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRPY
FT                   VSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARL
FT                   AQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDTYQQ
FT                   ERRDHAKAMIDLSVTAGNVLAPPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQY
FT                   YGGALVREGEAKHSPVGKMFIQPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDE
FT                   QIQQWRALSTRFIQVVPEVQIHTAQDNHDGVLRVGDTQGRLRSWFAQHNASLVVMRPDR
FT                   FVAATAIPQTLGKTLNKLASVMTLTRPDADVSVEKVA"
FT   CDS_pept        428878..429822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpB"
FT                   /locus_tag="ECs_0403"
FT                   /product="2,3-dihydroxyphenylpropionate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33826"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33826"
FT                   /db_xref="GOA:P0ABS0"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABS0"
FT                   /protein_id="BAB33826.1"
FT                   /translation="MHAYLHCLSHSPLVGYVDPAQEVLDEVNGVIASARERIAAFSPEL
FT                   VVLFAPDHYNGFFYDVMPPFCLGVGATAIGDFGSAAGELPVPVELAEACAHAVMKSGID
FT                   LAVSYCMQVDHGFAQPLEFLLGGLDKVPVLPVFINGVATPLPGFQRTRMLGEAIGRFTS
FT                   TLNKRVLFLGSGGLSHQPPVPELAKADAHMRDRLLGSGKDLPASERELRQQRVISAAEK
FT                   FVEDQRTLHPLNPIWDNQFMTLLEQGRIQELDAVSNEELSAIAGKSTHEIKTWVAAFAA
FT                   ISAFGNWRSEGRYYRPIPEWIAGFGSLSARTEN"
FT   CDS_pept        429840..430706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="ECs_0404"
FT                   /product="2-hydroxy-6-ketonona-2,4-dienedioic acid
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33827"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33827"
FT                   /db_xref="GOA:Q8X5K0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR023791"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5K0"
FT                   /protein_id="BAB33827.2"
FT                   /translation="MSYQPQTEAATSRFLNVEEAGKTLRIHFNDCGQGDETVVLLHGSG
FT                   PGATGWANFSRNIDPLVEAGYRVILLDCPGWGKSDSIVNSGSRSDLNARILKSVVDQLD
FT                   IAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMGGGTGGMSLFTPMPTEGIKRLNQLYR
FT                   QPTIENLKLMMDIFVFDTSDLTDALFEARLNNMLSRRDHLENFVKSLEANPKQFPDFGP
FT                   RLAEIKAQTLIVWGRNDRFVPMDAGLRLLSGIAGSELHIFRDCGHWAQWEHADAFNQLV
FT                   LNFLARA"
FT   CDS_pept        430716..431525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpD"
FT                   /locus_tag="ECs_0405"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33828"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33828"
FT                   /db_xref="GOA:Q8XEC1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR023793"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEC1"
FT                   /protein_id="BAB33828.2"
FT                   /translation="MTKHTLEQLAADLRRAAEQGEAIAPLRDLIGIDNAEAAYAIQHIN
FT                   VQYDVAQGRRVVGRKVGLTHPKVQQQLGVDQPDFGTLFADMCYGDNEIIPFSRVLQPRI
FT                   EAEIALVLNRDLPATDITFDELYNAIEWVLPALEVVGSRIRDWSIQFVDTVADNASCGV
FT                   YVIGGPAQRPAGLDLKNCAMKMTRNNEEVSSGRGSECLGHPLNAAVWLARKMASLGEPL
FT                   RAGDIILTGALGPMVAVNAGDRFEAHIEGIGSVAAAFSSAAPKGSLS"
FT   CDS_pept        431522..432472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpF"
FT                   /locus_tag="ECs_0406"
FT                   /product="acetaldehyde-CoA dehydrogenase II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33829"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33829"
FT                   /db_xref="GOA:Q8X5J9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5J9"
FT                   /protein_id="BAB33829.1"
FT                   /translation="MSKRKVAIIGSGNIGTDLMIKILRHDQHLEMAVMVGIDPQSDGLA
FT                   RARRMGVATTHEGVIGLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTP
FT                   AAIGPYCVPVVNLEENVDQLNVNMVTCGGQATIPMVAAVSRVVRVHYAEIIASIASKSA
FT                   GPGTRANIDEFTETTSRAIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDI
FT                   EASINEMAEAVQAYVPGYRLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAH
FT                   YLPAYAGNLDIMTSSALATAEKMAQSLARKAGEAA"
FT   CDS_pept        432469..433482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpE"
FT                   /locus_tag="ECs_0407"
FT                   /product="4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic
FT                   acid aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33830"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33830"
FT                   /db_xref="GOA:Q8X5J8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5J8"
FT                   /protein_id="BAB33830.1"
FT                   /translation="MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALDDARVDSIE
FT                   VAHGDGLQGSSFNYGFGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGA
FT                   RVVRVATHCTEADVSAQHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCI
FT                   YVVDSGGAMNMSDIRDRFRALKAVLKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDA
FT                   SLAGMGAGAGNAPLEVFIAAVDKLGWQHGADLYALMDAADDLVRPLQDRPVRVDRETLA
FT                   LGYAGVYSSFLRHCETAAARYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK"
FT   CDS_pept        433658..434869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpT"
FT                   /locus_tag="ECs_0408"
FT                   /product="3-hydroxyphenylpropionic transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33831"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33831"
FT                   /db_xref="GOA:Q8X5J7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J7"
FT                   /protein_id="BAB33831.2"
FT                   /translation="MSTRTPSSSSSRLMLTIGLCFLVALMEGLDLQAAGIAAGGIAQAF
FT                   ALDKMQMGWIFSAGILGLLPGALVGGMLADRYGRKRILIGSVALFGLFSLATAIAWDFP
FT                   SLVFARLMTGVGLGAALPNLIALTSEAAGPRFRGTAVSLMYCGVPIGAALAATLGFAGA
FT                   NLAWQTVFWVGGVVPLILVPLLMRWLPESAVFAGEKQAAPPLRALFAPETATATLLLWL
FT                   CYFFTLLVVYMLINWLPLLLVEQGFQPSQAAGVMFALQMGAASGTLMLGALMDKLRPVT
FT                   MSLLIYSGMLASLLALGTVSSFNGMLLAGFVAGLFATGGQSVLYALAPLFYSSQIRATG
FT                   VGTAVAVGRLGAMSGPLLAGKMLALGTGTVGVMAASAPGILVAGLAVFILMSRRLRMQP
FT                   CADA"
FT   CDS_pept        434971..435510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECs_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33832"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33832"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J6"
FT                   /protein_id="BAB33832.2"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDNPYADFKVPDDLMW"
FT   CDS_pept        complement(435635..436468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmB"
FT                   /locus_tag="ECs_0410"
FT                   /product="S-formylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33833"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33833"
FT                   /db_xref="GOA:Q8X5J5"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5J5"
FT                   /protein_id="BAB33833.1"
FT                   /translation="MELIEKHASFGGWQNVYRHYSASLKCEMNVGVYLPPKAAGEKLPV
FT                   LYWLSGLTCNEQNFITKSGVQRYAAEHNIIVVAPDTSPRGSHVADADRYDLGQGAGFYL
FT                   NATQAPWNEHYKMYDYIRNELPDLVMNHFPATAKKSISGHSMGGLGALVLALRNPDEYV
FT                   SVSAFSPIVSPSQVPWGQQAFAAYLGENKEAWLDYHPVSLISQGQRVAEIMVDQGLSDD
FT                   FYAEQLRTQNLEKICQEMNIKTLIRYHEGYDHSYYFVSSFIGEHIAYHANKLNMR"
FT   CDS_pept        complement(436561..437670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmA"
FT                   /locus_tag="ECs_0411"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33834"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33834"
FT                   /db_xref="GOA:Q8X5J4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5J4"
FT                   /protein_id="BAB33834.1"
FT                   /translation="MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAF
FT                   TLSGDDPEGVFPVVLGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECEFCRSGKTN
FT                   LCVAVRETQGKGLMPDGTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPEANHEH
FT                   VCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPK
FT                   KFDLARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGW
FT                   GQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPF
FT                   VTHTMSLDEINDAFDLMHEGKSIRTVIRY"
FT   CDS_pept        complement(437705..437980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmR"
FT                   /locus_tag="ECs_0412"
FT                   /product="regulator protein that represses frmRAB operon"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33835"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33835"
FT                   /db_xref="GOA:Q8X5J3"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5J3"
FT                   /protein_id="BAB33835.2"
FT                   /translation="MPSTPEEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAV
FT                   RGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVRAYLK"
FT   CDS_pept        complement(438140..439186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /locus_tag="ECs_0413"
FT                   /product="ferric transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33836"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33836"
FT                   /db_xref="GOA:Q7AH43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AH43"
FT                   /protein_id="BAB33836.2"
FT                   /translation="MSQKNFVELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGK
FT                   TTILRLVAGLEKPSEGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLK
FT                   MLGVSRSEVKQRVKEALAMVDLEGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEP
FT                   LSNLDANLRRSMRDKIRELQKQFNITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQ
FT                   DLYRQPASRFMASFMGDANLFPANFSEEYVDIYGYRLPRAAHFPVQGSGTVGVRPEAIT
FT                   LSNHGEESQRCVIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDIGEHYYLEIHPYG
FT                   MFVLADAA"
FT   CDS_pept        complement(439198..441276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0414"
FT                   /product="ferric transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33837"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33837"
FT                   /db_xref="GOA:Q8X5J2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J2"
FT                   /protein_id="BAB33837.1"
FT                   /translation="MSQTLALHPVKKRDAIFLWVLLGWLAFVLLPSWSLDYGLLESTSD
FT                   EILGAYGWSHFNISWLWYLLPSLLLVRPFRQATREQRSRHYFDAGWALLCMAFIVISAT
FT                   VAGRGLGYAAIVLFVELGAIMTLALTRLEWLGGDRFVIGSLIAIVALIGIFIVWPSIAI
FT                   FIPMFTNDAGELAPLAFMTVLSQAHIVQVIVNSIVLSIAVGIGCAFFGLVLAIYTTRIA
FT                   KRSAIIGRIFSILPIVTPPFVVGLGVTLMMGRSGYVTEFMVEWFGLTNTNWLYGFTGIW
FT                   LAQVLAFTPMAFMILDGAIKTIHPSLEEASYTLRASRWQTFNGVFVPLLKPALANAFLI
FT                   VVVQSLADFSNPLVLGGNFDVLATQIYFYITGSQLDYQAASTLGAFLLLFSLLVFCIQY
FT                   MWIGKRSYVTVSGKSYRGDVQPLPVTLVWSVVAILAIWIAFNALLYGSIFYGSFTVNWG
FT                   VDYTLTLDNFIKLFGQGMSDGAWPSLLDTLLYAGIAAPITAIFGLLIAWVVVRQQFKGK
FT                   KTIEFTTMLCFAVPGTVAGVSYILAFNSAPVYLTGTAAIVIISMVMRNVPVGIRAGIAG
FT                   LGQIDKSLDEASLSLRAGSLRTITHILLPLLRPAILSALIYSFVRAITTVSAIVFLVTP
FT                   DTRVATAYILNRVEDGEYGVAIAYGSILIVVMLAIIFLFDWLIGEARISRSKAKNQA"
FT   CDS_pept        complement(441345..442376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0415"
FT                   /product="periplasmic-iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33838"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33838"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J1"
FT                   /protein_id="BAB33838.1"
FT                   /translation="MKMTFTSTLIASAVALATLTGAAQAKGRLVVYCSATNEMCEAETK
FT                   AFGEKYDVKTSFIRNGSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEMGLLQAYKSP
FT                   NLEQIMEKFRDPAKVKGNLSSAVYVGILGFGVNTDRLKEKNLPVPKCWKDLTKPEYKGE
FT                   IQIADPQSSGTAYTALATFAQLWGEDQAFDYLKQLNANVSQYTKSGIAPARNAARGETA
FT                   IGIGFLHDYSLEKEQGAPLELISPCEGTGYEIGGVSILKGARNLDNAKLFVDWVLSKEA
FT                   QELAWKKGKSYQILTNTTAETSPNSLKLDDLKLINYDMDKYGSTDVRKALINKWVSEVK
FT                   MGK"
FT   CDS_pept        complement(442373..443677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0416"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33839"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33839"
FT                   /db_xref="GOA:Q8X5J0"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J0"
FT                   /protein_id="BAB33839.1"
FT                   /translation="MHARSAREINQCYRTLRPRLLMCMIIGYAAFYLTRKSVNYVLPAL
FT                   QTDLGLDKGDIGLLGSLFYLSYGLSKFTAGLWHDSHGQRGFMGVGLFATGLLNVVFAFG
FT                   ESLTLLLVVWTLNGFFQGWGWPPCARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLIS
FT                   AFAAHWWGWQAAMLTPGIISMALGIWLTLQLKGTPQEEGLPTVGHWRHDPLELRQEQQS
FT                   PPMGLWQMLRTTMLQNPLIWLLGVSYVLVYVIRIALNDWGNIWLTESHGVNLLSANATV
FT                   MLFEVGGLLGALFAGWGSDLLFSGQRAPMILLFTLGLMVSVAALWLAPVHHYALLAVCF
FT                   FTVGFFVFGPQMLIGLAAVECGHKAAAGSITGFLGLFAYLGAALAGWPLSLVIERYGWP
FT                   GMFSLLSVAAVLMGLLLMPLLMAGITTTHARRIKQ"
FT   CDS_pept        complement(443762..445303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0417"
FT                   /product="sensor histidine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33840"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33840"
FT                   /db_xref="GOA:Q8X5I9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5I9"
FT                   /protein_id="BAB33840.1"
FT                   /translation="MSRNLRHWVILLFIVLAWGTGWLMLWTLSFYLTNNGQQAVLFLPQ
FT                   GVYLALVILLSRRYWPALVLPPLLMMFWLHSEQLLNGYLMLATPVISLFPALLAQNFWH
FT                   RFPLYWQRLTLLLATVTAASLLNTALLSPFMSGPIMLPGLTSFTGGVLLTPFVYLIFEF
FT                   LRQQHRYQLLGLDTHNPPLRTSLIIWCSLFFIIGIGTQMVLSPEIERLLLIVVFLPNVV
FT                   MAWKFGWQGGVLSGLLGSMMITIARQIGVGFSNLVELEIFLATQALLGIGLGIAISRQQ
FT                   HLALNLHHYRQRLEAELAARRALAEKLIHTEEDTRKNLARELHDEIGQNITAIQIQSQL
FT                   VKRARDPAQIQSAASQINELARRIHLSTRQLLRQLRPPALDELTFREALLHLINEFAFS
FT                   ERGIHCQFAYQLNSTPENETVRFTLYRLLQELLNNICKHAEASEVTIILRQQGEVLHLE
FT                   VSDNGVGIASGKMAGFGIQGMRERVSALGGDLTLEKQHGTRVIVNLPTFLQQIAG"
FT   CDS_pept        complement(445303..445932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0418"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33841"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33841"
FT                   /db_xref="GOA:Q8X5I8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5I8"
FT                   /protein_id="BAB33841.1"
FT                   /translation="MIRVVLVDDHVVVRSGFAQLLSLEDDLEVIGQYSSAAQAWSALIR
FT                   DDVNVAVIDIAMPDENGLSLLKRLRAQKPQFRAIILSIYDAPTFVQSALDAGASGYLTK
FT                   RCGPEELVQAVRSVGLGGHYLCADAIRALRGGGQPAQALEILTPREREVFELLVKGDSV
FT                   KEIAFKLELSHKTVHVHRANVLGKLNCHSTIELVHFALDHHLLAGH"
FT   CDS_pept        446235..447197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="ECs_0419"
FT                   /product="taurine ABC transporter periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33842"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33842"
FT                   /db_xref="GOA:Q8X5I7"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5I7"
FT                   /protein_id="BAB33842.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVK
FT                   AFSKSAIDAQQPYIANPDVWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
FT   CDS_pept        447210..447977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="ECs_0420"
FT                   /product="taurine ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33843"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33843"
FT                   /db_xref="GOA:Q8X5I6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X5I6"
FT                   /protein_id="BAB33843.1"
FT                   /translation="MLQISHLYADYGGKPVLEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQ
FT                   RLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
FT   CDS_pept        447974..448801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="ECs_0421"
FT                   /product="taurine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33844"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33844"
FT                   /db_xref="GOA:Q8X5I4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5I4"
FT                   /protein_id="BAB33844.1"
FT                   /translation="MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVAALQ
FT                   LISPLFLPPPQQVLAKLLTIAGPQGFMDATLWQHLAASLTRIVLALLAAVLIGIPVGIA
FT                   MGLSPTVRGILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
FT   CDS_pept        448798..449649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="ECs_0422"
FT                   /product="taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33845"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33845"
FT                   /db_xref="GOA:Q8X5I2"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5I2"
FT                   /protein_id="BAB33845.1"
FT                   /translation="MSERLSITPLGPYIGAQISGADLTRPLSDNQFEQLYHAVLRHQVV
FT                   FLRDQAITPQQQRALAQRFGELHIHPVYPHAEGVDEIIVLDTHNDNPPDNDNWHTDVTF
FT                   IETPPAGAILAAKELPSTGGDTLWTSGIAAYEALSVPFRQLLSGLRAEHDFRKSFPEYK
FT                   YRKTEEEHQRWREAVAKNPPLLHPVVRTHPVSGKQALFVNEGFTTRIVDVSEKESEALL
FT                   GFLFAHITKPEFQVRWRWQPNDIAIWDNRVTQHYANADYLPQRRIMHRATILGDKPFYR
FT                   AG"
FT   CDS_pept        complement(449756..450730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="ECs_0423"
FT                   /product="5-aminolevulinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33846"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33846"
FT                   /db_xref="GOA:A0A0H3JFW2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFW2"
FT                   /protein_id="BAB33846.2"
FT                   /translation="MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYK
FT                   AVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSR
FT                   ICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIA
FT                   PSAAMDGQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMN
FT                   PMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKF
FT                   AALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR"
FT   CDS_pept        451256..454198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiT"
FT                   /locus_tag="ECs_0424"
FT                   /product="flagellin structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33847"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33847"
FT                   /db_xref="GOA:A0A0H3JCC1"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCC1"
FT                   /protein_id="BAB33847.1"
FT                   /translation="MHSWKKKLIVSQLALACTLAITSQANAATNDISGQTYNTFHHYND
FT                   ATYADDVYYDGYVGWNNYAADSYYNGDIYPVINNATVNGVISTYYLDDGISTNTNANSL
FT                   TIKNSTIHGMITSECMTTDCADDRATGYVYDRLTLSVDNSTIDDNYEHYTYNGTYNNAA
FT                   DTHVVDVYDMGTAITLDQEVDLSITNNSHVAGITLTQGYEWEDIDDNTVSTGVNSSEVF
FT                   NNTITVKDSTVTSGSWTDEGTTGWFGHTGNASNYSNTLTADDVAIAAIANPYADNAMQT
FT                   TVTLDNSTLMGDVVFSSNFDENFFPQGANSYRDADGDVDTNGWDGTDRMDVTLNNGSKW
FT                   VGAAMSVHMVDEDGDGSYDGYAVGTEATATLLDIAANSLWPSSTVGVDNINTQYDENGH
FT                   IVGNEVYQSGLFNVTLNGGSEWDTTKSSLIDTLSINSGSQVNVADSRLISDTVSLTGGS
FT                   NLNIGEDGHVATNTLTIDNSTVKMSDDVSAGWGLEDAALYANTITVTNDGLLDINVDQF
FT                   DANPFQADTLNLTSTTDTNGNIHAGVFDIHSSDYVMDTDLVNDRTNDTTKSNYGYGLIA
FT                   MNSDGHLTINGNGDNDNTASIEAGQNEVDNNGDHVAAATGNYKVRIDNATGAGSIADYN
FT                   GNELIYVNDKNSNATFSAANKADLGAYTYQAEQRGNTVVLQQMELTDYANMALSIPSAN
FT                   TNIWNLEQDTVGTRLTNSRHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDT
FT                   KIDGNNAKWIVGAAAGFAKGDMNDRSGQVDQDSQTAYIYSSAHFANNVFVDGSLSYSHF
FT                   NNDLSATMSNGTYVDGSTNSDAWGFGLKAGYDFKLGDAGYVTPYGSISGLFQSGDDYQL
FT                   SNDMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDNDVNGDSID
FT                   NGTEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
FT   CDS_pept        454286..454909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiV"
FT                   /locus_tag="ECs_0425"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33848"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33848"
FT                   /db_xref="GOA:P0AAP6"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR034719"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAP6"
FT                   /protein_id="BAB33848.2"
FT                   /translation="MLSVVKPLQEFGKLDKCLSRYGTRFEFNNEKQVIFSSDVNNEDTF
FT                   VILEGVISLRREENVLIGITQAPYIMGLADGLMKNDIPYKLISEGNCTGYHLPAKQTIT
FT                   LIEQNQLWRDAFYWLAWQNRILELRDVQLIGHNSYEQIRATLLSMIDWNEELRSRIGVM
FT                   NYIHQRTRISRSVVAEVLAALRKGGYIEMNKGKLVAINRLPSEY"
FT   CDS_pept        complement(454910..456067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="ECs_0426"
FT                   /product="D-alanyl-D-alanine-carboxypeptidase/endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33849"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33849"
FT                   /db_xref="GOA:P0AD71"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AD71"
FT                   /protein_id="BAB33849.1"
FT                   /translation="MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYG
FT                   SGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTY
FT                   TPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQAD
FT                   RMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAM
FT                   IPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPAS"
FT   CDS_pept        456419..457639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="ECs_0427"
FT                   /product="peptide antibiotic transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33850"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33850"
FT                   /db_xref="GOA:P0AFY7"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFY7"
FT                   /protein_id="BAB33850.1"
FT                   /translation="MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQI
FT                   PISAARFWSLDFLIFYAYYIVCVGLFALFWFIYSPHRWQYWSILGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMANWQQLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPELPIIGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDATRATPPTVRELFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQ
FT                   EVTHTLS"
FT   CDS_pept        457652..458746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="ECs_0428"
FT                   /product="microcin Bac7 uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33851"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33851"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5H6"
FT                   /protein_id="BAB33851.1"
FT                   /translation="MSRVNHLSSLSFLAVLVLAGCSSQAPQPLKKGEKAIDVASVVRQK
FT                   MPASVKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQ
FT                   EIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSGIFDDLISMVPMGQT
FT                   LFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPA
FT                   SYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRK
FT                   LAAKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDERRARCMKQ"
FT   CDS_pept        complement(458805..459113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="ECs_0429"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33852"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33852"
FT                   /db_xref="GOA:P0AAP9"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAP9"
FT                   /protein_id="BAB33852.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ"
FT   CDS_pept        459373..459585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="ECs_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33853"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33853"
FT                   /db_xref="GOA:Q8X5H4"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5H4"
FT                   /protein_id="BAB33853.2"
FT                   /translation="MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGL
FT                   VTWVISFWLAGLIIRRRDEETENAQ"
FT   CDS_pept        complement(459609..460703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="ECs_0431"
FT                   /product="D-alanine-D-alanine ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33854"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33854"
FT                   /db_xref="GOA:P0A6J9"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6J9"
FT                   /protein_id="BAB33854.1"
FT                   /translation="MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDK
FT                   QGQWHVSDASNYLLNADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFP
FT                   IVHGTLGEDGSLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTR
FT                   ANRHNISFAEVESKLGLPLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQ
FT                   GIKGREIECAVLGNDNPQASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDK
FT                   IRAIAVQAYQTLGCAGMARVDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYT
FT                   DLITRLIELALERHAADNALKTTM"
FT   CDS_pept        461166..461426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iraP"
FT                   /locus_tag="ECs_0432"
FT                   /product="anti-RssB factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33855"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33855"
FT                   /db_xref="GOA:P0AAP0"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAP0"
FT                   /protein_id="BAB33855.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
FT   CDS_pept        461527..462942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="ECs_0433"
FT                   /product="bacterial alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33856"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33856"
FT                   /db_xref="GOA:Q8XEB6"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEB6"
FT                   /protein_id="BAB33856.2"
FT                   /translation="MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGAR
FT                   RLTADQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTG
FT                   QYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGL
FT                   ATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARA
FT                   DVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLF
FT                   ADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFF
FT                   LQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIV
FT                   APDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQT
FT                   DLFYTMKAALGLK"
FT   CDS_pept        463061..463381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECs_0434"
FT                   /product="phosphate starvation-inducible protein PsiF"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33857"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33857"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEB3"
FT                   /protein_id="BAB33857.2"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
FT   CDS_pept        463483..464598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiC"
FT                   /locus_tag="ECs_0435"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33858"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33858"
FT                   /db_xref="GOA:Q8XEB2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEB2"
FT                   /protein_id="BAB33858.1"
FT                   /translation="MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPR
FT                   AVGLAGMFLPIASTLVSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKT
FT                   DAVLAGMWVGVMGVNVLPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGI
FT                   TVSFNSAPLEWWLSLPIIVIYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRR
FT                   HWETMLRNEFDNCRRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRG
FT                   SDVIGRFGGDEFAVIMSGTPAESAITAMLRVHEGLNTLRLPNTPQVNLRISVGVAPLNP
FT                   QMSHYREWLKSADLALYKAKKAGRNRTEVAA"
FT   CDS_pept        complement(464615..465424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="ECs_0436"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33860"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33860"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8D5"
FT                   /protein_id="BAB33860.2"
FT                   /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAAL
FT                   HDKFGINAAESAQEVAQIADIIFAAVKPGIMIKVLSEITSSLNKDSLVVSIAAGVTLDQ
FT                   LARALGHDRKIIRAMPNTPALVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEP
FT                   MIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGEHP
FT                   GALKDMVCSPGGTTIEAVRVLEEKGFRAAVIEAMTKCMEKSEKLSKS"
FT   CDS_pept        465544..466002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="ECs_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33859"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33859"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEB1"
FT                   /protein_id="BAB33859.2"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRE
FT                   RLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKWWLEVQRSRG"
FT   CDS_pept        466185..466709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="ECs_0438"
FT                   /product="shikimate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33861"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33861"
FT                   /db_xref="GOA:P0A6E3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6E3"
FT                   /protein_id="BAB33861.1"
FT                   /translation="MTQPLFLIGPRGCGKTTVGMALADSLNRRFVDTDQWLQSQLNMTV
FT                   AEIVEREEWAGFRARETAALEAVTAPSTVIATGGGIILTEFNRHFMQNNGIVVYLCAPV
FT                   SVLVNRLQAAPEEDLRPTLTGKPLSEEVQEVLEERDALYREVAHIIIDATNEPSQVISE
FT                   IRSALAQTINC"
FT   CDS_pept        466759..466950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="ECs_0439"
FT                   /product="OxyR-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33862"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33862"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAN7"
FT                   /protein_id="BAB33862.1"
FT                   /translation="MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
FT   CDS_pept        467208..467885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="ECs_0440"
FT                   /product="AroM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33863"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33863"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA6"
FT                   /protein_id="BAB33863.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNHLAHVSRRKVERDLQGVVEVLDNQGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEELLTVQAQKWQILQKPPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFNQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
FT   CDS_pept        467957..468241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="ECs_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33864"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33864"
FT                   /db_xref="GOA:P0C039"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C039"
FT                   /protein_id="BAB33864.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
FT   CDS_pept        468385..470664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbD"
FT                   /locus_tag="ECs_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33865"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33865"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA4"
FT                   /protein_id="BAB33865.2"
FT                   /translation="MNRINILVICMVLFFMTGNACATEWISSEDLITSDFHLMTADERN
FT                   VVKAATDDSMEAAYMLKDNIRWYYHNGDLSLPANFSNKNKLVVNGNLTISGDYDDYLSG
FT                   NGHLIVLGNVIVDNFINHDFAYVKGQMTAKGLVYADYNDHNFEVMKGISARGIIVSDKA
FT                   TQFEVIKAEFYINEDGSGEGYNWDENIQKAYSLVTADLYDHTEIETDNISNAYPDYDSV
FT                   ADNIVQGLPLFRDKAAPEINEKLKWIETGKLDNFPANKIKHQDPLVARFLTHTESLSPA
FT                   VMLQLLQHPDDQTRESMAQSWPAQQMHWLTDELIKDEAVARGLVKNSNISADVNKKLMS
FT                   VPVESVQLEQARQDNLSPDIVASLSHSPFLSVRKTLLSHYDYAWLVPTAVADELINNED
FT                   PELRERITGADLTAQQAVMLSKDKSLKVREALARTLTELKITQLSATLRTEDIERIAEQ
FT                   MYLDNKENKNIVKVLLIALPEMCQLSLAKEDVHNLREGARYLTSKDVISYLLTQHDVPT
FT                   VWDELARDKLLPLEYKKQLWQRTLNLMMSKRQEDQEQAYEVQLALIDNGVVDEEMLNNA
FT                   IDLLVDLPAEYRYRMRNQLFDNKELPSGIINKLDQQYRFNSDWALAVVSMKNSTRRQSE
FT                   RGLHRWNHEDSDIFAELATIKDKSDDEWWRALLQSRNDHLRQTALRNAHTPASLLTTLT
FT                   ESQDRSLAINNPQLAADVKTVWLKEDPSLLLFVDKPDLSQLRDLVKTGATRKIRNEARH
FT                   RLEEKQ"
FT   CDS_pept        470661..471110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33866"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA3"
FT                   /protein_id="BAB33866.1"
FT                   /translation="MTQRPWSKLQREIYDLLTPTINLQIHCTRYPMRSQNGGSTDLPRY
FT                   WITLDKNVIWDYPKDFIAGNGGVRNFHGETCWYPYLTDICSISDLLREYIDTPKAELLT
FT                   KQFTSDKWGLVNILRAADRRIGMRRLDQLRRKTHNIAALKNYCPP"
FT   CDS_pept        complement(471195..472172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="ECs_0444"
FT                   /product="recombination-associated protein rdgC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33868"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33868"
FT                   /db_xref="GOA:Q8XEA0"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA0"
FT                   /protein_id="BAB33868.2"
FT                   /translation="MQGRRQFVIMPAKFNDKAVEIIMLWFKNLMVYRLSREISLRAEEM
FT                   EKQLASMAFTPCGSQDMAKMGWVPPMGSHSDALTHVANGQIVICARKEEKILPSPVIKQ
FT                   ALEAKIAKLEAEQARKLKKTEKDSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDC
FT                   ASAKKAEDTLALLRKSLGSLPVVPLSMANPIELTLTEWVRSGSAAQGFQLLDEAELKSL
FT                   LEDGGVIRAKKQDLTSEEITNHIEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCDEL
FT                   RDQNEDIDREDFAQRFDADFILMTGELAALIQNLIEGLGGEAQR"
FT   CDS_pept        472231..473139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="ECs_0445"
FT                   /product="manno(fructo)kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33867"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33867"
FT                   /db_xref="GOA:Q8XEA1"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEA1"
FT                   /protein_id="BAB33867.2"
FT                   /translation="MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIAT
FT                   LVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWM
FT                   DEDELRYREEVPCYCGKQGCIETFISGTGFATDYRRLSGHALKGSEIIRLVEESDPVAE
FT                   LALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYQTVPQLIKQFVFGGECETPV
FT                   RKAKHGDSSGVRGAAWLWPQE"
FT   CDS_pept        complement(473282..474550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="ECs_0446"
FT                   /product="L-arabinose-inducible transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33869"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33869"
FT                   /db_xref="GOA:Q8X5A5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5A5"
FT                   /protein_id="BAB33869.2"
FT                   /translation="MALLVVILQAITLLATVIGSRSGSCDGGMKKVILSLALGTFGLGM
FT                   AEFGIMGVLTELAHNVGISIPAAGHMISYYALGVVVGAPIIALFSSRYSLKHILLFLVA
FT                   LCVIGNAMFTLSSSYLMLAIGRLVSGFPHGAFFGVGAIVLSKIIKPGKVTAAVAGMVSG
FT                   MTVANLLGIPLGTYLSQEFSWRYTFLLIAVFNIAVMASVYFWVPDIRDEAKGKLREQFH
FT                   FLRSPAPWLIFAATMFGNAGVFAWFSYVKPYMMFISGFSETAMTFIMMLVGLGMVLGNM
FT                   LSGRISGRYSPLRIAAVTDFIIVLALLMLFFCGGMKTTSLIFAFICCAGLFALSAPLQI
FT                   LLLQNAKGGELLGAAGGQIAFNLGSAVGAYCGGMMLTLGLAYNYVALPAALLSFAAMSS
FT                   LLLYGRYKRQQAADSPVLAKPLG"
FT   CDS_pept        complement(474592..477735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="ECs_0447"
FT                   /product="exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33870"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33870"
FT                   /db_xref="GOA:Q8XEJ6"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEJ6"
FT                   /protein_id="BAB33870.2"
FT                   /translation="MKILSLRLKNLNSLKGEWKIDFTREPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHETPRLSNVSQSQNDLMTRDTAECLAEVEFEVKGEAYRAFWSQNRARNQ
FT                   PDGNLQVPRVELARCADGKILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AKPKERAELLEELTGTEIYGQISAMVFEQHKSARTELEKLQAQASGVALLTPEQVQSLT
FT                   ASLQVLTDEEKQLLTAQQQEQQSLNWLTRLDELQQEASRRQQALQQALAEEEKAQPQLA
FT                   ALSLAQPARNLRPHWERIAEHSAALAHTRQQIEEVNTRLQNTMALRASIRHHAAKQSAE
FT                   LQQQQQSLNTWLQEHDRFRQWNNELAGWRAQFSQQTSDREHLRQWQQQLTHAEQKLNAL
FT                   AAITLMLTADEVATALAQHAEQRPLRQRLVALHGQIVPQQKRLAQLMVTIQNVTLEQTQ
FT                   RNAALNEMRQRYKEKTQQLADVKTICEQEARIKTLEAQRAQLQAGQPCPLCGSTSHPAV
FT                   EAYQALEPGVNQSRLLALENEVKKLGEEGAALRGQLDALTKQLQRDENEAQSLRQDEQA
FT                   LTQQWQAVTASLNITLQPQDDIQPWLDAQDEHERQLRLLSQRHELQGQIAAHNQQIIQY
FT                   QQQIEQRQQQLLTALAGYALTLPQEDEEESWLATRQQEAQSWQQRQNELTALQNRIQQL
FT                   TPILETLPQSDDLPHSEETVALDNWRQVHEQCLALHSQQQTLQQQDVLAAQSLQKAQAQ
FT                   FDTALQASVFDDQQAFLAALMDEQTLTQLEQLKQNLENQRRQAQTLVTQTAETLAQHQQ
FT                   HRPDGLALTVTVEQIQQELAQTHQKLRENTTSQGEIRQQLKQDADNRQQQQTLLQQIAQ
FT                   MTQQVEDWGYLNSLIGSKEGDKFRKFAQGLTLDNLVHLANQQLTRLHGRYLLQRKASEA
FT                   LEVEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLD
FT                   SETLDTALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLESTFAVK"
FT   CDS_pept        complement(477732..478934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="ECs_0448"
FT                   /product="exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33871"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33871"
FT                   /db_xref="GOA:P0AG77"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG77"
FT                   /protein_id="BAB33871.1"
FT                   /translation="MRILHTSDWHLGQNFYSKSREAEHQAFLDWLLETAQTHQVDAIIV
FT                   AGDVFDTGSPPSYARTLYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDIMAFLNTTV
FT                   VASAGHAPQILPRRDGTPGAVLCPIPFLRPRDIITSQAGLNGIEKQQHLLAAITDYYQQ
FT                   HYADACKLRGDQPLPIIATGHLTTVGASKSDAVRDIYIGTLDAFPAQNFPPADYIALGH
FT                   IHRAQIIGGMEHVRYCGSPIPLSFDECGKSKYVHLVTFSNGKLESVENLNVPVTQPMAV
FT                   LKGDLASITAQLEQWRDVSQEPPVWLDIEITTDEYLHDIQRKIQALTESLPVEVLLVRR
FT                   SREQRERVLASQQRETLSELSVEEVFNRRLALEELDESQQQRLQHLFTTTLHTLAGEHE
FT                   A"
FT   CDS_pept        479124..479813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="ECs_0449"
FT                   /product="two-component regulatory system response
FT                   regulator PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33872"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33872"
FT                   /db_xref="GOA:P0AFJ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFJ6"
FT                   /protein_id="BAB33872.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEP
FT                   WPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   CDS_pept        479871..481166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ECs_0450"
FT                   /product="two-component system sensor histidine kinase
FT                   PhoR"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33873"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33873"
FT                   /db_xref="GOA:Q8XE99"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE99"
FT                   /protein_id="BAB33873.1"
FT                   /translation="MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSVISNLVYNAVNHTPEGTHIT
FT                   VRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIVKNSD"
FT   CDS_pept        481573..482892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="ECs_0451"
FT                   /product="branched chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33874"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33874"
FT                   /db_xref="GOA:P0ADA0"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ADA0"
FT                   /protein_id="BAB33874.1"
FT                   /translation="MTHQLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSALPLFIYSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIVWPAGSISTATEAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSASLVDQSANGAAILHAYVQHTFGGGGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQIS
FT                   VPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPPMFISLLFGILDGIKASAFSDILPSW
FT                   AQRLPLAEQGLAWLMPTVVMVVLAIIWDRAAGRQVTSSAH"
FT   CDS_pept        482968..484341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="ECs_0452"
FT                   /product="proline-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33875"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33875"
FT                   /db_xref="GOA:P0AAE4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAE4"
FT                   /protein_id="BAB33875.1"
FT                   /translation="MESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVL
FT                   LAYIIGGIAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAI
FT                   ADVTAFGIYMGVWFPTVPHWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIM
FT                   IVAGFGIIIWGIGNGGQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITA
FT                   GEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGITF
FT                   AASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTT
FT                   ALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKVP
FT                   GGVATTIGGLIFLLFIIGLIGYHPDTRISLYVGFAWIVVLLIGWMFKRRHDRQLAENQ"
FT   CDS_pept        484497..486314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="ECs_0453"
FT                   /product="maltodextrin glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33876"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33876"
FT                   /db_xref="GOA:A0A0H3JFX7"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFX7"
FT                   /protein_id="BAB33876.1"
FT                   /translation="MMLNAWHLPVPPFVKQSKDQLLITLWLTGEDPPQRIMLRTEHDNE
FT                   EMSVPMHKQRSQPQPGVTAWRAAIDLSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPA
FT                   RLEQFAVDVPDIGPQWAADQIFYQIFPDRFARSLPREAEQDHVYYHHAAGQEIILRDWD
FT                   EPVTAQAGGSTFYGGDLDGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDP
FT                   QFGGDGALLRLRHNTQQLGMRLVLDGVFNHSGDSHAWFDRHNRGTGGACHNPESPWRDW
FT                   YSFSDDGTALDWLGYASLPKLDYQSESLVNEIYRGEDSIVRHWLKAPWNMDGWRLDVVH
FT                   MLGEAGGARNNLQHVAGITEAAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTF
FT                   PLWGFLANTDISYDPQQIDAQTCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLG
FT                   REVARLPLAVVWLFTWPGVPCIYYGDEVGLDGKNDPFCRKPFPWQVEKQDMALFALYQR
FT                   MIALRKKSQALRRGGCQVLYAEDNVVVFVRVLNQQRVLVAINRGEACEVVLPASPFLNV
FT                   VQWQRKEGHGQLTDGILALPAISATVWMN"
FT   CDS_pept        486502..487947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33877"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33877"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE97"
FT                   /protein_id="BAB33877.1"
FT                   /translation="MTISNSNLLKPFITGTELPPFKEDVFSKTEEQFKKSTYGKSLFIS
FT                   GNENLVNISAEKIDEIKNSKNFFSNIVNIIILLIKHPDKILPILHGCPVESIEVIKNAK
FT                   RTGQWSYEMTDKNGQSIEVSYIFTDTIDDKSDGKLCLKICNSCNQNDSSTHEYKIDHQQ
FT                   LKNHIRQLEEWALLEKFYDNNAYYSKRTKQLEKKIADAGFITRKVKAENFNVKEFKDDI
FT                   ASMLCEQPPMRTHQISSSGYVSADKLHKLYKTNLEDAQRDLKTTPVDIDGVSLKSITRE
FT                   KIAEEIAKKTAEIIAKQNAKSIEEKNIEKNKKQTNSEDNFVLKFSPEEINEMLLDYSDE
FT                   EQKKLRPFFTSDHIYCLFDAFSQGLHNVARNGSPRYAGLLRQIASKSAILQDFDQQLFW
FT                   RTFTGGVLHRHISVKSEPEKTDVWRFSSQFDFPHINENGELSRTVLMFEGVAESNFKDI
FT                   ANHSSECFSYRCYAAPLDANAKK"
FT   CDS_pept        complement(487968..488549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="ECs_0455"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33878"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33878"
FT                   /db_xref="GOA:Q8XE96"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE96"
FT                   /protein_id="BAB33878.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSW
FT                   YDLDAHYAALETRFWQFYPRMMAQASRKAL"
FT   CDS_pept        488642..489712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="ECs_0456"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33879"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33879"
FT                   /db_xref="GOA:P0A7G0"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7G0"
FT                   /protein_id="BAB33879.1"
FT                   /translation="MRVTDFSFELPESLIAHYPMPERSSCRLLSLDGPTGALTHGTFTD
FT                   LLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   AELLLGDDESINATMTARHGALFEVEFNDERSVLDILNSIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIED
FT                   HIMHSEYAEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKNDLIEPFFDDTQ
FT                   IFIYPGFQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYGDA
FT                   MFITYNPQAINERVGE"
FT   CDS_pept        489767..490894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="ECs_0457"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33880"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33880"
FT                   /db_xref="GOA:P0A849"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A849"
FT                   /protein_id="BAB33880.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRERFDSLGNKNALFGIIQGSVYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKA
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD"
FT   CDS_pept        490917..491249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="ECs_0458"
FT                   /product="SecYEG protein translocase auxiliary subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33881"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33881"
FT                   /db_xref="GOA:P0ADZ9"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ADZ9"
FT                   /protein_id="BAB33881.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   CDS_pept        491310..493124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ECs_0459"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33882"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33882"
FT                   /db_xref="GOA:P0AG91"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG91"
FT                   /protein_id="BAB33882.2"
FT                   /translation="MLIVVIVIGLLYALPNLFGEDPAVQITGARGVAASEQTLIQVQKT
FT                   LQEEKITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALNLAPATPRWLAA
FT                   IHAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGIPYTTVRKENNY
FT                   GLSITFRDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEAREYAVQQNINI
FT                   LRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNTNVDQAA
FT                   AASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQVNISLDSAGGN
FT                   IMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQSRLGNSFRITG
FT                   INNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACLAGLLVSILFMI
FT                   IFYKKFGLIATSALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVAVDANVLINERI
FT                   KEELSNGRTVQQAIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIKGFAITTGIGVA
FT                   TSMFTAIVGTRAIVNLLYGGKRVKKLSI"
FT   CDS_pept        493135..494106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ECs_0460"
FT                   /product="protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33883"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33883"
FT                   /db_xref="GOA:P0AG95"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG95"
FT                   /protein_id="BAB33883.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGE
FT                   TGGQVLGSQVLKVINESTNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   CDS_pept        494257..494499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0461"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33884"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33884"
FT                   /db_xref="GOA:P58092"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58092"
FT                   /protein_id="BAB33884.1"
FT                   /translation="MRKITSVSVGEQLDSFITRMVQSGRYGSASEVMRSALRLLEQQES
FT                   RDEAVRNAVIEGLESGESSMTLRDIAAERKQKHRV"
FT   CDS_pept        494492..494773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0462"
FT                   /product="plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33885"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33885"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE95"
FT                   /protein_id="BAB33885.1"
FT                   /translation="MYKLSGKAVEDFRGIYDYTLGKFGDEQADRYTDSLGTFLDTLSQM
FT                   PEIGQDYDAIPEVKKIAFRFHTVYYVIRVDDILIARILHQLMEPRRHW"
FT   CDS_pept        494861..495208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="ECs_0463"
FT                   /product="HNH nuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33886"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33886"
FT                   /db_xref="GOA:P0AAQ4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAQ4"
FT                   /protein_id="BAB33886.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
FT   CDS_pept        complement(495385..496269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="ECs_0464"
FT                   /product="nucleoside-specific channel-forming protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33887"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33887"
FT                   /db_xref="GOA:P0A928"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A928"
FT                   /protein_id="BAB33887.1"
FT                   /translation="MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEP
FT                   RFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSM
FT                   NVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSG
FT                   NAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRS
FT                   TGWGGYLVVGYNF"
FT   CDS_pept        complement(496568..497107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="ECs_0465"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33888"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33888"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE89"
FT                   /protein_id="BAB33888.2"
FT                   /translation="MNINVFRLILLGSLFSLSACVQQSEVRQMKHSVSTLNQEMTQLNQ
FT                   ETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDTDGTTLTLRIQ
FT                   GESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISV
FT                   DQLGFVRIHDIQPVMQ"
FT   CDS_pept        497258..497707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="ECs_0466"
FT                   /product="transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33889"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33889"
FT                   /db_xref="GOA:P0A8D2"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8D2"
FT                   /protein_id="BAB33889.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
FT   CDS_pept        497711..498814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="ECs_0467"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33890"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33890"
FT                   /db_xref="GOA:Q8XE88"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE88"
FT                   /protein_id="BAB33890.1"
FT                   /translation="MQDEYYMARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQR
FT                   AGEPHAEVHALRMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIDVSHGLMMSEAEQLNKGFLKRMRTGFPYIQLKLGASLDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWSELDVQTQALYPQH
FT                   HLRQPVRIVIDSQNRVTPEHHIVQQPGETWFARTQEDSREWPETVRTLLIPEHKGHLDL
FT                   VVLMMQLGKQQINSIWVEAGPTLAGALLQAGLVDELIVYIAPKLLGSDARGLCTLPGLE
FT                   KLADAPQFKFKEIRHVGPDVCLHLVGA"
FT   CDS_pept        498903..499373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="ECs_0468"
FT                   /product="riboflavin synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33891"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33891"
FT                   /db_xref="GOA:P61717"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61717"
FT                   /protein_id="BAB33891.1"
FT                   /translation="MNIIEANVATPDARVAITIARFNNFINDSLLEGAIDALKRIGQVK
FT                   DENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHV
FT                   AQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   CDS_pept        499393..499812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="ECs_0469"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33892"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33892"
FT                   /db_xref="GOA:P0A782"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A782"
FT                   /protein_id="BAB33892.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   CDS_pept        499890..500867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ECs_0470"
FT                   /product="thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33893"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33893"
FT                   /db_xref="GOA:Q8XE87"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE87"
FT                   /protein_id="BAB33893.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLG
FT                   HIVKASDCGARIDLALLPFSDALSRHVVPEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALGHLGVPFTCIGQMTADIEGLCFIRDGEPVTLDWKGYDHFATP"
FT   CDS_pept        500845..501360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="ECs_0471"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33894"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33894"
FT                   /db_xref="GOA:Q8XE86"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE86"
FT                   /protein_id="BAB33894.1"
FT                   /translation="MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAA
FT                   IPFWYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMA
FT                   LPTNDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIG
FT                   HHWPLGIL"
FT   CDS_pept        complement(501538..503109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY3"
FT                   /locus_tag="ECs_0472"
FT                   /product="T3SS effector-like protein EspY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33895"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33895"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE85"
FT                   /protein_id="BAB33895.1"
FT                   /translation="MMKTITKQPILFTDVPVADLRNSMKQDLNQNLIERLWNKIRDFFL
FT                   DSDKQKAFKSIHKYINTLSVLNYNSALTPDPNFNIDATSDLDSYLKLDFDRLSPKQKQT
FT                   TLCCFWNKIASSLPEPYNSTIKHNIIFYKDGENLMIRGTISIVNEVVKTYSLPIEKDDN
FT                   GYYDFSGLYLAHSNISGKDPNKDPDIDFGIDMGNCNCSNVNFEHTYFYGVKFTNANCTN
FT                   ANFNNCRFKKCDLTNMNCTGAILDNAMIYGKEKEPEMQYPEADQIIQRITYQKSDGNET
FT                   KGMILTNCSCVKTTFNWADLSESDCQNVDFSEANLSNTILPDIVRMKGTKLYRTDLFNP
FT                   ILKTEAESTEEKDISPLAKIILDYIESDKNPESLNFEEKSTVIKIKQDIDNFIFYNQHL
FT                   KKIFNRAMNLQEKISRKKYNEFFKYIQAEAKQYFKDQYKLTKNDYLKKVPLTAQLIAKY
FT                   KMDDQLDQLLVTREIQDEIKSKIQDKIDELSKNLFNTMTETIENNFDDIFRQQSENMSN
FT                   YYEFVD"
FT   CDS_pept        complement(503340..504314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="ECs_0473"
FT                   /product="2-carboxybenzaldehyde reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33896"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33896"
FT                   /db_xref="GOA:Q8XE84"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE84"
FT                   /protein_id="BAB33896.1"
FT                   /translation="MQYNPLGKTDLRVSRLCLGCMTFGEPDRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFSRREDVVVATKVFHRVGDLPEGLSRAQ
FT                   ILRSIDDSLRRLGMDYVDILQIHRWDYNTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALELQKQHGWAQFVSMQDHYNLIYREEEREMLPLCYQEGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDEVGKNLYKESDENDAQIAERLTGVSEELGATRAQVALAWLLSKPGIAA
FT                   PIIGTSREEQLDELLNAVDITLKPEQIAELETPYKPHPVVGFK"
FT   CDS_pept        complement(504369..506231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="ECs_0474"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33897"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33897"
FT                   /db_xref="GOA:Q8XE76"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE76"
FT                   /protein_id="BAB33897.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEA
FT                   MNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLM
FT                   AITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRA
FT                   YDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECR
FT                   QMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPE
FT                   AAKVAESLNATLVDMRFVKPLDETLILEMAASHEALVTVEENAIMGGAGSGVNEVLMAH
FT                   RKPVPVLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKAWLA"
FT   CDS_pept        complement(506256..507155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="ECs_0475"
FT                   /product="geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33898"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33898"
FT                   /db_xref="GOA:Q8XE75"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE75"
FT                   /protein_id="BAB33898.1"
FT                   /translation="MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGK
FT                   RLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVK
FT                   FGEANAILAGDALQTLAFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLD
FT                   AEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKAQDLIDDARQSLKQLAEQS
FT                   IDTSALEALADYIIQRNK"
FT   CDS_pept        complement(507155..507397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="ECs_0476"
FT                   /product="exonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33899"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33899"
FT                   /db_xref="GOA:P0A8H1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8H1"
FT                   /protein_id="BAB33899.1"
FT                   /translation="MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEDASLTPFTPDNE"
FT   CDS_pept        507603..509051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="ECs_0477"
FT                   /product="tRNA s(4)U8 sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33900"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33900"
FT                   /db_xref="GOA:Q8XE74"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE74"
FT                   /protein_id="BAB33900.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRAKDENQRLTIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLDG
FT                   KTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRFGSSHRVRFVAINFEPVVGEILEKIDDGQMGVILKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTM
FT                   PEYCGVISKSPTVKAVKSKIEAEEEKFDFSILDKVVEEANNVDIREIAQQTGQEVVEVE
FT                   TVNDFGPNDVILDIRSVDEQEDKPLKVEGIDVVSLPFYKLSTKFGDLDQNRTWLLWCER
FT                   GVMSRLQALYLREQGFKNVKVYRP"
FT   CDS_pept        complement(509105..509695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajL"
FT                   /locus_tag="ECs_0478"
FT                   /product="oxidative stress resistance chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33901"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33901"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE73"
FT                   /protein_id="BAB33901.2"
FT                   /translation="MSASALVCLAPGSEETEAVTTIDLLIRGGIKVTTASVASDGNLAI
FT                   TCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAA
FT                   ICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
FT   CDS_pept        complement(509658..510569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="ECs_0479"
FT                   /product="2-dehydropantoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33902"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33902"
FT                   /db_xref="GOA:Q8XE72"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE72"
FT                   /protein_id="BAB33902.1"
FT                   /translation="MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETD
FT                   GSIFNESLTANDPDFLATSDLLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIE
FT                   ELQNIQQPLLMGTTTHAACRDGNVIIHVANGITHIGPARQQDGDYSYLADILQTVLPDV
FT                   AWHNNIRAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHT
FT                   SAEDLRDYVMQVIDATAENISSMLQDIRTLRHTEIDYINGFLLRRARAHGIAVPENTRL
FT                   FEMVKRKESEYERIGTGLPRPW"
FT   CDS_pept        510737..511228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="ECs_0480"
FT                   /product="nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33903"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33903"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8E9"
FT                   /protein_id="BAB33903.2"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
FT   CDS_pept        complement(511356..512720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="ECs_0481"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33904"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33904"
FT                   /db_xref="GOA:Q8XE71"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE71"
FT                   /protein_id="BAB33904.2"
FT                   /translation="MNDYKMTPGERRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGA
FT                   SEALIGIAIGIYGLTQAVFQIPFGLLSDRIGRKPLIVGGLAVFAAGSVIAALSDSIWGI
FT                   ILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIITHKLG
FT                   LHALFWMIAILATTGIALTIWVVPNSSTHVLNRESGMVKGSFSKVLAEPRLLKLNFGIM
FT                   CLHILLMSTFVALPGQLADAGFPAAEHWKVYLATMLIAFGSVVPFIIYAEVKRKMKQVF
FT                   VFCVGLIVVAEIVLRNAQTQFWQLVVGVQLFFVAFNLMEALLPSLISKESPAGYKGTAM
FT                   GVYSTSQFLGVAIGGSLGGWIDGMFDGQGVFLAGAMLAAVWLAVASTMKEPPYVSSLRI
FT                   EIPANIAANEALKVRLLETEGIKEVLIAEEEHSAYVKIDSKVTNRFDVEQAIRQA"
FT   CDS_pept        complement(512869..513759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="ECs_0482"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33905"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33905"
FT                   /db_xref="GOA:P0AEA7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEA7"
FT                   /protein_id="BAB33905.1"
FT                   /translation="MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVG
FT                   VSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPAVSLVYATLLGIAGFMLLWFG
FT                   ANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGEFDSGAA
FT                   ILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLM
FT                   LSLGGYAGYKYLVVAAAVSVWWLGMALRGYKVADDRIWARKLFGFSIIAITALSVMMSV
FT                   DFMVPDSHTLLAAVW"
FT   CDS_pept        complement(513771..514100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="ECs_0483"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33906"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33906"
FT                   /db_xref="GOA:P0ABJ7"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABJ7"
FT                   /protein_id="BAB33906.1"
FT                   /translation="MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAV
FT                   ILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
FT   CDS_pept        complement(514100..514714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="ECs_0484"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33907"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33907"
FT                   /db_xref="GOA:Q8XE64"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE64"
FT                   /protein_id="BAB33907.1"
FT                   /translation="MATDTLTHATVHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
FT   CDS_pept        complement(514704..516695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="ECs_0485"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33908"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33908"
FT                   /db_xref="GOA:P0ABJ0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABJ0"
FT                   /protein_id="BAB33908.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYALGFMGMTRRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMY
FT                   VSIRDRDQNRDLTGDPWGGRTLEWATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKK
FT                   PDHYEEIHMPKNSGAGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVD
FT                   YYVPVAEIEKLENQHFDEITKAGLKNGN"
FT   CDS_pept        complement(516717..517664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="ECs_0486"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33909"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33909"
FT                   /db_xref="GOA:Q8XE63"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE63"
FT                   /protein_id="BAB33909.1"
FT                   /translation="MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLIL
FT                   TAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLA
FT                   VLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGFATVNEIAFPANTPVYF
FT                   KVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKA
FT                   IATPDRAAFDQWVAKAKQSPNSMSDMAAFEKLAAPSEYNQVEYFSNVKPNLFADVINKF
FT                   MAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH"
FT   CDS_pept        complement(518124..519599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="ECs_0487"
FT                   /product="muropeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33910"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33910"
FT                   /db_xref="GOA:P0AE17"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AE17"
FT                   /protein_id="BAB33910.1"
FT                   /translation="MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFFGRRRGWLLATQILLLVAIAAMGFLEPG
FT                   TQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLA
FT                   LWLADKWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPVPKTLEQAVVAPLRDFFGRN
FT                   NAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGI
FT                   LMQRLSLFRALLIFGILQGASNAGYWLLSITDKHLYSMGAAVFFENLCGGMGTSAFVAL
FT                   LMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWSTFYLFSVAAAVPGLILL
FT                   LVCRQTLEYTRVNDNFISRTAYPAGYAFAMWTLAAGVSLLAVWLLLLTMDALDLTHFSF
FT                   LPALLEVGVLVALSGVVLGGLLDYLALRKTHLT"
FT   CDS_pept        complement(519643..520221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="ECs_0488"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33911"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33911"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE62"
FT                   /protein_id="BAB33911.2"
FT                   /translation="MFKKILFPLVALFMLAGCARPPTTIEVSPTITLPQQDPSLMGVTV
FT                   SINGADQRTDQALAKVTRDNQIVTLTASRDLRFLLQEVLEKQMTARGYMVGPNGPVNLQ
FT                   IIVSQLYADVSQGNVRYNIATKADIAIIATAQNGNKMTKNYRASYNVEGAFQASNKNIA
FT                   DAVNSVLTDTIADMSQDTSIHEFIKQNAR"
FT   CDS_pept        520529..520843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="ECs_0489"
FT                   /product="transcriptional regulator BolA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33912"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33912"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE61"
FT                   /protein_id="BAB33912.2"
FT                   /translation="MIRERIEEKLRAAFQPVFLEVVDESYRHNVPAGSESHFKVVLVSD
FT                   RFTGERFLNRHRMIYSTLAEELSTTVHALALHTYTIKEWEGLQDTVFASPPCRGAGSIA
FT                   "
FT   CDS_pept        521187..522485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="ECs_0490"
FT                   /product="peptidyl-prolyl cis/trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33913"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33913"
FT                   /db_xref="GOA:P0A851"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A851"
FT                   /protein_id="BAB33913.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFT
FT                   YSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGMLDTLRKQQATWKEKDGAVEAEDR
FT                   VTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSA
FT                   IRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVTEKETTFNELMNQQA"
FT   CDS_pept        522730..523353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="ECs_0491"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33914"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33914"
FT                   /db_xref="GOA:P0A6G9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6G9"
FT                   /protein_id="BAB33914.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
FT   CDS_pept        523479..524753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="ECs_0492"
FT                   /product="ATP-dependent protease ATP-binding subunit ClpX"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33915"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33915"
FT                   /db_xref="GOA:P0A6H3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6H3"
FT                   /protein_id="BAB33915.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKA
FT                   SEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIDGQSKPLLIYGKPEAQQASGE"
FT   CDS_pept        524941..527295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="ECs_0493"
FT                   /product="lon protease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33916"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33916"
FT                   /db_xref="GOA:A0A152UUM3"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UUM3"
FT                   /protein_id="BAB33916.1"
FT                   /translation="MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMD
FT                   HDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALS
FT                   DNGEHFSAKAEYLESPTIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPA
FT                   RLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQME
FT                   KSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMM
FT                   SPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILNTDHYGLERVKDRILEYLAV
FT                   QSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALK
FT                   KGELTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAVKQLLLDKSLKHIEINGDNLH
FT                   DYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQ
FT                   ESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTG
FT                   NPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIA
FT                   DLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
FT   CDS_pept        527504..527776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="ECs_0494"
FT                   /product="transcriptional regulator HU subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33917"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33917"
FT                   /db_xref="GOA:P0ACF6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACF6"
FT                   /protein_id="BAB33917.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
FT   CDS_pept        527968..529839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="ECs_0495"
FT                   /product="peptidyl-prolyl cis-trans isomerase D"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33918"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33918"
FT                   /db_xref="GOA:Q8XE55"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE55"
FT                   /protein_id="BAB33918.1"
FT                   /translation="MMDSLRTAANSLVLKIIFGIIIVSFILTGVSGYLIGGGNNYAAKV
FT                   NDQEISRGQFENAFNSERNRMQQQLGDQYSELAANEGYMKTLRQQVLNRLIDEALLDQY
FT                   ARELKLGISDEQVKQAIFATPAFQVDGKFDNSRYNGILNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVAQQRVVREATIDVNALAAKQPVTEQEIASYYEQNK
FT                   NNFMTPEQFRVSYIKLDAATMQQPVSDADLQSYYDQHQDQFTQPQRTRYSIIQTKTEDE
FT                   AKAVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPDELKNAGLKEKGQLSG
FT                   VIKSSVGFLIVRLDDIQPAKVKSLDEVRDDVAAKVKHEKALDAYYALQQKVSDAASNDT
FT                   ESLAGAEQAAGVKATQTGWFSKENLPEELNFKPVADAIFNGGLVGENGAPGINSDIITV
FT                   DGDRAFVLRISEHKPEAVKPLADVQEQVKALVQHNKAEQQAKVDAEKLLVDLKAGKGAE
FT                   AMQAAGLKFGEPKTLSRSGRDPISQAAFALPLPAKDKPSYGMATDMQGNVVLLALDEVK
FT                   QGSMPEDQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
FT   CDS_pept        529990..530361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECs_0496"
FT                   /product="competence-suppressing periplasmic
FT                   helix-hairpin-helix DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33919"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33919"
FT                   /db_xref="GOA:Q8XE54"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE54"
FT                   /protein_id="BAB33919.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQ
FT                   NKAAVPAKASDEEGSRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
FT   CDS_pept        530467..530865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadM"
FT                   /locus_tag="ECs_0497"
FT                   /product="long-chain acyl-CoA thioesterase III"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33920"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33920"
FT                   /db_xref="GOA:Q8XE53"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE53"
FT                   /protein_id="BAB33920.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFHWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
FT   CDS_pept        complement(530917..531612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="ECs_0498"
FT                   /product="7-cyano-7-deazaguanine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33921"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33921"
FT                   /db_xref="GOA:Q8XE52"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE52"
FT                   /protein_id="BAB33921.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKVLNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGIKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AMKQKTGLK"
FT   CDS_pept        complement(531677..533377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="ECs_0499"
FT                   /product="ABC transporter periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33922"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33922"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE51"
FT                   /protein_id="BAB33922.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHVRTLLR
FT                   QAQEAGWLEWQAQSGRGKRGQLRFLVTPESLRNAMMEKALETGKQQDVLELAQLAPGEL
FT                   RTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRFDNNTQ
FT                   RPIGDLAHHWETSADGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFIS
FT                   VKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRL
FT                   ESHDYYHLRHPLLKAVEYWITPPLFEKDLGTSCRHPVQITIGKPEELQRVSQVSSGISL
FT                   GFCYLTLRKSPRLSLWQARKVISIIHQSGLLQTLEVGENLITASHALLPGWTIPHWQVP
FT                   DEVKLPKTLTLVYHLPIELHTMAERLQATLAAEGCELTIIFHNAKNWDDTTLLAHADLM
FT                   MGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAYAHLQSTLDAVQVMPDEENRFNALKAV
FT                   FSQLMTDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFTEAWLPAPSQ"
FT   CDS_pept        533477..534295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="ECs_0500"
FT                   /product="thiamine pyrimidine pyrophosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33923"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33923"
FT                   /db_xref="GOA:Q8XE50"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE50"
FT                   /protein_id="BAB33923.2"
FT                   /translation="MARLAAFDMDGTLLMPDHHLGEKTLSTLARLRERDITLTFATGRH
FT                   ALEMQHILGAISLDAYLITGNGTRVHSLEGELLHRDDLPADVAELVLYQQWDTRASMHI
FT                   FNDDGWFTGKEIPALLQAFVYSGFRYQIIDVKKMPLGSVTKICFCGDHDDLTRLQIQLH
FT                   EALGERAHLCFSATDCLEVLPVGCNKGAALTVLTQHLGLSLRDCMAFGDAMNDREMLGS
FT                   VGSGFIMGNAMPQLRAELPHLPVIGHCRNQAVSHYLTHWLDYPHLPYSPE"
FT   CDS_pept        534447..534905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaO"
FT                   /locus_tag="ECs_0501"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33924"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33924"
FT                   /db_xref="GOA:P0ACJ7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACJ7"
FT                   /protein_id="BAB33924.2"
FT                   /translation="MLDKIDRKLLALLQQDCTLSLQALAEAVNLTTTPCWKRLKRLEDD
FT                   GILIGKVALLDPEKIGLGLTAFVLIKTQHHSSEWYCRFVTVVTEMPEVLGFWRMAGEYD
FT                   YLMRVQVADMKRYDEFYKRLVNSVPGLSDVTSSFAMEQIKYTTSLPIE"
FT   CDS_pept        534935..536707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="ECs_0502"
FT                   /product="multidrug ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33925"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33925"
FT                   /db_xref="GOA:Q8XE49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE49"
FT                   /protein_id="BAB33925.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAVALLVIIAMLQLVPPKVVGIVVDG
FT                   VTEQHFTTGQILMWIATMVLIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYLRHRTGDLMARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIMMSTQISWQLTLF
FT                   ALLPMPVMAIMIKRNGDALHERFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSAL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAIGGGSWMVVQGSLTLGQLTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVNDGSEPVPEGRGELDVNIH
FT                   QFTYPQTDHPALENVNFALKPGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIP
FT                   LTKLQLDSWRSRLAVVSQTPFLFSDTVANNIALGCPNATQQEIEHVARLASVHDDILRL
FT                   PQGYDTEVGERGVMLSGGQKQRISIARALLVNAEILILDDALSAVDGRTEHQILHNLRQ
FT                   WGQGRTVIISAHRLSALTEASEIIVMQHGHIAQRGNHDVLAQQSGWYRDMYRYQQLEAA
FT                   LDDAPENREEAVDA"
FT   CDS_pept        536700..538481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="ECs_0503"
FT                   /product="multidrug ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33926"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33926"
FT                   /db_xref="GOA:P0AAG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAG7"
FT                   /protein_id="BAB33926.1"
FT                   /translation="MRSFSQLWPTLKRLLAYGSPWRKPLGIAVLMMWVAAAAEVSGPLL
FT                   ISYFIDNMVAKNNLPLKVVAGLAAAYVGLQLFAAGLHYAQSLLFNRAAVGVVQQLRTDV
FT                   MDAALRQPLSEFDTQPVGQVISRVTNDTEVIRDLYVTVVATVLRSAALVGAMLVAMFSL
FT                   DWRMALVAIMIFPVVLVVMVIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQ
FT                   QARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSSLILCGLLMLFGFSASGTIEV
FT                   GVLYAFISYLGRLNEPLIELTTQQAMLQQAVVAGERVFELMDGPRQQYGNDDRPLQSGT
FT                   IEVDNVSFAYRDDNLVLKNINLSVPSRNFVALVGHTGSGKSTLASLLMGYYPLTEGEIR
FT                   LDGRPLSSLSHSALRQGVAMVQQDPVVLADTFLANVTLGRDISEERVWQALETVQLAEL
FT                   ARSMSDGIYTPLGEQGNNLSVGQKQLLALARVLVETPQILILDEATASIDSGTEQAIQH
FT                   ALAAVREHTTLVVIAHRLSTIVDADTILVLHRGQAVEQGTHQQLLAAQGRYWQMYQLQL
FT                   AGEELAASVREEESLSA"
FT   CDS_pept        538662..539000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="ECs_0504"
FT                   /product="nitrogen regulatory protein P-II 2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33927"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33927"
FT                   /db_xref="GOA:P0AC57"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AC57"
FT                   /protein_id="BAB33927.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
FT   CDS_pept        539030..540316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="ECs_0505"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33928"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33928"
FT                   /db_xref="GOA:P69680"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="PDB:4NH2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69680"
FT                   /protein_id="BAB33928.1"
FT                   /translation="MKIATIKTGLASLAMLPGLVMAAPAVADKADNAFMMICTALVLFM
FT                   TIPGIALFYGGLIRGKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLM
FT                   LKNIELTAVMGSIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYI
FT                   PIAHMVWGGGLLASHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPM
FT                   VFTGTAILYIGWFGFNAGSAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLL
FT                   GACSGAIAGLVGVTPACGYIGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVH
FT                   GVCGIVGCIMTGIFAASSLGGVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLA
FT                   DLTVGLRVPEEQEREGLDVNSHGENAYNA"
FT   CDS_pept        complement(540365..541225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="ECs_0506"
FT                   /product="acyl-CoA thioesterase 2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33929"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33929"
FT                   /db_xref="GOA:P0AGG3"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AGG3"
FT                   /protein_id="BAB33929.1"
FT                   /translation="MSQALKNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPEERLVHSFHSYFLRPGDSKKPIIYDVETLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPEAGFEHQKTMPSAPAPDGLPSETQIAQSLAHLLPPVLKDKFICDRPLEVRPV
FT                   EFHNPLKGHVAEPHRQVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEP
FT                   GIQIATIDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGV
FT                   MRNHN"
FT   CDS_pept        541443..542015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaY"
FT                   /locus_tag="ECs_0507"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33930"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33930"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD73"
FT                   /protein_id="BAB33930.1"
FT                   /translation="MKLVHMASGLAVAIALAACADKSADIQTPAPAANTSISATQQPAI
FT                   QQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLAQKAVRTEGKQSPFSFVLP
FT                   FNPADVQPNARILLSAAITVNDKLVFITDTVQPVINQGGTKADLTLVPVQQTAVPVQAS
FT                   GGATTTVPSTSPTQVNPSSAVPAPTQY"
FT   CDS_pept        complement(542048..542359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="ECs_0508"
FT                   /product="6-O-methylguanine DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33931"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33931"
FT                   /db_xref="GOA:A0A0H3JBW9"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBW9"
FT                   /protein_id="BAB33931.2"
FT                   /translation="MEKEDSFPQRVWQIVAAIPEGYVTTYGDVAKLAGSPRAARQVGGV
FT                   LKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQRQALLAEGVMVSGSGQIDLQRYRWNY"
FT   CDS_pept        542738..543091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="ECs_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33932"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33932"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAQ8"
FT                   /protein_id="BAB33932.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
FT   CDS_pept        complement(543133..544683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="ECs_0510"
FT                   /product="membrane-anchored cyclic-di-GMP
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33933"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33933"
FT                   /db_xref="GOA:Q8X578"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X578"
FT                   /protein_id="BAB33933.2"
FT                   /translation="MRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDTYS
FT                   SRVAIRANKVATQGKDALQELERWQGADCSEAHLMEMRRVSYSYRYIQEVVYIDNNVPQ
FT                   CSSLEHESPPDTFPEPGKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASFID
FT                   VIPYSSWQIDAAIIGNAHNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPFPEM
FT                   NISIITWASSKMLQKGWHRQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAIEN
FT                   RDICVHYQPIVSLANGKIVGAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLIIR
FT                   SVFEDMGDWLRQHPQQHISINLESTVLTSEKIPQLLREMINHYQVNPRQIALELTEREF
FT                   ADPKTSAPIISRYREAGHEIYLDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETSKQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQHL"
FT   CDS_pept        complement(544847..545317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="ECs_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33934"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33934"
FT                   /db_xref="GOA:P0AAS1"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAS1"
FT                   /protein_id="BAB33934.2"
FT                   /translation="MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVA
FT                   FFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWY
FT                   NTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS"
FT   CDS_pept        complement(545433..545984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="ECs_0512"
FT                   /product="maltose O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33935"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33935"
FT                   /db_xref="GOA:Q8XD68"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD68"
FT                   /protein_id="BAB33935.1"
FT                   /translation="MSTEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTL
FT                   RQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAL
FT                   GVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVT
FT                   KDVPDNVVVGGNPARIIKKL"
FT   CDS_pept        complement(546156..546374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="ECs_0513"
FT                   /product="modulator of gene expression with H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33936"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33936"
FT                   /db_xref="GOA:P0ACE5"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACE5"
FT                   /protein_id="BAB33936.1"
FT                   /translation="MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
FT   CDS_pept        complement(546400..546774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tomB"
FT                   /locus_tag="ECs_0514"
FT                   /product="Hha toxicity attenuator TomB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33937"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33937"
FT                   /db_xref="GOA:P0AAR2"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAR2"
FT                   /protein_id="BAB33937.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAIN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYLDDTFMLFSSYGINMQDLQKWRKSG
FT                   NRLFRCFVNATKENPASLSC"
FT   CDS_pept        complement(547320..550469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB_1"
FT                   /locus_tag="ECs_0515"
FT                   /product="multidrug efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33938"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33938"
FT                   /db_xref="GOA:Q8XD55"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD55"
FT                   /protein_id="BAB33938.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSIEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
FT                   NGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPIAKGDHGEGKKGFFGWFN
FT                   RMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMV
FT                   QLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTGVGYDWTGMSYQERLSGN
FT                   QAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRPILMTSLAFILGVMPL
FT                   VISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRKNEDIEHNHTVDH
FT                   H"
FT   CDS_pept        complement(550492..551685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="ECs_0516"
FT                   /product="multidrug efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33939"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33939"
FT                   /db_xref="GOA:P0AE07"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AE07"
FT                   /protein_id="BAB33939.1"
FT                   /translation="MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTV
FT                   KTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQAT
FT                   YDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVAS
FT                   QAIGDKWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS"
FT   CDS_pept        551827..552474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="ECs_0517"
FT                   /product="transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33940"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33940"
FT                   /db_xref="GOA:Q8X5D3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5D3"
FT                   /protein_id="BAB33940.1"
FT                   /translation="MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTR
FT                   GAIYWHFKDKSDLFSEIWELSESNIGELELEYQAKFPSDPLSVLREILIHVLESTVTEE
FT                   RRRLLMEIIFHKCEFVGEMAVVQQAQRNLCLESYDRIEQTLKHCIEAKMLPADLMTRRA
FT                   AIIMRGYISGLMENWLFAPQSFDLKKEARDYVAILLEMYLLCPTLRNPATNE"
FT   CDS_pept        552602..555964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscK"
FT                   /locus_tag="ECs_0518"
FT                   /product="mechanosensitive channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33941"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33941"
FT                   /db_xref="GOA:Q8XD54"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD54"
FT                   /protein_id="BAB33941.1"
FT                   /translation="MTMFQYYKRSRHFVFSAFIAFVFVLLCQNTAFARASSNGDLPTKA
FT                   DLQAQLDSLNKQKDLSAQDKLVQQDLTDTLATLDKIDRVKEETVQLRQKVAEAPEKMRQ
FT                   ATAALTALSDVDNDEETRKILSTLSLRQLETRVAQALDDLQNAQNDLASYNSQLVSLQT
FT                   QPERVQNAMYNASQQLQQIRSRLDGTDVGETALRPSQKVLMQAQQALLNAEIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSARLEHQLQLLQEAVNSKRLTLTEKTAQEAVSPDEAARI
FT                   QANPLVKQELEINQQLSQRLITATENGNQLMQQNIKVKNWLERALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELENMTNRIADLRLEQFEVNQQRDALFQSDAFVNKLEEG
FT                   HTNEVNSEVHDALLQVVDMRRELLDQLNKQLGNQLMMAINLQINQQQLMSVSKNLKSIL
FT                   TQQIFWVNSNRPMDWDWIKAFPQSLKDEFKSMKITVNWEKAWPAVFIAFLAGLPLLLIA
FT                   GLIHWRLGWLKAYQQKLASAVGSLRNDSQLNTPKAILIDLIRALPVCLIILAVGLILLT
FT                   MQLNISELLWSFSKKLAIFWLVFGLCWKVLEKNGVAVRHFGMPEQQTSHWRRQIVRISL
FT                   ALLPIHFWSVVAELSPLHLMDDVLGQAMIFFNLLLIAFLVWPMCRESWRDKESHTMRLV
FT                   TITVLSIIPIALMVLTATGYFYTTLRLSGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPPEEPTIALEQVNQQTLRITMLLMFALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGTEAGAAVVKNVTMGSLLFAIIASMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYIIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLTDTTTRLVIRLGVAYGSDLEKVRKVLLKAATEHPRVMHEPMPEVFFTAFGAS
FT                   TLDHELRLYVRELRDRSRTVDELNRTIDQLCRENDINIAFNQLEVHLHNEKGDEVTEVK
FT                   RDYKGDDPTPAVG"
FT   CDS_pept        complement(556003..556167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="ECs_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33942"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33942"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD52"
FT                   /protein_id="BAB33942.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPARTVLRALDIVKRDYEKKL
FT                   QSDEASQSE"
FT   CDS_pept        complement(556181..556708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="ECs_0520"
FT                   /product="primosomal replication protein PriC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33943"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33943"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCK2"
FT                   /protein_id="BAB33943.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFNRHLFQTRATT
FT                   LQACLDKAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREATAWSLREWDSAPPQ
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
FT   CDS_pept        556778..557155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="ECs_0521"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33944"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33944"
FT                   /db_xref="GOA:P0AAR6"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAR6"
FT                   /protein_id="BAB33944.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
FT   CDS_pept        557308..557859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="ECs_0522"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33945"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33945"
FT                   /db_xref="GOA:Q8XD48"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD48"
FT                   /protein_id="BAB33945.1"
FT                   /translation="MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI
FT                   DLLVERYKNAGINKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
FT                   GTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGG
FT                   EQRLEKQGITSYSLVPFPGH"
FT   CDS_pept        557988..559919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="ECs_0523"
FT                   /product="DNA polymerase III/DNA elongation factor III tau
FT                   and gamma subunits DnaX"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33946"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33946"
FT                   /db_xref="GOA:Q8XD46"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD46"
FT                   /protein_id="BAB33946.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEWEAL
FT                   LVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELP
FT                   YAPDRRMGVEMTLLRALAFHPRMPLPEPEVPRQSFAPVAPTAVMTPTQVPPQPQSAPQQ
FT                   APTVPLPETTSQVLAARQQLQRVQGATKAKKSEPAAATRARPVNNAALERLASVTDRVQ
FT                   ARPVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALKKALEHEKTPELAAKLAAEA
FT                   IERDAWAAQVSQLSLPKLVEQVALNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEAL
FT                   SMLKGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAEL
FT                   DEDSIRPI"
FT   CDS_pept        559972..560301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="ECs_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33947"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33947"
FT                   /db_xref="GOA:P0A8B7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8B7"
FT                   /protein_id="BAB33947.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
FT   CDS_pept        560301..560906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="ECs_0525"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33948"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33948"
FT                   /db_xref="GOA:P0A7H8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A7H8"
FT                   /protein_id="BAB33948.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
FT   CDS_pept        561016..562890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="ECs_0526"
FT                   /product="heat shock protein Hsp90"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33949"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33949"
FT                   /db_xref="GOA:P0A6Z5"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6Z5"
FT                   /protein_id="BAB33949.1"
FT                   /translation="MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADK
FT                   LRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKS
FT                   FLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYT
FT                   VADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVI
FT                   SWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIP
FT                   SQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQ
FT                   DSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKL
FT                   LRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVL
FT                   LLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADEVDESAKEAEKALTPFIDRVKA
FT                   LLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVL
FT                   VKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS"
FT   CDS_pept        563011..563715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="ECs_0527"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33950"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33950"
FT                   /db_xref="GOA:P69442"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69442"
FT                   /protein_id="BAB33950.2"
FT                   /translation="MVVSFIAFSKNSTHFKGIFAMRIILLGAPGAGKGTQAQFIMEKYG
FT                   IPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLD
FT                   GFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVE
FT                   GKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPV
FT                   AEVRADLEKILG"
FT   CDS_pept        563847..564809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="ECs_0528"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33951"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33951"
FT                   /db_xref="GOA:Q8XD39"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD39"
FT                   /protein_id="BAB33951.1"
FT                   /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTSRLLW
FT                   WPLLRGVILPLRSPRVAKLYASVWMEGGSPLMVYSRQQQQALAQRLPETPVALGMSYGS
FT                   PSLESAVDELLAEHVDHIVVLPLYPQFSCSTVGAVWDELARILARKRSIPGISFIRDYA
FT                   DNHDYINALANSVRASFAKHGEPDLLLLSYHGIPQRYADEGDDYPQRCRTTTRELASAL
FT                   GMAPEKVMMTFQSRFGREPWLMPYTDETLKMLGEKGVGHIQVMCPGFAADCLETLEEIA
FT                   EQNREVFLGAGGKKYEYIPALNATPEHIEMMANLVAAYR"
FT   CDS_pept        complement(564806..565765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="ECs_0529"
FT                   /product="acetyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33952"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33952"
FT                   /db_xref="GOA:Q8XD38"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR023508"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD38"
FT                   /protein_id="BAB33952.1"
FT                   /translation="MKPENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYT
FT                   LERRFWNAGAPEMATKAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHD
FT                   RIMRLLASYSQCTVIGIDYTLSPEARFPQVIEEIVAACCYFHQQAEDYQINMSRIGFAG
FT                   DSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQ
FT                   MYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQP
FT                   CEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL"
FT   CDS_pept        565917..567221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="ECs_0530"
FT                   /product="inosine/guanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33953"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33953"
FT                   /db_xref="GOA:P0AEW8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEW8"
FT                   /protein_id="BAB33953.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQFQPENETSAAWVVGIDQTLVD
FT                   IEAKVDDEFIERYGLSAGHSLVIEDDVAEALYQELKQKNLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQGVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEDVIAGASALVLTSYLVRCKPGEPMPEATMKAIEYAKKYNVP
FT                   VVLTLGTKFVIAENPQWWQQFLKDHVSILAMNEDEAEALTGESDPLLASDKALDWVDLV
FT                   LCTAGPIGLYMAGFTEDEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCQNPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
FT   CDS_pept        complement(567354..569030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="ECs_0531"
FT                   /product="inner membrane NAD(P)-binding transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33954"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33954"
FT                   /db_xref="GOA:Q8XD37"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD37"
FT                   /protein_id="BAB33954.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMLANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKAIAIPGAIAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMMEQGDVGFATLAVDMGITIGKVIAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLILIQQPLAVLATLAIILFGKSLAAFFLVRLFGHSQRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFALLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRE
FT                   RGVRAVLGNAANEEIMQLAHLECAKWLILTIPNGYEAGEIVASARAKNPDIEIIARAHY
FT                   DDEVAYITERGANQVVMGEREIARTMLELLETPPAGEVVTG"
FT   CDS_pept        complement(569267..570487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="ECs_0532"
FT                   /product="fosmidomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33955"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33955"
FT                   /db_xref="GOA:Q8XD36"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD36"
FT                   /protein_id="BAB33955.1"
FT                   /translation="MAMSEQTQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQSEFSLTFMQIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGL
FT                   VLLALAGSFGAVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPR
FT                   NKVVLAVSILLILIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLILPYASLHWTGVLTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFL
FT                   PDNRHKD"
FT   CDS_pept        570705..572357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="ECs_0533"
FT                   /product="UDP-sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33956"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33956"
FT                   /db_xref="GOA:Q8XD35"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD35"
FT                   /protein_id="BAB33956.1"
FT                   /translation="MKLLQRGVALALLTTFTLASEAALAYEQDKTYKITVLHTNDHHGH
FT                   FWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDL
FT                   KIAVIGLTTDDTAKLGNPENFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYD
FT                   NGDHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIA
FT                   ENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGA
FT                   DFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSG
FT                   AYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVN
FT                   TGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ"
FT   CDS_pept        complement(572394..572873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="ECs_0534"
FT                   /product="Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33957"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33957"
FT                   /db_xref="GOA:Q8XD27"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD27"
FT                   /protein_id="BAB33957.1"
FT                   /translation="MTPAVKSLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVY
FT                   KTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGIS
FT                   PLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD"
FT   CDS_pept        complement(573077..573871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="ECs_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33958"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33958"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD26"
FT                   /protein_id="BAB33958.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDISLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQKLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNEITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
FT   CDS_pept        573955..574350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaQ"
FT                   /locus_tag="ECs_0536"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33959"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33959"
FT                   /db_xref="GOA:Q8XD25"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD25"
FT                   /protein_id="BAB33959.1"
FT                   /translation="MIQYVLVSLFTGKQQLKTMKQATRKPTTPGDILLYEYLEPLDLKI
FT                   NELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLWEVENNM
FT                   RTQEELGRIETVAEYLARREERAKKVA"
FT   CDS_pept        complement(574565..577069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="ECs_0537"
FT                   /product="copper transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33960"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33960"
FT                   /db_xref="GOA:Q8XD24"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD24"
FT                   /protein_id="BAB33960.1"
FT                   /translation="MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTG
FT                   TASAEQLIETIKQAGYDASVSHPKAKPLAESSIPSEALTAVSEALPAATADDDDSQQLL
FT                   LSGMSCASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVEKAGYGAEA
FT                   IEDDAKRRERQQETAVATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTADNRSLWLVI
FT                   GLITLAVMVFAGGHFYRSAWKSLLNGAATMDTLVALGTGVAWLYSMSVNLWPQWFPMEA
FT                   RHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARLVTDEGEKSVPLAE
FT                   VQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSV
FT                   LFRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVVIALVSAAIWYFF
FT                   GPAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASTL
FT                   DTVVFDKTGTLTEGKPQVVAVKTFADFDEAQALRLAAALEQGSSHPLARAILDKASDMQ
FT                   LPQVNGFRTLRGLGVSGEAEGHALLLGNQALLNDQQVDTKAIEADISAQASQGATPVLL
FT                   AVDGKAVALLAVRDPLRSDSVAALQRLHKAGYRLVMLTGDNPTTANAIAKEAGIDEVIA
FT                   GVLPDGKAEAIKRLQSEGRQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLM
FT                   RHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTGTLLNPVVAGAA
FT                   MALSSITVVSNANRLLRFKPKE"
FT   CDS_pept        577331..578263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="ECs_0538"
FT                   /product="glutaminase 1"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33961"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33961"
FT                   /db_xref="GOA:Q8XD23"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD23"
FT                   /protein_id="BAB33961.1"
FT                   /translation="MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAI
FT                   VTSDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIAL
FT                   ELHGGKPLSPLVNAGAIATTSLINAENAEQRWQRILHIQQQLAGELVALSDEVNQSEQT
FT                   TNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLINTVELATLGATLAAGGVNPLTH
FT                   KRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSP
FT                   PLDEEGNSVRGQKMVASVAKQLGYNVFKG"
FT   CDS_pept        578266..579558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaT"
FT                   /locus_tag="ECs_0539"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33962"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33962"
FT                   /db_xref="GOA:Q8XD21"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD21"
FT                   /protein_id="BAB33962.1"
FT                   /translation="MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEAS
FT                   TWVAFAFGGIVAMFSGYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAV
FT                   SIAMVARAFGAYAVQFLHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGI
FT                   KMMILLLLIIAGVWSLQPAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDP
FT                   QVIMPRAFLVAIGVTTLLYISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIV
FT                   VIGALLATASAINANLFAVFNIMDNMGSERELPKRMNKSLWRQSTWGNIIVVVLIMLMT
FT                   AALNLGSLASVASATFLICYLAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSL
FT                   WSQGSRALIWIIGAILLSLIVAMVMKRNKTV"
FT   CDS_pept        579896..581251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0540"
FT                   /product="outer membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33963"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33963"
FT                   /db_xref="GOA:Q8XD20"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD20"
FT                   /protein_id="BAB33963.1"
FT                   /translation="MARFQFKNRKNNGLIFFISFMVMGEAAIAAPLPQWANAPAVTPVA
FT                   QLSLQESILRAFARNPGVTQQAAQIGIGEAQIDEAKSAWYPHVGLTGNAGPSRQTDSSG
FT                   RLDNNVSYGITLTQLVYDFGKTNNDINLQTAARDSYRFKLMATLTDVAEKTATAYMEVS
FT                   RYQALCDAAQRNIHSLENVYNMAALRANAGLNSSSDELQAQTRIAGMRSTLEQYQAQMA
FT                   SAKAQLAVLTGVQPEAIAAPPAELAEQPVSLKNIDYQSIPLVLAAENLRQSAQYGVEKT
FT                   KAQYWPTLSIQGGKTRYQTSDRSYWDDQLQLNVNAPLYQGGAVSAQVQQAEGQQKISAS
FT                   QVEQAKLDVLQRASVAYANWTGARGREEAGLAQSESAHKTRDVYQNEYKLGKRSLNDLL
FT                   TVEQDVFQAQSAEINANYDGWVAAVNYAAAVNNLIPLAGIKQGLYNDLPDLK"
FT   CDS_pept        581354..585739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33964"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCK7"
FT                   /protein_id="BAB33964.1"
FT                   /translation="MSLIIDVISRKTSVKQTLINPGDVTVVIYEPSVVQVHAQASAVAR
FT                   YVREGNDLLIYMQDGTVIRCNGYFLQAANTAEQSELVFADGQQLTHITFADTAAGGLAP
FT                   VELTAQTTAIESIAPFLDTVAQTSAFPWGWLAGAAVGGGALGALLASGGDGDSKTEVIN
FT                   NPTPPAEPGNATPSFLVTDNQGDQRGILATNDITDDTTPTFSGSGQAGATIQIKDSNGN
FT                   TIASTQVDNNGHWSVSLPTQSAGEHTWSVVQIVGSTITDAGSITLTIDNSQASVQVATT
FT                   AGDNIINASEQAAGFTLSGTSSHLAQGTELTVTLNGKTYTTSVGANGAWSVQVPTADAQ
FT                   ALGEGNQAVLVSGKDATGNTVTGAQLLTVDTQPPTLAINTIAQDNIISAAEHNVALVLS
FT                   GTSNAEAGQTVTLTVNGKSHTATVGSDGTWQVTLPATEVQALAEGNYAVNASVSDRAGN
FT                   TTSHSANFTVDTSAPVVSVNTVAGDDILNNAEQAVAQIISGQVSGASPGDTVTVKLGTH
FT                   VLTGIVLADGSWNVALDPAVTRTLDRGANTIFVTVTDAAGNTGAASRAITLVGVSPLIT
FT                   INTVSGDDIISGAEKGAPLTLTGSTQQAETGQTVTVTLAGQSFTTTVQADGSWSLTVPA
FT                   AAMGNLPDGAVAITASVTDLSGNTGNTSRTITVDSQAPALSIDPLTADNIINAAESGQD
FT                   LPITGTTDAQPGQTVTVTLNGQTYQGVVQPDGTWSVTVPAANVGALADGNATVTASVND
FT                   VAGNPSSVSRVALVDATPPVVTINPVATDNVINTPEHAQAQIISGTVTGAQAGDIVTVT
FT                   LNNVDYTTVVDGSGNWSLGVPASVVSGLADGSYPVSVSVTDKAGNTGSQSLTVTVNTAA
FT                   PLIGINSIAGDDVINASEKGADLQITGTSDQPVNTAITVTLNGQNYTTTTDASGNWSVT
FT                   VPASAVTALGQANYTVTAAVTSDIGNSATASHNVLVDSALPGVTINPVATDDIINAAEA
FT                   GVAQTISGQVTGAEDGDTVTITLGGNTYTATVGSNLTWSVDVPAADIQALGNGDLTVNA
FT                   SVTNQNGNTGSGTRDITIDANLPGLRVDTVAGDDVVNIIEHGQALVVTGSSSGLAESTP
FT                   LTVTINNVEYTTAVQADGSWSVGVTAAQVSAWPAGTVNIAVSGESSAGNSVSITHPVTV
FT                   DLTPAAITINTIATDDVINAAEKGADLTLSGTTTNVEPGQTVTVTFGGKNYTASVASDG
FT                   SWTATVPAADLASLPEGSASALASVSNINGNSASAVHNYSVDSSAPTIIINTVASDNIV
FT                   NASEADAGVTVSGSTTAEAGQIVTITLNSPTVQTYQATVQADGSWSINIPAADLEALTD
FT                   GSHTLTATVNDKAGNPASTTHNLAVDLTVPVLTINTIAGDDIINATEHGQALVISGSST
FT                   GGEAGDVVTVTLNSKTYTTTLDASGNWSVGVPAADVTALGSGPQTVTATVTDAAGNSDN
FT                   "
FT   CDS_pept        585947..601822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33965"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33965"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JG23"
FT                   /protein_id="BAB33965.1"
FT                   /translation="MPASAVGALGEASYTVTANVTDSAGNSNSASHNVQVNTALPGVTI
FT                   NPVATDDIINAAESGNAQTISGQVTGAAAGDTVTVTLGGKTYTATVQGNLSWSVDVPAA
FT                   DIQAIGNGNLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVVNSIEHAQAL
FT                   VITGSSSGLAAGAALTVVINTVTYAATVLADGTWSVGVPAADVSNWPAGTVNITVSGTN
FT                   TAGTTSTITHPVTVDLAAVAISINTVSGDDVINAAEKGADLTLSGSTSGVEVGQTVTVT
FT                   FGGKTYTATVAGDGSWTTTVPAADLSVLRDGDATVQASVSTINGNTASATHAYSVDATA
FT                   PTLAINTIATDDILNAAEAGNPLTISGSSTAEAGQTVTVTLNGVTYSGSVQADGSWSVS
FT                   LPTADLSNLTASQYTVSASVSDKAGNPASANHGLAVDLTVPVLTINTVSGDDIINAAEH
FT                   GQALVISGSSTGGEAGDVITVTLNSKTYTTMLDASGNWSVGVPAADVTALGSGPQTITA
FT                   AITDAAGNSDDASRTVTVNLAAPTIGINTIATDDVIKATEKGADLQITGTSNQPAGTTI
FT                   TVTLNGQNYTATTDSNGNWSATVPASAVSALGEANYTVTANVTDTAGNSNSASHNVLVN
FT                   SALPAVTINAVATDDIINAAESGNAQTISGQVTGAAQGDTVTVTLGGNTYTATVQSNLS
FT                   WSVDVPAADIQALGNGDLTVNASVTNGVGNTGSGSRDITIDANLPGLRVDTVAGDDVIN
FT                   SIEHNQALVITGSSSGLTAGTALTVEINNVTYGATVLADGTWSLGVPAVDVSNWPAGTV
FT                   NITVSGTNSAGTTSTITHPVTVDLAGVAITINTLSGDDVINAVEKGETLVVSGSTSGVE
FT                   AGQTVTVTFGGKNYTTTVEANGSWTVNVPPADLAALPDGAGNVQASVSNINGNSAQADR
FT                   AYSVDATAPLVTINTIASDDILNVSEAGAGITISGTTTAQAGQTLTVTLNNNTYQTTVL
FT                   ADGTWSVNVPAADLSGLTASSYTVTATVSDKAGNPASADHALVVDITAPDLTINTVAGD
FT                   DIINAIEHGQALVVSGTSTGAAAGDVVTVTLNGKNYTTTLDASGNWSVGIPAADVTALA
FT                   TGSQTITASLSDRAGNSDSTTHDVTVDLSGPTLTINTVSGDDIINAAEIVVAQTISGQV
FT                   TGTAVAGNTVIVTIGGNQYNATVQSDLSWSVSVPANVLQALGNGELTISASLTNSANNT
FT                   GTATHDIVIDANLPGLRVDTVAGDDVINSIEHTQALVITGSSSGLAAGAALTVVINSVT
FT                   YGATVLADGSWSVGVPVADVTNWPAGTVNIAVSGTNTAGTTTSISHPVTVDLAAVAITI
FT                   NTLSTDDVINAAEKGSDLQLSGTTSGVEAGQTITVIFGGKSYTTTVAADNTWGLTIPAV
FT                   DVATLPDGAANVQASVSNVAGNSTQATHAYSVDATAPSVTINTIATDDILNAAEAGSAL
FT                   TISGTSTAEAGQTVTVTLNGVNYSGNVQADGSWSVSVPTGDLASLTASSYTVNASVSDK
FT                   ARNSASATHNLTVDLAAPVVTINTVAGDDIINATEHGQAQIISGSATGATTGNTVSVTI
FT                   GTTTYTTVLDANGNWSIGVPASVISALAQGDVTITATVTDSAGNSGTASHTVTVALGAP
FT                   VLAINTIAVDDIINAAEKGADLAITGTSNQPAGTQITVTLNGQNYTTTADASGNWSVTV
FT                   PASRVSALGEATYTVTAAATDADGNSGSASHNVQVNTALPGVTINVVATDDIINAAEAG
FT                   VEQTISGQVTGAAAGDTVTVTLGGATYTATVQANLSWSVDVPASALQELGNGELTISAS
FT                   VTNSVGNTGNGTREITIDANLPGLRVDTVAGDDVVNIIEHGQALVITGSSSGLAAGSNV
FT                   TLTINGQTYVAAVLADGTWSVGVPAVDVSAWPAGSVTIAASGSTSAGNPVSVTHPVTVD
FT                   LSAVAVSINAITADDVINAAEKGAALTLSGSTSGVEAGQTVTVTFGGKTYSATVAANGS
FT                   WSTSVPAADMAALRDGDASAQASVSNVNGNSATTTHAYSVDASAPTVTINTIAGDDILN
FT                   AAEAGAALTITGSSTAEAGQTVTVTLNGTNYTGTVQTDGSWSVSVPSADLSTLTASNYT
FT                   VNAAVSDKAGNPASVNHNLTVDTSVPVVTINTVAGDDVINATEHAQAQIISGSATGAAT
FT                   GSTVTVTIGTNTFTTVLDASGNWSVGVPASVVSALANGTVTINASVTDAGGNSGSATHQ
FT                   VTVNTGLPTITFNAISGDNILNADEKGQPLTISGGSTGLATGAQVTVTLNGHNYSATTD
FT                   ASGNWTLTVPVSDLAALGQANYTVSASATSAAGNTASSQANLLVDSGLPDVTINTVAGD
FT                   DIINAAEAGADQTISGVVTRAAAGDTVTVTLGGNTYTATVQSNLSWSVSVPTADLQALG
FT                   NGDLTITASVTNANGNTGSGTRDITIDANLPGLRVDTVAGDDIVNSIEHGQALVITGGS
FT                   SGLNAGAVLTVTINSVAYSATVQADGSWSVGIPAANVSAWPAGPLTVEVDGQSSANNPV
FT                   SVSHPFTVDLTAVAISINTVASDDVINAAEKGTNLTLSGSTSGIESGQTVTVTFGGKTY
FT                   TASVAANGSWSVNVPAADLATLPEGAANVQASVSSASGNSASATHAYSVDASAPTLTIN
FT                   TIASDDILNAAEAGSPLTISGTSTAETGQTVTVTLNGATYTGTVQADGSWSVSVPTSAL
FT                   GALNASNYTVSATVNDKAGNPGSASHNLAVDTTAPVLTINTVAGDDIINDAEHAQALVI
FT                   SGTSSGGEAGDVVSVVLNGKTYTTTLDASGNWSVGVPAADVTALGSGAQTITASVSDRA
FT                   GNSDDASRTVTVSLSAPVISINTIAGDDVINATEKGSDLALSGTSDQPAGTAITVTLNG
FT                   QNYSATTDASGNWSVTVPASAVSALGEATYSVTASVTNAQGNSSTASHNVQVNTALPGI
FT                   TINPVATDDIINASEAGSAQTISGQVTGAAAGSTVTVELGGKTYTATVQADLSWNVSVP
FT                   AADWQALGNGELTVNASVTNAVGNTGSGTRDITIDASLPGLRVDTVAGDDVVNIIEHAQ
FT                   AQVITGSSSGFAAGTALTVVINNQTYAATVLANGSWSVGVPATDVSNWPAGTLNITVSG
FT                   ANSAGTQTSITHPLTVDLTAVAISMNSITSDDAINAAEKGAALTLSGSTSGVEAGQTVT
FT                   VTFGGKTYTTTVAANGSWSTTVPAADLAALRDGDASAQVRVTNVNGNSATATHEYSVDS
FT                   AAPTVTINTIASDNIINASEAAAGVTVSGTSTAQTGQTLTVTLNGTNYQTTVQTDGSWS
FT                   LTLPASDLTALANNGYTLTATVSDLAGNLGSASKGVTVDTTAPVISFNTVAGDDVINNV
FT                   EHIQAQIISGTATGAVAGDRLVVTIAGQQYVTSTDASGNWSVGVPASVISGLADGTVTI
FT                   SATITDSAGNSSTQTHNVQVNTAAVSLSVSTISGDNLINAAEAGSALTLSGTGTNFATG
FT                   TVVTVLLNGKGYSATIQSNGSWSVNVPAADVAALSDGTSYTVSASAQDSAGNGNSSTQT
FT                   HNVQVNTAAVSLSVSTISGDNLINAAEAGSALTLSGTGTNFATGTVVTVLLNGKGYSAT
FT                   IQSNGSWSVNVPAADVAALSDGTSYTVSASAQDSAGNSATASRSVAVDLTAPVISINTV
FT                   STDDRLNAAEQQQPLTLNGSTSAEVGQTVTVTFGGKTYTATVAANGTWALNVPAVDLAA
FT                   LGQGAQTITASVNDRAGNPGQATHALTVDTVAPTVTIATVAGDDIINNAEQLAGQTISG
FT                   TTTAEVGQTVTVTFNGQTWSATVGSGGSWSVFIPAQQFAGLSDGSYTISATVSDQAGNP
FT                   GSASRGVTLNGDVPTVTINTFAGDDVVNAAEHGSSLVISGTTTAPVGQTLTLTLNGKTY
FT                   TTTVQTGGSWSYTLGSADVTALADGNAYVINASVSNAIGNTGSSNHTITVDLSAPAMGI
FT                   NIDSLQADTGLSASDFITSVSPVVVNGSLTAALASNETAQISIDGGTTWTTLTVTGTTW
FT                   RYNDSRTLTDGNYLYQVRVIDAAGNVGATDSQNVVIDTTAPDPAVKTIAISAITTDMGL
FT                   ITNDFVTSDTTLAVSGTLGATLSAGEFAQISLDGGVTWTTLTVVGTSWSYADGHTLTDG
FT                   TWNYTVRVVDLAGNVGQTATQNVVVDTTSPEAAKSITITGISDDTGTSSSDFITSDTTL
FT                   TVRGVLGAALGANEFAQISTDNGATWVNVTVAADSLNWSYVDGRTLTNGTTTWQVRVVD
FT                   LAGNVGATSSQSALIDTVNPAQVLTIASISTDTGSSATDFITSDTMLTLTGSLGAGLAS
FT                   GEVAQISLDSGATWTTLTTNGTQWTYTDSRTLTDGSYVYQVRVLDLAGNTGPVVSKTVV
FT                   VDTINPTATPTIVSYTDDVGQRQGTLSSSQATDDTTPLLNGVLSAPLASGEVVYLYRNG
FT                   LLLGAVTMVGALNWTYSDSGLVSGAYTYSARVVDLAGNITSSSDFVLTVDTSIPTTLAQ
FT                   ITSQTTRDTTPIISGVITAALASGQYVEVVINGKTYTSEPGGAVVVDPAHNTWYVQLPD
FT                   TDALTVSATAYTVTAQVKSSAGNGNNANISNGTVTVNAAIDYTPTWTTASKTTAWGLTY
FT                   GLDSHGMWTVLANQQVMQSTDPLTWSKTALTLYQSGNNYATSSIADYDRNGTGDLFITR
FT                   DDYGTGYINGFTNNGDGTFSSAIQVTVGTLTWYGSIVAFDKEGDGYLDFWIGDAGGPDS
FT                   NTFLWNNAGTLVGNSTTSNSGGSATVGGAVTGYLSLNEGSGVDLNNDGRIDLVQHTYNL
FT                   NNYYTLSSLINQGNGTFVWGQNTTNTFLSGAGSGAMSSSVSMTWADFDGDGDMDLFLPA
FT                   SQGRANYGSLLFNTNGVLGCPVAVGATATTYASQFSLAVDWNHDGLMDIARIAQTGQSY
FT                   LYTNVSNASNWTQSALGGSQSGTTSGVAAMDYDWDGAVDVLVSKQSGSVFLSRNTNTVS
FT                   YGTSLHLRITDPNGINVYYGNTVKLYNSAGVLVATQIINPQSGMGVNDTSALVNFYGLN
FT                   AGETYNAVLIKSTGTTASNIDQTVNTSWGGLQATDATHAYDLSAEAGTASNNGKFVGTG
FT                   YNDTFFATAGTDTYDGSGGWVYSSGTGTWLANGGMDVVDFRLSTVGVTANLSSTAAQAT
FT                   GFNTSTFTNIEGISGSNFNDILTGSSGDNQLEGRGGNDTLNIGNGGHDTLLYKLLNASD
FT                   ATGGNGSDVVNGFTVGTWEGTADTDRIDIRELLQGSGYTGNGKASYVNGVATLDAQAGN
FT                   IGDFVKVTQSGSDTIVQIDRDGTGGTFATTNVVTLTGVHTDLATLLANHQLMVV"
FT   CDS_pept        601826..603988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapB"
FT                   /locus_tag="ECs_0543"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33966"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33966"
FT                   /db_xref="GOA:Q8XD16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD16"
FT                   /protein_id="BAB33966.2"
FT                   /translation="MKKNAQSVEAWLEAMIAVARYYRLDFSQENVRATVNWERDSKREE
FT                   LLTDMARQLGMGLRLVEFSADSLNPWRLPLIAVFDNQQIGVITRRDNHDNISVQFSGDE
FT                   GLETTLNVADIEDKIVELALLRPLSAIPDARVDDYIRPYQANWFWSLSLKDWRRYGDIM
FT                   LASLVANVLALAAMIFSMQVYDRVVPAQSYPTLWVLFAGVMMAILFEFCMRMVRTHLSD
FT                   VIGKRADLRISDRVFGHALRLKNNVRSKSTGSFISQIRELESVRELITSTTIGAVADLP
FT                   FFLLFVFILWMIGGWLVLVVLLALPLLVIPGLLVQRPLARLANEGMRESAVRNATLVEA
FT                   VQSIEDIKLLRAEQRFQNQWNHTNDVASSISMKQRFLTGLLLTWTQEVQSIVYVVVLLV
FT                   GCFMVMNGDMTTGALVGTTILASRTIAPLSQISGVLSRWQQAKVARNGLDELMKRPVDQ
FT                   PEHGKLVHKAVLHGNYQFSNAVFYYDEEEKIADVAIGKLNIQAGEKIAILGRNGAGKST
FT                   LLQMLAGMRIAQQGQVLLDNISIGQLDPADLRRDMGLLSQTGRLFFGSLRENLTMGMPE
FT                   ASDEDIERALTLSGALPFVQKQKNGLNYMIQEGGFGLSGGQRQTLLLARLLISQPNIVL
FT                   LDEPSASLDEMAEAYLIEQLKQWIGHRTLIIATHRTAMLQLVDRIIVMDQGRIVMDGAK
FT                   EAILREQGEPTARRVVLQEKNKGSAA"
FT   CDS_pept        603985..605160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0544"
FT                   /product="membrane fusion protein of a transport system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33967"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33967"
FT                   /db_xref="GOA:Q8XD11"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD11"
FT                   /protein_id="BAB33967.1"
FT                   /translation="MNGQLQYNRGLTEPRLPRSALAVRVTAVMLLCFLGWAWYFQLDEV
FT                   TTGSGTVEPSGREQVVQSLEGGILYHLDVKVGDIVEQGQPLAQLNRTKTESDVQEAMSR
FT                   LYAALATSARLRAEVSNKPLVFPDELNKFPELIESETALYNTRRDGLNKATTGLTQGIS
FT                   LVNRELAMTQPLVKQGAASSVEVLRLQRQANELENKLSDVRTQYYVQAREELAKANAEV
FT                   ETQRSVIRGREDSLTRLNFTAPVRGIVQDIDVTTVGGVIAPGGKLMTIVPLDEQLLIEA
FT                   KISPRDVAFIHPGQKSLVKITAYDYSIYGGLPGEVAVISPDTVQDEVRRDVYYYRVYIR
FT                   TFSNHLENKSKQQFPIFPGMVATVDIRTGKKSVLDYLLKPFNKAQEALRER"
FT   CDS_pept        605157..605564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="ECs_0545"
FT                   /product="copper-responsive regulon transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33968"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33968"
FT                   /db_xref="GOA:Q8XD09"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XD09"
FT                   /protein_id="BAB33968.1"
FT                   /translation="MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLN
FT                   ELTLLRQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRNQ
FT                   LLALANACPGDDSADCPIIENLSGCCHHRAG"
FT   CDS_pept        complement(605768..606190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0546"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33969"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33969"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC31"
FT                   /protein_id="BAB33969.1"
FT                   /translation="MMNSSIKSFSLLAVILLAGCSSPTSRIADCQAQGVSHDTCYLAEQ
FT                   QRQAAILSASEAQAFKNAEAAQHAQAAKKAIYKGFGMTFRMSSKNFAYLNDSLCAIDED
FT                   NKDATVYQSGLYNVIVYHHTGKVALMKEGQFVGYLK"
FT   CDS_pept        complement(606275..607291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0548"
FT                   /product="adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33971"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33971"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC30"
FT                   /protein_id="BAB33971.1"
FT                   /translation="MKTVNVALLALIISATSSPVVLAGDTIEAAATELSAINSGMSQSE
FT                   IEQKITRFLERTDNSPAAYTYLTEHHYIPSETPDTTQTPTVQTDPDAGQKTVAATGDVQ
FT                   TTARYQSMINARQSAVTDAQQTQITEQQAQIVATQKTLAATGDTQNTAHYQEMINARLA
FT                   AQNEANQRTATEQGQKMNALTTDVAVQQQNERTQYDKQMQSLAQESAQAHEQIDSLSQD
FT                   VTQTHQQLTNTQKRVADNSQQINTLNNHFSSLKNEVDDNRKEANAGTASAIAIASQPQV
FT                   KTGDVMMVSAGAGTFNGESAVSVGTSFNAGTHTVLKAGISADTQSDFGAGVGVGYSF"
FT   CDS_pept        607658..608020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33972"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33972"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC29"
FT                   /protein_id="BAB33972.1"
FT                   /translation="MNEFEKIFNEMNLDRALLPILFRSNRSTVWKYLSGDSTAPASAMS
FT                   LIMLLQLIQKRNPDLLAEWLTLSDFTIPPEVYLDQPDYWKGWVYTQHKVNKNVLEYLKK
FT                   HYPDEDQKSMSKGREE"
FT   CDS_pept        complement(608199..608657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECs_0551"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33974"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33974"
FT                   /db_xref="GOA:Q8XD05"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD05"
FT                   /protein_id="BAB33974.2"
FT                   /translation="MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLV
FT                   VWLVPLGWEWQGVMFAVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLE
FT                   SPLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLIIRAVIA"
FT   CDS_pept        complement(608654..609571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qmcA"
FT                   /locus_tag="ECs_0552"
FT                   /product="protease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33975"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33975"
FT                   /db_xref="GOA:P0AA55"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AA55"
FT                   /protein_id="BAB33975.1"
FT                   /translation="MLIFIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINSRLLRIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGIRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATKMVSEAIASGDIQAVNYFVAQKYTEALQQIGSSSNSKVVMMPLEA
FT                   SSLMGSIAGIAELVKDSANKRTQP"
FT   CDS_pept        609717..610394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fetA"
FT                   /locus_tag="ECs_0553"
FT                   /product="iron export ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33976"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33976"
FT                   /db_xref="GOA:Q7DC28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC28"
FT                   /protein_id="BAB33976.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
FT   CDS_pept        610381..611160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fetB"
FT                   /locus_tag="ECs_0554"
FT                   /product="iron export ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33977"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33977"
FT                   /db_xref="GOA:Q8XD04"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD04"
FT                   /protein_id="BAB33977.2"
FT                   /translation="MNSHNITNESLALALMLVVVAILISHKEKLALEKDILWSVGRAII
FT                   QLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAG
FT                   ITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLG
FT                   ATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
FT   CDS_pept        complement(611223..612077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="ECs_0555"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33978"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33978"
FT                   /db_xref="GOA:Q8X570"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X570"
FT                   /protein_id="BAB33978.2"
FT                   /translation="MSVENIVNINESNLQQVLEQSMTTPVLFYFWSERSQHCLQLTPIL
FT                   ESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRA
FT                   LLDKVLPREEELKAQQAMQLMQEGNYTDALPLLKDAWQLSNQNGEIGLLLAETLIALNR
FT                   SEDAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPEDAALATQL
FT                   ALQLHQVGRNEEALELLFGHLRKDLTAADGQTRKTFQEILAALGTGDALASKYRRQLYA
FT                   LLY"
FT   CDS_pept        complement(612138..612947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="ECs_0556"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33979"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33979"
FT                   /db_xref="GOA:Q8XCZ8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCZ8"
FT                   /protein_id="BAB33979.1"
FT                   /translation="MTHKATEILTGKVMQKSVLITGCSSGIGLESALELKRQGFHVLAG
FT                   CRKPDDVERMNSMGFTGVLIDLDSPESVDRAADEVIALTDNCLYGIFNNAGFGMYGPLS
FT                   TISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASK
FT                   YALEAWSDALRMELRRSGIKVSLIEPGPIRTRFTDNVNQTQSDKPVENPGIAARFTLGP
FT                   EAVVDKVRHAFISEKPKMRYPVTLVTWAVMVLKRLLPGRVMDKILQG"
FT   CDS_pept        complement(612937..613530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="ECs_0557"
FT                   /product="acyl-CoA thioesterase I"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33981"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33981"
FT                   /db_xref="GOA:P0A9T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9T9"
FT                   /protein_id="BAB33981.2"
FT                   /translation="MPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDK
FT                   WQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLR
FT                   QILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFLMEEVYLKP
FT                   QWMQDDGIHPNRDAQPFIADWMAKQLQPLVNHDS"
FT   CDS_pept        613531..614217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="ECs_0558"
FT                   /product="ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33980"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33980"
FT                   /db_xref="GOA:Q8XCZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCZ6"
FT                   /protein_id="BAB33980.2"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGESSAESRNGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLIMVTHDLQLAARCDRCLRLVNG
FT                   QLQEEA"
FT   CDS_pept        614214..616628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="ECs_0559"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33982"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33982"
FT                   /db_xref="GOA:Q8XCZ5"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCZ5"
FT                   /protein_id="BAB33982.1"
FT                   /translation="MIARWFWREWRSPSLLIVWLALSLAVACVLALGNISDRMEKGLSQ
FT                   QSREFMAGDRALRSSREVPQAWLEEAQKRGLKVGKQLTFATMTFAGDTPQLANVKAVDD
FT                   IYPMYGDLQTNPPGLKPQAGSVLLAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDS
FT                   GFNPFQMAPRLMMNLADVDKTGAVQPGSRVTWRYKFGGSENQLDSYEKWLLPQLKPEQR
FT                   WYGLEQDEGALGRSMERSQQFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIVGQWLMVLTLSAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWPWLWA
FT                   LGTMTVISLLVGLRPYRLLLATQPLRVLRNYVVANVWPLKFYLPIVSVVVVLLLAGLMG
FT                   GSMLLWAVLAGAVVLALLCGVLGWMLLNVLRRMTLKSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIATEQVTPLKAFLAEHQIVPE
FT                   SFYPVVRARLTAINGKPTEGNEDEALNRELNLTWQNTRPDHNPIVAGNWPPKADEVSME
FT                   EGLAKRLNVTLGDTVTFMGDTQEFRAKVTSLRKVDWESLRPNFYFIFPEGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNRQFPTISLLDIGAILKQVGQVLEQVSRALEVMVVLVTACGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGFVSGLVAAIGAETALAV
FT                   LQAKVFDFPWEPDWRLWIVLPCSGALLLSLFGGWLGARLVKGKALFRQFAG"
FT   CDS_pept        617058..621254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsD"
FT                   /locus_tag="ECs_0560"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33983"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33983"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEI5"
FT                   /protein_id="BAB33983.2"
FT                   /translation="MSGKPAARQGDMTQYGGPIVQGSAGVRIGAPTGVACSVCPGGMTS
FT                   GNPVNPLLGAKVLPGETDLALPGPLPFILSRTYSSYRTRTPAPVGIFGPGWKAPSDIRL
FT                   QLRDDALVLNDNGGRSIHFEPLLPGEAVYSRSESMWLVRGGKAAQPDGHTLARLWGALP
FT                   PDIRLSPHLYLATNSAQGPWWILGWSERVPGAEDVLPAPLPPYRVLTGMADRFGRTLTY
FT                   RREAAGDLAGEITGVTDGAGREFRLVLTTQAQRAEEARKQHTASLSSPDTPRPLSDSAF
FT                   PDTLPGTEYGPDRGIRLSAVWLTHDPAYPESLPAAPLVRYTYTEAGELLAVYDRSNTQV
FT                   RAFTYDAQHPGRMVGHRYAGRPEMRYRYDDAGRVVEQLNPAGLSYHYQYEQDRITVTDS
FT                   LNRREVLHTEGGAGLKRVVKKELADGSVTHSGYDAAGRLTAQTDAAGRRTEYGLNVVSG
FT                   DITDITTPDGRETKFYYNDGNQLTAVVSPDGLESRRAYDEPGRLVSETSRSGETVRYRY
FT                   DDAYSELPATTTDATGSTRQMTWSRYGQLLAFTDCSGYQTRYEYDRFGQMTAVHREEGI
FT                   SLYRRYDNRGRLISVKDAQGHETRYEYNAAGDLTAVITPDGNRSETQYDAWGKAVSTTQ
FT                   GGLTRSMEYDLAGRITTLTNENGSRSEFTYDALDRLVQQRGFDGRTQRYHYDLTGKLTQ
FT                   SEDEGLVTLWHYDESDRLTHRTVNGEPAEQWQYDEHGWLTEISHLSEGHQVAVHYGYDD
FT                   KGRLAGERQTVHNPETGELLWQHETEHAYNEQGLANRVTPDSLPRVEWLTYGSGYLAGM
FT                   KLGGTPLVEFTRDRLHRETVRSFGNNAYELTSTYTPAGHLQSQRLNSQVYDRDYDWNDN
FT                   GDLVRISGPRQTREYGYSATGRLESVRTLASDLDIRIPYATDPAGNRLPDPELHPDSTL
FT                   TAWPDNRIAEDAHYVYRHDEYGRLTEKTDRIPAGVIRTDDERTHHYHYDSQHRLVFYTR
FT                   IQHGEPLVESRYLYDPLGRRTGKRVWRRGRDLTGWMSLSRKPEVTWYGWDGDRLTTVQT
FT                   DTTRIQTVYEPGSFAPLIRIETDNGEREKAQRRSLAEKLQQEGSEDGHGVVFPAELVRL
FT                   LDRLEEEIRADRVSSESRAWLAQCGLTVEQLARQVEPEYTPARKVHLYHCDHRGLPLAL
FT                   ISEDGNTAWSGEYDEWGNQLNEENPHHLHQPYRLPGQQYDKESGLYYNRNRYYDPLQGR
FT                   YITQDPIGLEGGWSLYAYPLNPVNGIDPLGLSPADVALIRRKDQLNHQRAWDILSDTYE
FT                   DMKRLNLGGTDQFFHCMAFCRVSKLNDAGVSRSAKGLGYEKEIRDYGLNLFGMYGRKVK
FT                   LSHSEMIEDNKKDLAVNDHGLTCPSTTDCSDRCSDYINPEHKETIKALQDAGYLK"
FT   CDS_pept        621235..621495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbD"
FT                   /locus_tag="ECs_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33984"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33984"
FT                   /db_xref="GOA:Q8XCZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCZ4"
FT                   /protein_id="BAB33984.1"
FT                   /translation="MLAISSNLSKMIIFIIAIIIIVVLCVITYLYLYKDESLVSKHYIN
FT                   YMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDYFFLIFP"
FT   CDS_pept        complement(622239..622610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbG"
FT                   /locus_tag="ECs_0563"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33986"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33986"
FT                   /db_xref="GOA:Q7DC27"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7DC27"
FT                   /protein_id="BAB33986.2"
FT                   /translation="MLHTANPVIKHKAGLLNLAEELSNVSKACKIMGVSRDTFYRYREL
FT                   VAEGGVDAQINRSRRAPNLKNRTDEATEQAVVDYAVAFPTHGQHRASNELRKQGVFISD
FT                   SGVRSVWLLHNLENLKRRY"
FT   CDS_pept        complement(622726..623820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnmH"
FT                   /locus_tag="ECs_0564"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33987"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33987"
FT                   /db_xref="GOA:Q8XCZ2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XCZ2"
FT                   /protein_id="BAB33987.1"
FT                   /translation="MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNN
FT                   DERAAVGTCYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRS
FT                   HIVQSWLHAAGIDYPLVEGGYKALRQTAIQATIELAQKPIVLIGGCTGSGKTLLVQQQP
FT                   NGVDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDARQNLRLWVLEDESRMIG
FT                   SNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYGDEQGWQEYCEY
FT                   LHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLAWLVPLLEEYYDPMYRYQ
FT                   LEKKAEKVVFRGEWAEVAEWVKAQ"
FT   CDS_pept        complement(623889..624815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allS"
FT                   /locus_tag="ECs_0565"
FT                   /product="allD operon transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33988"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33988"
FT                   /db_xref="GOA:P0ACR1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACR1"
FT                   /protein_id="BAB33988.1"
FT                   /translation="MFDPETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTG
FT                   VALFFRTTRSVTLTAAGEHLLSQARDWLSWLESMPSELQQVNDGVERQVNIVINNLLYN
FT                   PQAVAQLLAWLNERYPFTQFHISRQIYMGVWDSLLYEGFSLAIGVTGTEALANTFSLDP
FT                   LGSVQWRFVMAADHPLANVEEPLTEAQLRRFPAVNIEDSARTLTKRVAWRLPGQKEIIV
FT                   PDMETKIAAHLAGVGIGFLPKSLCQSMIDNQQLVSRVIPTMRPPSPLSLAWRKFGSGKA
FT                   VEDIVTLFTQRRPEISGFLEIFGNPRS"
FT   CDS_pept        625045..625527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="ECs_0566"
FT                   /product="ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33989"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33989"
FT                   /db_xref="GOA:P63486"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="PDB:1YQC"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63486"
FT                   /protein_id="BAB33989.1"
FT                   /translation="MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVE
FT                   ILEQDRTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLST
FT                   LRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA"
FT   CDS_pept        625605..626420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allR"
FT                   /locus_tag="ECs_0567"
FT                   /product="glyoxylate-inducible transcriptional repressor of
FT                   all and gcl operons"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33990"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33990"
FT                   /db_xref="GOA:P0ACN6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ACN6"
FT                   /protein_id="BAB33990.1"
FT                   /translation="MTEVRRRGRPGQAEPVAQKGAQALERGIAILQYLEKSGGSSSVSD
FT                   ISLNLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGLGVFNVGAAYIHNRDVLSVAGP
FT                   FMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHASGAGKALLYP
FT                   LAEEELMSIILQTGLQQFTPTTLVDMPTLLKDLEQARELGYTVDKEEHVVGLNCIASAI
FT                   YDDVGSVVAAISISGPSSRLTEDRFVSQGELVRDTARDISTALGLKAHP"
FT   CDS_pept        626510..628291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="ECs_0568"
FT                   /product="glyoxylate carboligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33991"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33991"
FT                   /db_xref="GOA:P0AEP8"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEP8"
FT                   /protein_id="BAB33991.1"
FT                   /translation="MAKMRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKHGGIRH
FT                   ILARHVEGASHMAEGYTRATAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQA
FT                   PRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLVDLP
FT                   FDVQVAEIEFDPDMYEPLPVYKPAASRMQIEKAVEMLIQAERPVIVAGGGVINADAAAL
FT                   LQQFAELTSVPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMVFGIGNRF
FT                   ANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAG
FT                   RLPCRKEWVADCQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFGRDVCYVTTIGLSQIA
FT                   AAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPKRNVVAISGDFDFQFLIEELAV
FT                   GAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSSEVNGYGVDHVKVAEG
FT                   LGCKAIRVFKPEDIAPAFEQAKALMAQYRVPVVVEVILERVTNISMGSELDNVMEFEDI
FT                   ADNAADAPTETCFMHYE"
FT   CDS_pept        628304..629080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="ECs_0569"
FT                   /product="hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33992"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33992"
FT                   /db_xref="GOA:Q8XCX7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCX7"
FT                   /protein_id="BAB33992.1"
FT                   /translation="MLRFSANLSMLFGEYDFLARFEKAAQCGFRGVEFMFPYDYDIEEL
FT                   KQVLASNKLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKNINC
FT                   LVGKTPAGFSSEQIHATLVENLRYAANMLMKEDILLLIEPINHFDIPGFHLTGTRQALK
FT                   LIDDVGCCNLKIQYDIYHMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEINYD
FT                   YLFKVIENSDYNGWVGCEYKPQTTTEAGLRWMDPYR"
FT   CDS_pept        629181..630059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxR"
FT                   /locus_tag="ECs_0570"
FT                   /product="tartronate semialdehyde reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33993"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33993"
FT                   /db_xref="GOA:Q8XCX6"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCX6"
FT                   /protein_id="BAB33993.1"
FT                   /translation="MKLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVN
FT                   VDTARQVTEAADIIFIMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFA
FT                   RQVNELGGDYLDAPVSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNG
FT                   DGQTCKVANQIIVALNIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMI
FT                   KRTFNPGFKIALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQ
FT                   ALELMANHKLA"
FT   CDS_pept        630228..631619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbW"
FT                   /locus_tag="ECs_0572"
FT                   /product="allantoin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33995"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33995"
FT                   /db_xref="GOA:Q8XCX4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCX4"
FT                   /protein_id="BAB33995.1"
FT                   /translation="MEHQRKLFQQRGYSEDLLPKTQSQRTWKTFNYFTLWMGSVHNVPN
FT                   YVMVGGFFILGLSTFSIMLAIILSAFFIAAVMVLNGAAGSKYGVPFAMILRASYGVRGA
FT                   LFPGLLRGGIAAIMWFGLQCYAGSLACLILIGKIWPGFLTLGGDFTLLGLSLPGLITFL
FT                   LFWLVNVGIGFGGGKVLNKFTAILNPCIYIVFGGMAIWAISLVGLGPIFDYIPSGIQKA
FT                   ENSGFLFLVVINAVVAVWAAPAVSASDFTQNAHSFREQALGQTLGLVVAYILFAVAGVC
FT                   IIAGASIHYGADTWNVLDIVQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAI
FT                   APTKLTYKNGVLIASIISLLICPWKLMENQDSIYLFLDIIGGMLGPVIGVMMAHYFVVM
FT                   RGQINLDELYTAPGDYKYYDNGFNLTAFSVTLVAVILSLGGKFIPLMEPLSRVSWFVGV
FT                   IVAFA"
FT   CDS_pept        631656..633017
FT                   /transl_table=11
FT                   /gene="allB_1"
FT                   /locus_tag="ECs_0573"
FT                   /note="allantoinase"
FT                   /pseudogene="unknown"
FT   CDS_pept        633074..634375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbY"
FT                   /locus_tag="ECs_0575"
FT                   /product="uracil/xanthine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33998"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33998"
FT                   /db_xref="GOA:Q8XCW2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCW2"
FT                   /protein_id="BAB33998.2"
FT                   /translation="MFNFAVSRESLLSGFQWFFFIFCNTVVVPPTLLSAFQLPQSSLLT
FT                   LTQYAFLATALACFAQAFCGHRRAIMEGPGGLWWGTILTITLGEASRGTPINDIATSLA
FT                   VGIALSGVLTMLIGFSGLGHRLARLFTPSVMVLFMLMLGAQLTTIFFKGMLGLPFGIAD
FT                   PNFKIQLPPFALSVAVMCLVLAMIIFLPQRFARYGLLVGTITGWLLWYFCFPSSHSLSG
FT                   ELHWQWFPLGSGGALSPGIILTAVITGLVNISNTYGAIRGTDVFYPQQGAGNTRYRRSF
FT                   VATGFMTLITVPLAVIPFSPFVSSIGLLTQTGDYTRRSFIYGSVICLLVALVPALTRLF
FT                   CSIPLPVSSAVMLVSYLPLLFSALVFSQQITFTARNIYRLALPLFVGIFLMALPPVYLQ
FT                   DLPLTLRPLLSNGLLVGILLAVLMDNLIPWERIE"
FT   CDS_pept        634397..635542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="ECs_0576"
FT                   /product="glycerate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33999"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33999"
FT                   /db_xref="GOA:Q8XCW0"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCW0"
FT                   /protein_id="BAB33999.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGITGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLVA
FT                   NGGNLARVASIEMEECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLRAVNLEQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
FT   CDS_pept        complement(635770..636555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="ECs_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34000"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34000"
FT                   /db_xref="GOA:Q8XCV9"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCV9"
FT                   /protein_id="BAB34000.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNFALLTPDGLVKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFSLS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYVPVEGYAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI"
FT   CDS_pept        complement(636566..637801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allC"
FT                   /locus_tag="ECs_0578"
FT                   /product="allantoate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34001"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34001"
FT                   /db_xref="GOA:Q8XCV8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017591"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCV8"
FT                   /protein_id="BAB34001.1"
FT                   /translation="MITHFRQTIEEALPWLSSFGADPAGGMTRLLYSPEWLETQQQLKK
FT                   RMAASGLETRFDEVGNLYGRLSGTEYPQEVILSGSHIDTVVNGGNLDGQFGALAARLAI
FT                   DWLKTQYGAPLRTVEVVAMAEEEGSRFPYVFWGSKNIFGLANPDDVRNICDAKGNSFVD
FT                   AMKACGFTLPDAPLTPRQDIKAFVELHIEQGCVLESNGQSIGVVNAIVGQRRYTVTLNG
FT                   ESNHAGTTPMGYRRDTVYAFSRICHQSIEKAKKMGDPLVLTFGKVEPRPNTVNVVPGKT
FT                   TFTIDCRHTDAAVLRDFTQQLENDMRAICDEMDIRIDIDLWMDEEPVPMNKDLVATLTE
FT                   LCESEKLNYRVMHSGAGHDAQIFAPRVPTCMIFIPSINGISHNPAERTNITDLAEGVKT
FT                   LALMLYQLAWQK"
FT   CDS_pept        complement(637823..638872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allD"
FT                   /locus_tag="ECs_0579"
FT                   /product="ureidoglycolate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34002"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34002"
FT                   /db_xref="GOA:P58408"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR017590"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58408"
FT                   /protein_id="BAB34002.1"
FT                   /translation="MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHG
FT                   AVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQN
FT                   GVAVVGISRMGHSGAISYFVQQAARAGLIGISMCQSDPMVVPFGGAEIYYGTNPLAFAA
FT                   PGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGAPTTDPFAVHALLPAAG
FT                   PKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHVVINPNFFSSSELFRQ
FT                   HLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRQAAVEGIEIVDDIYQYLISDALYNTS
FT                   YETKNPFAQ"
FT   CDS_pept        639189..640856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdrA"
FT                   /locus_tag="ECs_0580"
FT                   /product="NAD(P)-binding acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34003"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34003"
FT                   /db_xref="GOA:Q8XCV7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCV7"
FT                   /protein_id="BAB34003.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKAL
FT                   LDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAIMQQLEEALKQLAQGSGSSQALTQ
FT                   VRRWDSACQKLPDANLALISVAGEYAAELANQALDRNLNVMMFSDNVTLEDEIQLKTRA
FT                   REKGLLVMGPDCGTSMIAGTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSREVGGISALTALEMLSADEKSEVLAFVSKPPAEAVRLKIVNAMKATGKP
FT                   TVALFLGYTPAVARDENVWFASSLDEAARLACLLSRVTARRNAIMPASSGFICGLYTGG
FT                   TLAAEAAGLLAGHLGVEADDAHHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPTLRNQ
FT                   LITDLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARSDNQPLYAIATVTGTE
FT                   RDPQCRSQQIATLEDAGIAVVSSLPEATLLAAALIHPLSPAAQQHTPSLLENVAVINIG
FT                   LRSFALELQSASKPVVHYQWSPVAGGNKKLARLLERLQ"
FT   CDS_pept        640866..642125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbE"
FT                   /locus_tag="ECs_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34004"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34004"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCV6"
FT                   /protein_id="BAB34004.2"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHA
FT                   GPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAILEQGEVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAAL
FT                   GRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNT
FT                   PQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGASGMEAARAVSEEM
FT                   AEIYLERNMQLQIPSWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGIG"
FT   CDS_pept        642136..642951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="ECs_0582"
FT                   /product="anaerobic allantoin catabolic oxamate
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34005"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34005"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAS6"
FT                   /protein_id="BAB34005.1"
FT                   /translation="MTIIHPLLASSSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAH
FT                   PQPLAAAWMQRAEETGLFGPLALAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
FT   CDS_pept        642948..643841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECs_0583"
FT                   /product="carbonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34006"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34006"
FT                   /db_xref="GOA:Q8XCV5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XCV5"
FT                   /protein_id="BAB34006.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   RTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTDDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGMPQQRAIRHATPDELAPFAKADGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
FT   CDS_pept        complement(643980..645047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="ECs_0584"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34007"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34007"
FT                   /db_xref="GOA:Q8XCV4"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCV4"
FT                   /protein_id="BAB34007.1"
FT                   /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSV
FT                   ITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERS
FT                   EWPAVFERLGELAIVKRRTGGYDGRGQWRLRADETEQLPAECYGECIVEQGINFSGEVS
FT                   LVGARCFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQAQAEEMLSAIMQELGYVGV
FT                   MAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSV
FT                   MINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLSATLEALIPLLP
FT                   PEYASGVMWAQSKFC"
FT   CDS_pept        complement(645044..645553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="ECs_0585"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34008"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34008"
FT                   /db_xref="GOA:P0AG19"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AG19"
FT                   /protein_id="BAB34008.1"
FT                   /translation="MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAH
FT                   RTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSL
FT                   YSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENP
FT                   DPRGAA"
FT   CDS_pept        complement(645671..646393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="ECs_0586"
FT                   /product="UDP-2,3-diacylglucosamine pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34009"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34009"
FT                   /db_xref="GOA:Q8XCU1"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XCU1"
FT                   /protein_id="BAB34009.1"
FT                   /translation="MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEA
FT                   WIGDDDPNPLHRQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLE
FT                   LYGRRVLIMHGDTLCTDDAGYQAFRTKVHKPWLQTLFLALPLFVRKRIAVRMRANSKEA
FT                   NSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTE
FT                   GSMVKVTADDVELIHFPF"
FT   CDS_pept        complement(646396..646890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="ECs_0587"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34010"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34010"
FT                   /db_xref="GOA:Q8XCU0"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCU0"
FT                   /protein_id="BAB34010.1"
FT                   /translation="MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVI
FT                   NGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVD
FT                   NDFLNFSGESLQGWGYCVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVS
FT                   E"
FT   CDS_pept        647064..648449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="ECs_0588"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34011"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34011"
FT                   /db_xref="GOA:Q8XCT9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XCT9"
FT                   /protein_id="BAB34011.1"
FT                   /translation="MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFV
FT                   AFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHKDFDALN
FT                   ILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQL
FT                   QAGARVDVVDDKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFD
FT                   IHGGGSDLMFPHHENEIAQSTCAHDGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVL
FT                   KYYDAETVRYFLMSGHYRSQLNYSEENLKQARAALERLYTALRGTDKTVAPAGGEAFEA
FT                   RFIEAMDDDFNTPEAYSVLFDMAREVNRLKVEDMAAANAMASHLRKLSAVLGLLEQEPE
FT                   AFLQSGAQADDSEVAEIEALIQQRLDARKAKDWAAADAARDRLNEMGIVLEDGPQGTTW
FT                   RRK"
FT   CDS_pept        complement(648485..649006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="ECs_0589"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34012"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34012"
FT                   /db_xref="GOA:Q8XCT8"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCT8"
FT                   /protein_id="BAB34012.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   NFGVAYGNVFGHRGFTHSLVFAFVVPLLCVLIGRRWFRAGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTAYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
FT   CDS_pept        complement(649114..649326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="ECs_0590"
FT                   /product="ribosome-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34013"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34013"
FT                   /db_xref="GOA:Q8XCT7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCT7"
FT                   /protein_id="BAB34013.2"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAV
FT                   ETRKRCKIVAGQTVSFAGHSVQVVA"
FT   CDS_pept        complement(649328..650194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="ECs_0591"
FT                   /product="5,10-methylene-tetrahydrofolate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34014"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34014"
FT                   /db_xref="GOA:Q8XCT6"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XCT6"
FT                   /protein_id="BAB34014.1"
FT                   /translation="MAAKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNP
FT                   ASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDALNADNTIDGILVQLPLPAG
FT                   IDNVKVLERIHPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAV
FT                   VIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIK
FT                   EGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVE
FT                   YHDPQGE"
FT   CDS_pept        650665..651207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmA"
FT                   /locus_tag="ECs_0592"
FT                   /product="type-1 fimbrial protein subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34015"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34015"
FT                   /db_xref="GOA:P0ABW6"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABW6"
FT                   /protein_id="BAB34015.2"
FT                   /translation="MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNT
FT                   DSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNL
FT                   LAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTS
FT                   ASAGQANADATFIMRYE"
FT   CDS_pept        651427..652119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmC"
FT                   /locus_tag="ECs_0593"
FT                   /product="periplasmic pilus chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34016"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34016"
FT                   /db_xref="GOA:Q8XCT5"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCT5"
FT                   /protein_id="BAB34016.1"
FT                   /translation="MMTKIKLLMLIIFYLIISASVHAAGGIALGATRIIYPADAKQTAV
FT                   WIRNSHTNERFLVNSWIENSSGVKEKSFIITPPLFVSEPKSENTLRIIYTGPPLAADRE
FT                   SLFWMNVKTIPSVDKNALNGRNVLQLAILSRMKLFLRPIQLQELPAEAPDTLKFSRSGN
FT                   YINVHNPSPFYVTLVNLQVGSQKLGNAMAAPRVNSQIPLPSGVQGKLKFQTVNDYGSVT
FT                   PVREVNLN"
FT   CDS_pept        652150..654759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimD"
FT                   /locus_tag="ECs_0594"
FT                   /product="outer membrane usher protein FimD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34017"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34017"
FT                   /db_xref="GOA:A0A0H3JG58"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JG58"
FT                   /protein_id="BAB34017.1"
FT                   /translation="MKIPTTTDIPQRYTWCLAGICYSSLAILPSFLSYAESYFNPAFLL
FT                   ENGTFVADLSRFERGNHQPAGVYRVDLWRNDEFIGSQDIVFESTTENTGDKSGGLMPCF
FT                   NQVLLERIGLNSSAFPELAQQQNNKCINLLKAVPDATINFDFAAMRLNITIPQIALLSS
FT                   AHGYIPPEEWDEGIPALLLNYNFTGNRGNGNDSYFFSELSGINIGPWRLRNNGSWNYFR
FT                   GNGYHSEQWNNIGTWVQRAIIPLKSELVMGDGNTGSDIFDGVGFRGVRLYSSDNMYPDS
FT                   QQGFAPTVRGIARTAAQLTIRQNGFIIYQSYVSPGAFEITDLHPTSSNGDLDVTIDERD
FT                   GNQQNYTIPYSTVPILQREGRFKFDLTAGDFRSGNSQQSSPFFFQGTALGGLPQEFTAY
FT                   GGTQLSANYTAFLLGLGRNLGNWGAVSLDVTHARSQLADDSRHEGDSIRFLYAKSMNTF
FT                   GTNFQLMGYRYSTQGFYTLDDVAYRRMEGYEYDYDYDGEHRDEPIIVNYHNLRFSRKDR
FT                   LQLNISQSLNDFGSLYISGTHQKYWNTSDSDTWYQVGYTSSWVGISYSLSFSWNESVGI
FT                   PDNERIVGLNVSVPFNVLTKRRYTRENALDRAYASFNANRNSNGQNSWLAGVGGTLLEG
FT                   HNLSYHVSQGDTSNNGYTGSATANWQAAYGTLGVGYNYDRDQHDVNWQLSGGVVGHENG
FT                   ITLSQPLGDTNVLIKAPGAGGVRIENQTGILTDWRGYAVMPYATVYRYNRIALDTNTMG
FT                   NSIDVEKNISSVVPTQGALVRANFDTRIGVRALITVTQGGKPVPFGSLVRENSTGITSM
FT                   VGDDGQVYLSGAPLSGELLVQWGDGANSRCIAHYVLPKQSLQQAVTVISAVCTHPGS"
FT   CDS_pept        654772..655779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmH"
FT                   /locus_tag="ECs_0595"
FT                   /product="fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34018"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34018"
FT                   /db_xref="GOA:Q8XCS0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCS0"
FT                   /protein_id="BAB34018.2"
FT                   /translation="MKIICRLLLAMACLCLANISWATVCANSTGVAEDEHYDLSNVFNS
FT                   TNNQPGQIVVLPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLNDYL
FT                   LGAMSLVDSVMDIQFPPQNYIRMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIP
FT                   RQVMFTVYVTSTPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAA
FT                   GPGNRPAGVMPQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQND
FT                   TPITPNDLNSVIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ"
FT   CDS_pept        655790..656305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECs_0596"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34019"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34019"
FT                   /db_xref="GOA:Q8XCR9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCR9"
FT                   /protein_id="BAB34019.1"
FT                   /translation="MRRVFFSCFCGLLWSSSGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALLPFSLRLEGCPPGSVAILFTGTPASDANLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
FT   CDS_pept        complement(656308..656940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmZ"
FT                   /locus_tag="ECs_0597"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34020"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34020"
FT                   /db_xref="GOA:P0AEL9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEL9"
FT                   /protein_id="BAB34020.1"
FT                   /translation="MKPTSVIIMDTHPIIRMSIEVLLQKNSELQIVLKTDDYRITIDYL
FT                   RTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFV
FT                   SKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSNKCSTNSSTVTVLSNREVTILRYLVS
FT                   GLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVELIDYAKLYELI"
FT   tRNA            657183..657259
FT                   /gene="argU"
FT                   /locus_tag="ECs_R0030"
FT                   /product="tRNA-Arg"
FT                   /note="anticodon: tct"
FT   CDS_pept        complement(657305..658066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envY"
FT                   /locus_tag="ECs_0598"
FT                   /product="porin thermoregulatory transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34021"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34021"
FT                   /db_xref="GOA:Q8X567"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X567"
FT                   /protein_id="BAB34021.1"
FT                   /translation="MQLSSSEPCVVILTEKEVEVSVNNHATFTLPKNYLAAFACNNNVI
FT                   ELSTLNHVLITHINRNIINDYLLFLNKNLTCVKPWSRLATPVIACHSRTPEVFRLAANH
FT                   SKQQPSKPCEAELTRALLFTVLSNFLEQSRFIALLMYILRSSVRDSVCRIIQSDIQHYW
FT                   NLRIVASSLCLSPSLLKKKLKNENTSYSQIVTECRMRYAVQMLLMDNKNITQVAQLCGY
FT                   SSTSYFISVFKAFYGLTPLNYLAKQRQKVMW"
FT   CDS_pept        complement(658249..659139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="ECs_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34022"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34022"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X566"
FT                   /protein_id="BAB34022.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDTLVLQWTRYGDAFTQPEQRALLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAVPGVTPDGWYFSAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEHVKATGVNVWVQDGSGVDKLTAEQ
FT                   RERYLQASADCQSSAPASGIVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPVAHGILEY"
FT   CDS_pept        complement(659140..662112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0600"
FT                   /product="bacteriophage N4 receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34023"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34023"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025137"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCR8"
FT                   /protein_id="BAB34023.1"
FT                   /translation="MKENNLNRVIGWSGLLLTSLLSTSALADNIGTSAEELGLSDYRHF
FT                   VIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEAYRHFGHDDRARLLL
FT                   EDQLKRHPGDARLERSLAAIPVEVKSITTVEELLAQQKACDAAPTLRCRSEVGQNALRL
FT                   AQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNEARQQNTLSAAER
FT                   RQWFDVLLAGQLDDRILALQSQGIFTDPQSYITYATALAYRGEKARLQHYLIENKPLFT
FT                   TDAQEKSWLYLLSKYSANPVQALANYTVQFADNRQYVVGATLPVLLKEGQYDAAQKLLA
FT                   TLPANEMLEERYAVSVATRNKAEALRLARLLYQQESANLTRLDQLTWQLMQNEQSREAA
FT                   DLLLQRYPFQGDARISQTLMARLASLLESHPYLATPAKVAILSKPLPLAEQRQWQSQLP
FT                   GIADNCPAIVRLLGDMSPSYDAAAWNRLAKCYRDTLPGVALYAWLQAEQRQPNAWQHRA
FT                   VAYQAYQVEDYATALAARQKISLHDMSNEDLLAAANTAQAAGNGAARDRWLQQAEQRGL
FT                   GSNALYWWLHAQRYIPGQPELALNDLTRSINIAPSANAYVARATIYRQRHNVPAAVSDL
FT                   RAALELEPNNSNTQAALGYALWDSGDIAQSREMLEQAHKGLPDDPALIRQLAYVNQRLD
FT                   DMPATQHYARLVIDDIDNQALITPLTPEQNQQRFNFRRLHEEVGRRWTFSFDSSIGLRS
FT                   GAMSTANNNVGGAAPGKSYRSYGQLEAEYRIGRNMLLEGDLLSVYSRFFADTGENGVMM
FT                   PVKNPMSGTGLRWKPLRDQIFFLAVEQQLPLNGQNGASDTMLRASASFFNGGKYSDEWH
FT                   PNGSGWFAQNLYLDAAQYIRQDIQAWTADYRVSWHQKVANGQTIEPYAHVQDNGYRDKG
FT                   TQGAQLGGVGVRWNIWTGETHYDAWPHKVSLGVEYQHTFKAINQRNGERNNAFLTIGVH
FT                   W"
FT   CDS_pept        complement(662099..664336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrB"
FT                   /locus_tag="ECs_0601"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34024"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34024"
FT                   /db_xref="GOA:P0AFA6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFA6"
FT                   /protein_id="BAB34024.1"
FT                   /translation="MDWLLDVFATWLYGLKVIAITLAVIMFISGLDDFFIDVVYWVRRI
FT                   KRKLSVYRRYPRMSYRELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFV
FT                   GTYPNDPDTQRDVDEVCARFPNVHKVVCARPGPTSKADCLNNVLDAITQFERSANFAFA
FT                   GFILHDAEDVISPMELRLFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKD
FT                   VPVREALAGQVPSAGVGTCFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTE
FT                   IFVRFPVVDEAKEREQRKFLQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFK
FT                   THKWTSSLTLNYFLWRDRKGAISNFVSFLAMLVMIQLLLLLAYESLWPDAWHFLSIFSG
FT                   SAWLMTLLWLNFGLMVNRIVQRVIFVTGYYGLTQGLLSVLRLFWGNLINFMANWRALKQ
FT                   VLQHGDPRRVAWDKTTHDFPSVTGDTRSLRPLGQILLENQVITEEQLDTALRNRVEGLR
FT                   LGGSMLMQGLISAEQLAQALAEQNGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRL
FT                   ENDELIVGSEDGIDPVSLAALTRKVGRKVRYVIVLRGQIVTGLRHWYARRRGHDPRAML
FT                   YNAVQHQWLTEQQAGEIWRQYVPHQFLFAEILTTLGHINRSAINVLLLRHERSSLPLGK
FT                   FLVTEGVISQETLDRVLTIQRELQVSMQSLLLKAGLNTEQVAQLESENEGE"
FT   repeat_region   complement(664592..665857)
FT                   /note="ISEc1 Family: ISAs1 partial"
FT   CDS_pept        complement(664602..665738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="ECs_0602"
FT                   /product="H repeat-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34025"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34025"
FT                   /db_xref="GOA:Q8X565"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X565"
FT                   /protein_id="BAB34025.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDLGETHLNFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRRRAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAMSEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKESEMTV
FT                   RYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVVNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVFAGSGLS"
FT   CDS_pept        complement(666201..667535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0603"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34026"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34026"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR028912"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCR7"
FT                   /protein_id="BAB34026.1"
FT                   /translation="MTASGTGLGYGEGDESYGYDSCGYLKAQSAGGHRISEETDQYAGG
FT                   HRLKQAGNTQYDYDAAGRMVSRTRHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRH
FT                   DASGRRTEKRCDRKKIRFTYLWDGDSIAEIREYRDDELYSVRHLVFNGFELISQQCSRV
FT                   RQPHPSVAPQWVTRTNHAVNDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTDYP
FT                   DPRGERDAEADPGLLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRY
FT                   VPNPCGWVDPLGLAASSKISSLMDYIGDGRRVSGHTGFLDGVRLSRSQINNIAKEMEKL
FT                   GIKVIRKADKYLPPNARAAFDYGLRNIYLRKNATLYEVYHEVIHAKQFAKIGREAYEAL
FT                   GRLSREEHVLNEILKSKNLFNEAEIAHAIKYVEGLREKFMMGLIN"
FT   CDS_pept        complement(667704..668111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34027"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDX7"
FT                   /protein_id="BAB34027.1"
FT                   /translation="MKEIDLLYENIYQLLIKPYLLDLSSQSGKKIELNYTCKIKDAADE
FT                   IKGSMIFNDVDGKQKATCTIRVLILKTFHDGRYRFVIESVIYDLINNYSGFILTGRLFW
FT                   QGEGFGHELFPVTNKYNAWRWKNKKIIDISW"
FT   CDS_pept        complement(668129..672979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0605"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34028"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34028"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCN2"
FT                   /protein_id="BAB34028.1"
FT                   /translation="MSEGPGGPQGATAGGTLAMRMLSQRAMAASQMKRAANDKAIAQML
FT                   ASKKSGPPAARLGDEIQHKSFLGALAGAVLGAIVTIAEGCLIMAACATGPYALVLVPAL
FT                   MYASYKASDYVEEKQNQLESWINSFCDTDGAINTGSKNVKINGKPAARAAVTLPPPPPP
FT                   GAIPEVPQGEPSWGDIATDLLESAAEKAVPLAKAWGNAVITLTDSNAGFMDRVSAGASL
FT                   LFPAGPVLMEFATMVGGRGEIKKDVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQP
FT                   AARKGDKLECSAAIVEGSPDVFIGGEQVTYLDIQPEFPPWQRMILGGITIASYLLPPAG
FT                   LLGKLGNLAKLGKLGNLLGKSGKLLGAKLGALLGKTGNSLKSIANKVIRWVTDPVDPVT
FT                   GAYCDERTDFTLGQTLPLSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDVIS
FT                   LGATLNFAFDGESDTAVNPYHAQYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPV
FT                   TDDTSDDRLAHSPADRMYMLGGMSDTASNRITFERDTQYRITGVSHTDGIRLKLTYHAS
FT                   GYLKAIHRTDNGIQTLATYEQDARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYDAQGR
FT                   CVTVTGAEGYYNATLDYGDGCTTVTDGKGIHRYYYDPDGNILREEAPDGSTTTYEWDEF
FT                   HHLLARHSPAGRVEKFEYNAAHGQLSRYTAADGADWQYCYDERGLLSNITAPAGQTWTQ
FT                   QCDERGLPVSLVSPQGEETRLAYTPQGLLSGIFRQDERRLGIEYDHHNWPETLTDVMGR
FT                   EHHTEYSGHDLPVKMRGPGGQSVRLQWQQHHKLSGLERAGTGAEGFRYDRHGNLLAYTD
FT                   GNGVVWTMEYGPFDLPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYLYILDNCGRV
FT                   TEERDWGGVVCRYRYDADGLCTARVNGLEETILYSRDAAGRLAEVITPEGKTQYAYDKS
FT                   GRLTGIFSPDGTSQRTGYDERGRVNVTTQGRRAIEYHYPDEHTVIRCILPPEDERDRHP
FT                   DGSLLKTTYRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQP
FT                   VSQRAGLFPAEATWGGLLPSLLREYRYDSAGNVSGVTSREDYGRETHREYRLDRNGQVT
FT                   AVTASGTGLGYGEGDETYGYDSCGYLKAQSAGRHRISGETDQYAAGHRLKQAGNTQYDY
FT                   DAAGRMVSRTKHRDGYRPETERFRWDSRDQLTGYRSAQGEQWEYRHDASGRRTEKRCDR
FT                   KKIRFTYLWDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQPHPSVAPQWVT
FT                   RTNHAVSDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTDYPDPRGERDPEADPG
FT                   LLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRYVPNPCGYIDPLGL
FT                   AICQLARWTKWGSEQSNISDVLNSLGNRALKYANGDWIKSEAAFNKYINMINKRLELTG
FT                   SKFRVEIQPAIKNGERVPATTNGPFKVNGKWTSGTHYTGGSKRLDAGIIDITSPTNQYG
FT                   LHPVIEGFDITLNKTKPSAVDIYSDVFGGIDINDFRL"
FT   CDS_pept        complement(672999..673460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34029"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34029"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JG68"
FT                   /protein_id="BAB34029.1"
FT                   /translation="MQFTFNEGHIQLPSQWQDQSMQVLVSTDNSGINLVITREPVSQGT
FT                   LTPELYQETLALYQGKLDGYTEHACREITLAEAPAWLLDYSWNGPEDEGNQGRISQIAV
FT                   FQRRGDTLLTFTFSTSLSLKNSQKTMLLEVIKSFTPLPPENDIQKDQPR"
FT   CDS_pept        complement(673488..675389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0607"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34030"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34030"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="PDB:3WIT"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBY5"
FT                   /protein_id="BAB34030.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLTQSLSSLFSLDLSLVSQQF
FT                   LSLEFAQVLDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQMLYSMKVHPPLWRAGL
FT                   RQNFRIFQNEDIKSILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAYKSTDQSLVLCDTVRHLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMEGWR
FT                   NNAETARGMSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGAGTA
FT                   LENHFAVIPADRTWRPQPRLKPLVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNP
FT                   ADQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYMGSGFNELKFDDATGREQVYIHAQKNMDTEVLNDRTTTVKHDH
FT                   RETVKNDQTVTIQEGNRLLTVEKGHKITGVLKGSLSEDVFQDRGTIAGSVHVDAVNNGG
FT                   EGNGIQAYTAIKEIMLAVEESKIALTPDGIQLQVGESTVIRLSKDGITIVGGSVFIN"
FT   CDS_pept        complement(675983..677431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="ECs_0608"
FT                   /product="copper-sensing histidine kinase in two-component
FT                   regulatory system with CusR"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34031"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34031"
FT                   /db_xref="GOA:Q8XBY4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBY4"
FT                   /protein_id="BAB34031.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGA
FT                   PDIREFARDAIPDKDARGGEVFLLSGPTMMMPGHGHGHMEHSNWRMISLPVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   EVGKVFDFFEALAEDRGVELQFVGDECQVAGDPLMLRRALSNLLSNALRYTPPGEAIVV
FT                   RCQTVDHLVQVIVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSNARGTRFVIVLPERG"
FT   CDS_pept        complement(677421..678104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusR"
FT                   /locus_tag="ECs_0609"
FT                   /product="two-component regulatory system response
FT                   regulator CusR"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34032"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34032"
FT                   /db_xref="GOA:P0AD00"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AD00"
FT                   /protein_id="BAB34032.1"
FT                   /translation="MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDY
FT                   DLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFA
FT                   FAELLARVRTLLRRGAAVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLEFFL
FT                   RHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLE
FT                   VPDGQ"
FT   CDS_pept        678261..679643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusC"
FT                   /locus_tag="ECs_0610"
FT                   /product="outer membrane component of copper/silver efflux
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34033"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34033"
FT                   /db_xref="GOA:Q8XBY3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBY3"
FT                   /protein_id="BAB34033.1"
FT                   /translation="MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLSQNGLVNA
FT                   ADNYQNAGWRTFFVDNQVKTLISEALENNRDLRMATLKVQEARAQYRLTDADRYPQLNG
FT                   EGSGSWSGNLKGDSATTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHI
FT                   LLVSNVAQSYFNQQLAYAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIE
FT                   STRSDIAKRQGELAQANNALQLLLGSYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRP
FT                   DIMEAEHALMAANANIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEI
FT                   PIFNAGRNQANLDIAEIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLA
FT                   SLQITLQRARALYQHGAVSYLEVLDAERSLFATRQTVLDLNYARQVNEISLYTALGGGW
FT                   QQ"
FT   CDS_pept        679667..679999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="ECs_0611"
FT                   /product="Cu(I)/Ag(I) efflux system periplasmic protein
FT                   CusF"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34034"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34034"
FT                   /db_xref="GOA:Q8XBY2"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBY2"
FT                   /protein_id="BAB34034.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVK
FT                   GFDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSGIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
FT   CDS_pept        680015..681238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="ECs_0612"
FT                   /product="membrane fusion protein of copper/silver efflux
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34035"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34035"
FT                   /db_xref="GOA:Q8XEH9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEH9"
FT                   /protein_id="BAB34035.1"
FT                   /translation="MKKIALIIGSMIAGGIISAAGFTWFAKAEPPAEKTSTAERKILFW
FT                   YDPMYPNTRFDKPGKSPFMDMDLVPKYADEESSASGVRIDPTQTQNLGVKTATVTRGPL
FT                   TFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGAPLLDLTIPDWVEAQS
FT                   EYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFD
FT                   LRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKW
FT                   TLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQR
FT                   VITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMR
FT                   SESATHAH"
FT   CDS_pept        681250..684387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="ECs_0613"
FT                   /product="copper/silver efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34036"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34036"
FT                   /db_xref="GOA:Q8XBY1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBY1"
FT                   /protein_id="BAB34036.1"
FT                   /translation="MIEWIIRRSVANRFLVLMGALFLSIWGTWTIINTPVDALPDLSDV
FT                   QVIIKTSYPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDPY
FT                   WARSRVLEYLNQVQGKLPAGVSAELGPDATGVGWIYEYALVDRSGKHDLADLRSLQDWF
FT                   LKYELKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISLAEVKSALDASNQEAGGSSI
FT                   ELAEAEYMVRASGYLQTLDDFNHIVLKASENGVPVYLRDVAKIQVGPEMRRGIAELNGE
FT                   VVGGVVILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSGKL
FT                   LEEFIVVAVVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGGIAIAVG
FT                   AMVDAAIVMIENAHKRLEEWQHQHPDATLDNKTRWQVITNASVEVGPALFISLLIITLS
FT                   FIPIFTLEGQEGRLFGPLAFTKTYAMAGAALLAIVVIPILMGYWIRGKIPPESSNPLNR
FT                   FLIRVYHPLLLKVLHWPKTTLLVAALSVLTVLWPLNKVGGEFLPQINEGDLLYMPSTLP
FT                   GISAAEAASMLQKTDKLIMSVPEVARVFGKTGKAETATDSAPLEMVETTIQLKPQEQWR
FT                   PGMTMDKIIEELDNTVRLPGLANLWVPPIRNRIDMLSTGIKSPIGIKVSGTVLADIDAM
FT                   AEQIEEVARTVPGVASALAERLEGGRYINVEINREKAARYGMTVADVQLFVTSAVGGAM
FT                   VGETVEGIARYPINLRYPQSWRDSPQALRQLPILTPMKQQITLADVADVKVSTGPSMLK
FT                   TENARPTSWIYIDARDRDMVSVVHDLQKAIAEKVQLKPGTSVAFSGQFELLERANHKLK
FT                   LMVPMTLMIIFVLLYLAFRRVGEALLIISSVPFALVGGIWLLWWMGFHLSVATGTGFIA
FT                   LAGVAAEFGVVMLMYLRHAIEAEPSLNNPQTFSEQKLDEALHHGAVLRVRPKAMTVAVI
FT                   IAGLLPILWGTGAGSEVMSRIAAPMIGGMITAPLLSLFIIPAAYKLMWLHRHRVRK"
FT   CDS_pept        684489..685865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheP"
FT                   /locus_tag="ECs_0614"
FT                   /product="phenylalanine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34037"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34037"
FT                   /db_xref="GOA:Q8XBY0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBY0"
FT                   /protein_id="BAB34037.1"
FT                   /translation="MKNASNVSEDTASNQEPTLHRGLHNRHIQLIALGGAIGTGLFLGI
FT                   GPAIQMAGPAVLLGYGVAGIIAFLIMRQLGEMVVEEPVSGSFAHFAYKYWGPFAGFLSG
FT                   WNYWVMFVLVGMAELTAAGIYMQYWFPDVPTWIWAAAFFIIINAVNLVNVRLYGETEFW
FT                   FALIKVLAIIGMIGFGLWLLFSGHGGEKASIDNLWRYGGFFATGWNGLILSLAVIMFSF
FT                   GGLELIGITAAEARDPEKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVEVKSNSSPFV
FT                   MIFHNLDSNVVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRVSRRGV
FT                   PINSLMLSGAITSLVVLINYLLPQKAFGLLMALVVATLLLNWIMICLAHLRFRAAMRRQ
FT                   GRETQFKALLYPFGNYLCIAFLAMILLLMCTMDDMRLSAILLPVWIVFLFVAFKTLRRK
FT                   "
FT   CDS_pept        complement(685933..687180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="ECs_0615"
FT                   /product="mechanosensitive channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34038"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34038"
FT                   /db_xref="GOA:Q8XBX4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBX4"
FT                   /protein_id="BAB34038.1"
FT                   /translation="MQDLISHVEDLAGIEIDHTTSMVMIFGIIFLTAVVVHIILHWVVL
FT                   RTFEKRAIASSRLWLQIITQNKLFHRLAFTLQGIIVNIQAVFWLQKGTEAADILTTCAQ
FT                   LWIMMYALLSVFSLLDVILNLAQKFPAASQLPLKGIFQGIKLIGAILVGILMISLLIGQ
FT                   SPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDI
FT                   GLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSISIDVTSIRFLDEDE
FT                   MQRLNKAHLLKPYLTSRHQEINEWNRQQGSTESVLNLRRMTNIGTFRAYLNEYLRNHPR
FT                   IRKDMTLMVRQLAPGDNGLPLEIYAFTNTVVWLEYESIQADIFDHIFAIVEEFGLRLHQ
FT                   SPTGNDIRSLAGAFKQ"
FT   CDS_pept        complement(687288..687941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfsB"
FT                   /locus_tag="ECs_0616"
FT                   /product="dihydropteridine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34039"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34039"
FT                   /db_xref="GOA:Q8XBX3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBX3"
FT                   /protein_id="BAB34039.1"
FT                   /translation="MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQP
FT                   WHFIVASTEEGKARVAKSAAGNYVFNERKILDASHVVVFCAKTAMDDAWLKLVVDQEDA
FT                   DGRFATPEAKAANDKGRKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVP
FT                   IEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV"
FT   CDS_pept        complement(688035..688403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="ECs_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34040"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34040"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAT3"
FT                   /protein_id="BAB34040.1"
FT                   /translation="MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSE
FT                   LRGVPFINLKSDPQKSLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSW
FT                   NLVVDGLAKRDQKRVRPG"
FT   CDS_pept        complement(688468..688716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="ECs_0618"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34041"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34041"
FT                   /db_xref="GOA:Q8XBX2"
FT                   /db_xref="InterPro:IPR010590"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBX2"
FT                   /protein_id="BAB34041.1"
FT                   /translation="MKHPLETLTTAAGILLMAFLSCLLLPAPALGLTLAQKLVTTFHLM
FT                   DLSQLYTLLFCLWFLVLGAIEYFVLRFIWRRWFSLAD"
FT   CDS_pept        complement(688782..689900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="ECs_0619"
FT                   /product="gamma-glutamyl:cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34042"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34042"
FT                   /db_xref="GOA:Q8XBX1"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBX1"
FT                   /protein_id="BAB34042.1"
FT                   /translation="MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLIDAVKNKI
FT                   TAGEVKHDITESMLELATDVCRDINQAAGQFSAMQKVVLQAAADHHLEICGGGTHPFQK
FT                   WQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIA
FT                   LSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPWVSNWQQFEALFRCLSYTTMIDSIKD
FT                   LHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLIQATAHWLLTERPFKHKEKDYLLYK
FT                   FNRFQACRYGLEGVITDPYTGDRRPLTEDTLRLLEKIAPSAHKIGASSAIEALHRQVVS
FT                   GLNEAQLMRDFVADGGSLIGLVKKHCEIWAGD"
FT   CDS_pept        690339..690491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokE"
FT                   /locus_tag="ECs_0620"
FT                   /product="small toxic membrane polypeptide HokE"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34043"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34043"
FT                   /db_xref="GOA:Q8XBX0"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBX0"
FT                   /protein_id="BAB34043.1"
FT                   /translation="MLTKYALVAVIVLCLTVPGFTLLVGDSLCEFTVKERNIEFRAVLA
FT                   YEPKK"
FT   CDS_pept        690842..690994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="ECs_0621"
FT                   /product="regulatory peptide MokC whose translation enables
FT                   hok (gef) expression"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34044"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34044"
FT                   /db_xref="GOA:Q8XBW9"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBW9"
FT                   /protein_id="BAB34044.2"
FT                   /translation="MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA
FT                   YEPKK"
FT   CDS_pept        complement(691116..691859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entD"
FT                   /locus_tag="ECs_0622"
FT                   /product="4'-phosphopantetheinyl transferase entD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34045"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34045"
FT                   /db_xref="GOA:P0A3B9"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3B9"
FT                   /protein_id="BAB34045.2"
FT                   /translation="MNALSGLQKSCQFNILQDHVGLISVAHQAVLRLSSVSNMVDMKTT
FT                   HTSLPFAGHTLHFVEFDPANFCEQDLLWLPHYAQLQHAGRKRKTEHLAGRIAAVYALRE
FT                   YGYKCVPAIGELRQPVWPAEVYGSISHCGATALAVVSRQPIGVDIEEIFSAQTATELTD
FT                   NIITPAEHERLADCGLAFSLALTLAFSAKESAFKASEIQTDAGFLDYQIISWNKQQVII
FT                   HRENEMFAVHWQIKEKIVITLCQHD"
FT   CDS_pept        complement(691911..694151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepA"
FT                   /locus_tag="ECs_0623"
FT                   /product="ferrienterobactin outer membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34046"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34046"
FT                   /db_xref="GOA:Q8XBW7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBW7"
FT                   /protein_id="BAB34046.1"
FT                   /translation="MNKKIHSLALLVNLGIYGVAQAQEPTDTPVSHDDTIVVTAAEQNL
FT                   QAPGVSTITADEIRKNPVARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMGPENT
FT                   LILIDGKPVSSRNSVRQGWRGERDTRGDTSWVPPEMIERIEVLRGPAAARYGNGAAGGV
FT                   VNIITKKGSGEWHGSWDAYFNAPEHKEEGATKRTNFSLTGPLGDEFSFRLYGNLDKTQA
FT                   DAWDINQGHQSARAGTYATTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSRQGNL
FT                   YAGDTQNTNSDAYTRSKYGDETNRLYRQNYSLTWNGGWDNGVTTSNWVQYEHTRNSRIP
FT                   EGLAGGTEGKFNEKATQDFVDNDLDDVMLHSEVNLPIDFLVNQTLTLGTEWNQQRMKDL
FT                   SSNTQALTGTNTGGAIDGVSATDRSPYSKAEIFSLFAENNMELTDSTIVTPGLRFDHHS
FT                   IVGNNWSPALNISQGLGDDFTLKMGIARAYKAPSLYQTNPNYILYSKGQGCYASAGGCY
FT                   LQGNDDLKAETSINKEIGLEFKRDGWLAGITWFRNDYRNKIEAGYVAVGQNAVGTDLYQ
FT                   WDNVPKAVVEGLEGSLNVPVSETVMWTNNITYMLKSENKTTGDRLSIIPEYTLNSTLSW
FT                   QAREDLSMQTTFTWYGKQQPKKYNYKGQPAVGPETKEISPYSIVGLSATWDVTKNVSLT
FT                   GGVDNLFDKRLWRAGNAQTTGDLAGANYIAGAGAYTYNEPGRTWYMSVNTHF"
FT   CDS_pept        694394..695596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fes"
FT                   /locus_tag="ECs_0624"
FT                   /product="enterobactin/ferrienterobactin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34047"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34047"
FT                   /db_xref="GOA:Q8XBW6"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR021764"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBW6"
FT                   /protein_id="BAB34047.2"
FT                   /translation="MTALKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYST
FT                   IKRVWIYITGVTDHHQNSQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSA
FT                   PSPDRLELREGWRKLLPQAIADPLNPQSWKGGRGHAVSALEMPQAPLQPGWDCPQAPEI
FT                   PAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSMPVWPVLISLTHRQ
FT                   QLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKAIAPFSDRADRTVVAGQS
FT                   FGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLE
FT                   AGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFHDR
FT                   S"
FT   CDS_pept        695599..695817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="ECs_5381"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X498"
FT                   /protein_id="BBE29397.1"
FT                   /translation="MAFSNPFDDPQGVFYILRNAQGQFSLWPQQCALPAGWDIVCQPQS
FT                   QESCQQWLEVHWRTLTPANFTQLQEAQ"
FT   CDS_pept        695814..699695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entF"
FT                   /locus_tag="ECs_0625"
FT                   /product="enterobactin synthase multienzyme complex
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34048"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34048"
FT                   /db_xref="GOA:Q8XBV9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBV9"
FT                   /protein_id="BAB34048.1"
FT                   /translation="MSQHLPLVAAQPGIWMAEKLSELPSAWSVAHYVELTGEVDAPLLA
FT                   RAVVAGLAQADTLRMRFTEDNGEVWQWVDDALIFELPEIIDLRTNIDPHGTAQALMQAD
FT                   LQQDLRVDSGKPLVFHQLIQVADNRWYWYQRYHHLLVDGFSFPAITRQIANIYCALLRG
FT                   EQTPASPFTPFADVVEEYQQYRESEAWQRDAAFWAEQRRQLPPPASLSPAPLAGRSASA
FT                   DILRLKLEFTDGEFRQLATQLSGVQRTDLALALAAFWLGRLCNRMDYAAGFIFMRRLGS
FT                   AALTATGPVLNVLPLGIHIAAQETLPELATRLAAQLKKMRRHQRYDAEQIVRDSGRAAG
FT                   DEPLFGPVLNIKVFDYQLDIPGVQAQTHTLATGPVNDLELALFPDEHGDLSIEILANKQ
FT                   HYDEPTLIQHAERLKMLIAQFAADPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLS
FT                   ALVAEQAAKTPDAPALADARYQFSYREMREQVVALANLLREHGVKPGDSVAVALPRSVF
FT                   LTLALHAIVEAGAAWLPLDTGYPDDRLKMMLEDARPSLLITTDDQLPRFADVPDLTNLC
FT                   YNAPLTPQGSAPLQLSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQNHYPLTG
FT                   EDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAHRDPLAMQQFFAEYGVTTTHFVP
FT                   SMLAAFVASLTPQTARQNCATLKQVFCSGEALPADLCREWQQLTGAPLHNLYGPTEAAV
FT                   DVSWYPAFGEELAQVRGSSVPIGYPVWNTGLRILDAMMHPVPPGVAGDLYLTGIQLAQG
FT                   YLGRPDLTASRFIADPFVPGERMYRTGDVARWLDNGAVEYLGRSDDQLKIRGQRIELGE
FT                   IDRVMQALPDVEQAVTHACVINQAAATGGDARQLVGYLVSQSGLPLDTSALQAQLRETL
FT                   PPHMAPVVLLQLPQLPLSANGKLDRKALPLPELKAQTPGRAPKAGSETIIAAAFASLLG
FT                   CDVQDADADFFALGGHSLLAMKLAAQLSRQFARQVTPGQVMVASTVAKLATIIDGEEDS
FT                   SRRMGFETILPLREGNGPTLFCFHPASGFAWQFSVLSRYLDPLWSIIGIQSPRPHGPMQ
FT                   TATNLDEVCEAHLATLLEQQPHGPYYLLGYSLGGTLAQGIAARLRARGEQVAFLGLLDT
FT                   WPPETQNWQEKEANGLDPEVLAEINREREAFLAAQQGSTSTELFTTIEGNYADAVRLLT
FT                   TAHSVPFDGKATLFVAERTLQEGMSPERAWSPWIAELDIYRQDCAHVDIISPGAFEKIG
FT                   PIIRATLNR"
FT   CDS_pept        699911..701044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepE"
FT                   /locus_tag="ECs_0626"
FT                   /product="regulator of length of O-antigen component of
FT                   lipopolysaccharide chains"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34049"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34049"
FT                   /db_xref="GOA:Q8XBV8"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="PDB:3B8M"
FT                   /db_xref="PDB:3B8N"
FT                   /db_xref="PDB:4E2L"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBV8"
FT                   /protein_id="BAB34049.1"
FT                   /translation="MSSLNIKQGSDAHFPDYPLASPSNNEIDLLNLISVLWRAKKTVMA
FT                   VVFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAF
FT                   NLFIKKFQSVSLLEEYLRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKK
FT                   DEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKL
FT                   AQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERK
FT                   LEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLPVKKDGPGKAI
FT                   IVILSALIGGMVACGSVLLRYAMASRKQDAMMADHLV"
FT   CDS_pept        complement(701041..701856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="ECs_0627"
FT                   /product="ferrienterobactin ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34050"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34050"
FT                   /db_xref="GOA:Q8XBV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBV7"
FT                   /protein_id="BAB34050.1"
FT                   /translation="MTESVARLRGEQLTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCG
FT                   KSTLLRTLSRLMTPAHGHVWLDGEHIQHYASKEVARRIGLLAQNATTLGDITVQELVAR
FT                   GRYPHQPLFTRWRKEDEEAVTKAMQATGITHLADQSVDTLSGGQRQRAWIAMVLAQETA
FT                   IMLLDEPTTWLDISHQIDLLELLSELNREKGYTLAAVLHDLNQACRYASHLIALREGKI
FT                   VAQGAPKEIVTAELIERIYGLRCMIIDDPVAGTPLVVPLGRTAPSTANS"
FT   CDS_pept        complement(701853..702845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="ECs_0628"
FT                   /product="iron-enterobactin ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34051"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34051"
FT                   /db_xref="GOA:Q8XBV6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBV6"
FT                   /protein_id="BAB34051.1"
FT                   /translation="MIYVSRRLLITCLLLISACVVAGIWGLRSGAVTLEISQVFAALMG
FT                   DAPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGV
FT                   LVAMVLFGQDLTAIALAAMVGGIITSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNT
FT                   WLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIIILMLIAAALLVRRMRLLEMGDD
FT                   TACALGVSVERSRLLMMLVAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQA
FT                   ALCGALLLLAADLCAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
FT   CDS_pept        complement(702842..703846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="ECs_0629"
FT                   /product="ferrienterobactin ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34052"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34052"
FT                   /db_xref="GOA:Q8XBV5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBV5"
FT                   /protein_id="BAB34052.1"
FT                   /translation="MSGSVAVTRAIAVPGLLLLLIIATALSLLIGAKSLPASVVLEAFS
FT                   GTCQSADCTIVLDARLPRTLAGLLAGGALGLAGALMQTLTRNPLADPGLLGVNAGASFA
FT                   IVLGAALFGYSSAQEQLAMAFAGALVASLIVAFTGSQGGGQLSPVRLTLAGVALAAVLE
FT                   GLTSGIALLNPDVYDQLRFWQAGSLDIRNLHTLKVVLIPVLIAGATALLLSRALNSLSL
FT                   GSDTATALGSRVARTQLIGLLAITVLCGSATAVVGPIAFIGLMMPHMARWLVGADHRWS
FT                   LPVTLLATPALLLFADIIGRVIVPGELRVSVVSAFIGAPVLIFLVRRKTRGGA"
FT   CDS_pept        703957..705207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entS"
FT                   /locus_tag="ECs_0630"
FT                   /product="enterobactin exporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34053"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34053"
FT                   /db_xref="GOA:Q8X534"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023722"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X534"
FT                   /protein_id="BAB34053.1"
FT                   /translation="MNKQSWLLNLSLLKTHPAFRAVFLARFISIVSLGLLGVAVPVQIQ
FT                   MMTHSTWQVGLSVTLTGGAMFVGLMVGGVLADRYERKKVILLARGTCGIGFIGLCLNAL
FT                   LPEPSLLAIYLLGLWDGFFASLGVTALLAATPALVGRENLMQAGAITMLTVRLGSVISP
FT                   MIGGLLLATGGVAWNYGLAAAGTFITLLPLLSLPALPPPPQPREHPLKSLLAGFRFLLA
FT                   SPLVGGIALLGGLLTMASAVRVLYPALADNWQMSAAQIGFLYAAIPLGAAIGALTSGKL
FT                   AHSARPGLLMLLSTLGSFLAIGLFGLMPMWILGVVCLALFGWLSAVSSLLQYTMLQTQT
FT                   PEAMLGRINGLWTAQNVTGDAIGAALLGGLGAMMTPVASASASGFGLLIIGVLLLLVLV
FT                   ELRRFRQTPPQVTASDG"
FT   CDS_pept        complement(705211..706167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="ECs_0631"
FT                   /product="ferrienterobactin ABC transporter periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34054"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34054"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBY6"
FT                   /protein_id="BAB34054.1"
FT                   /translation="MRLAPLYRNALLLTGLLFSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSTEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQALLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSAMQVLERLKALF"
FT   CDS_pept        706356..707531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entC"
FT                   /locus_tag="ECs_0632"
FT                   /product="isochorismate synthase 1"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34055"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34055"
FT                   /db_xref="GOA:P0AEJ3"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEJ3"
FT                   /protein_id="BAB34055.1"
FT                   /translation="MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVN
FT                   GDSPDSPFQQKLAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQA
FT                   SARRFTRSQSLNVVERQAIPEQTTFEQMVARAAALTATPQVDKVVLSRLIDITTDAAID
FT                   SGVLLERLIAQNPVSYNFHVPLADGGVLLGASPELLLRKDGERFSSIPLAGSARRQPDE
FT                   VLDREAGNRLLASEKDRHEHELVTQAMKEVLRERSSELHVPSSPQLITTPTLWHLATPF
FT                   EGKANSQENALTLACLLHPTPALSGFPHQAATQVIAELEPFDRELFGGIVGWCDSEGNG
FT                   EWVVTIRCAKLRENQVRLFAGAGIVPASSPLGEWRETGVKLSTMLNVFGLH"
FT   CDS_pept        707541..709151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entE"
FT                   /locus_tag="ECs_0633"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase component of
FT                   enterobactin synthase multienzyme complex"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34056"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34056"
FT                   /db_xref="GOA:Q8XBV3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011963"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBV3"
FT                   /protein_id="BAB34056.1"
FT                   /translation="MSIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDG
FT                   ERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLAL
FT                   FSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVAEHSSIRVVQLLNDSGEHNL
FT                   QDAINHPADGFTATPSPADEVVYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQ
FT                   QTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQINVTALVPP
FT                   AVSLWLQALTEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVN
FT                   YTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQ
FT                   HNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVI
FT                   YAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTA
FT                   VGKVDKKQLRQWLASRASA"
FT   CDS_pept        709165..710022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /locus_tag="ECs_0634"
FT                   /product="isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34057"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34057"
FT                   /db_xref="GOA:P0ADI5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ADI5"
FT                   /protein_id="BAB34057.1"
FT                   /translation="MAIPKLQAYALPESHDIPQNKVDWAFEPQRAALLIHDMQDYFVSF
FT                   WGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPE
FT                   QQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATD
FT                   AFMRDIKPFMVADALADFSRDEHLMSLKYVAGRSGRVVMTEELLPAPIPASKAALREVI
FT                   LPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLS
FT                   REVK"
FT   CDS_pept        710022..710768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entA"
FT                   /locus_tag="ECs_0635"
FT                   /product="2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34058"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34058"
FT                   /db_xref="GOA:Q8X528"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR003560"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X528"
FT                   /protein_id="BAB34058.1"
FT                   /translation="MDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFAQEQYP
FT                   FATEVMDVADAAQVAQVCQRLLAETERLDVLVNAAGILRMGATDQLSKEDWQQTFAVNV
FT                   GGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELA
FT                   GSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQRIRGFGEQFKLGIPLGKIARPQEIANTI
FT                   LFLASDLASHITLQDIVVDGGSTLGA"
FT   CDS_pept        710771..711184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entH"
FT                   /locus_tag="ECs_0636"
FT                   /product="enterobactin synthesis proofreading thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34059"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34059"
FT                   /db_xref="GOA:Q8XBU9"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR026576"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBU9"
FT                   /protein_id="BAB34059.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDIR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG"
FT   CDS_pept        711365..713470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="ECs_0637"
FT                   /product="carbon starvation protein involved in peptide
FT                   utilization"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34060"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34060"
FT                   /db_xref="GOA:Q8XBU8"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBU8"
FT                   /protein_id="BAB34060.1"
FT                   /translation="MNKSGKYLVWTVLSVMGAFALGYIALNRGEQINALWIVVASVCIY
FT                   LIAYRFYGLYIAKNVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLALFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAESPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGNLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFAITPDTLNQIASEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKVGFLAIANKFQAMIDSGNIPSQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLALFSIKTALAALKEPKPTAKETPYEPMPENVEEIV
FT                   VQAKGAH"
FT   CDS_pept        713652..713849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="ECs_5382"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5XGZ6"
FT                   /protein_id="BBE29398.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
FT   CDS_pept        complement(713859..714947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdH"
FT                   /locus_tag="ECs_0638"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34061"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34061"
FT                   /db_xref="GOA:Q8XBU7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBU7"
FT                   /protein_id="BAB34061.1"
FT                   /translation="MPHNPIRVVVGPANYFSHPGSFNHLHDFFTDEQLSRAVWIYGVRA
FT                   IAAAQTKLPPAFGLPGAKHILFRGHCSESDVQQLAAESGDDRSVVIGVGGGALLDTAKA
FT                   LARRLGLPFVAAPTIAATCAAWTPLSVWYNDAGQALHYEIFDDANFMVLVEPEIILNAP
FT                   QQYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINNAQAIRDVLLNSSEQALADQQN
FT                   QQLTQSFCDVVDAIIAGGGMVGGLGDRFTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYG
FT                   ILVQSALLGQDDVLAQLTGAYQRFHLPTTLAELEVDINNQAEIDKVIAHTLRPVESIHY
FT                   LPVTLTPDTLRAAFEKVESFKA"
FT   CDS_pept        715056..716216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdL"
FT                   /locus_tag="ECs_0639"
FT                   /product="methionine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34062"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34062"
FT                   /db_xref="GOA:Q8XBU5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBU5"
FT                   /protein_id="BAB34062.1"
FT                   /translation="MTNNPLIPQSKLPQLGTTIFTQMSALAQQHQAINLSQGFPDFDGP
FT                   RYLQERLAYHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADSDITVTAGATEAL
FT                   YAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQEFAALLSER
FT                   TRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHP
FT                   QLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLAIADML
FT                   RAEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAVSTLDDVEFCQW
FT                   LTREHGVAAIPLSVFCADPFPHKLIRLCFAKKESTLLAAAERLRQL"
FT   CDS_pept        complement(716217..716846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="ECs_0640"
FT                   /product="chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34063"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34063"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBU4"
FT                   /protein_id="BAB34063.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRINAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNSQLMPNDYNPNNVAPPEKKLLKKSIEIDGFTQPIVVTHTDKNALEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK"
FT   CDS_pept        complement(716819..718039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="ECs_0641"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34064"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34064"
FT                   /db_xref="GOA:A0A0H3JCP3"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR021845"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCP3"
FT                   /protein_id="BAB34064.1"
FT                   /translation="MSIYKIPLPLNILEAARERITWTLNTLPRVCVSFSGGKDSGLMLH
FT                   LTAELARQMGKKICVLFIDWEAQFSCTINYVQSLRELYTDVIEEFYWVALPLTTQNSLS
FT                   QYQPEWQCWEPDVEWVRQPPQDAITDPDFFCFYQPGMTFEQFVREFAEWFSQKRPAAMM
FT                   IGIRADESYNRFVAIASLNKQRFADDKPWTTAAPGGHSWYIYPIYDWKVADIWTWYANH
FT                   QSLCNPLYNLMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSG
FT                   GIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHWYQKKGI
FT                   EVPQTQQGDIGAKDIPSWRRICKVLLNNDYWCRALSFSPTKAKNYQRYNERIKGKRQEW
FT                   GILCNND"
FT   CDS_pept        complement(718186..719088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="ECs_0642"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34065"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34065"
FT                   /db_xref="GOA:Q8XBU2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBU2"
FT                   /protein_id="BAB34065.1"
FT                   /translation="MTNLYDLKKFDLNLLVIFECIYQHLSISKAAESLYITPSAVSQSL
FT                   QRLRAQFNDPLFIRSGKGIAPTTTGLNLHHHLEKNLRGLEQTINIVNKSELKKNFIIHG
FT                   PQLISCSNNSMLIRCLRQDSSVEIECHDILMSAENAEELLVHRKADLVITQMPVISRSV
FT                   ICMPLHTIRNTLICSNRHPRITDNSTYEQIMAEEFTQLISKSAGVDDIQMEIDERFMNR
FT                   KISFRGSSLLTIINSIAVTDLLGIVPYELYNSHRDFLNLKEIKLEHPLPSIKLYISYNK
FT                   SSLNNLVFSRFIDRLNECF"
FT   CDS_pept        complement(719298..720044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="ECs_0643"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34066"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34066"
FT                   /db_xref="GOA:P58320"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58320"
FT                   /protein_id="BAB34066.2"
FT                   /translation="MLKKILLLALLPAIAFAEELPAPVKAIEKQGITIIKTFDAPGGMK
FT                   GYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQS
FT                   HWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATA
FT                   AAILASKDPAKTWQEYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYY
FT                   MSKENTLQQAVGLPDQKTLNIIMGNK"
FT   CDS_pept        720416..720979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="ECs_0644"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34067"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34067"
FT                   /db_xref="GOA:P0AE10"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AE10"
FT                   /protein_id="BAB34067.1"
FT                   /translation="MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTF
FT                   VCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGAL
FT                   TRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVASHPG
FT                   EVCPAKWKEGEATLAPSLDLVGKI"
FT   CDS_pept        721078..722673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="ECs_0645"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34068"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34068"
FT                   /db_xref="GOA:Q8XBT4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBT4"
FT                   /protein_id="BAB34068.1"
FT                   /translation="MMMFKAQEINMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAE
FT                   IKELLAEIAELSDKVTFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLAL
FT                   LWTGGHPSKEAQSLLEQIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTA
FT                   IDGGTFQNEITDRNVMGVPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDA
FT                   YDVLIVGSGPAGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAG
FT                   ALKVHVDEYDVDVIDSQSASKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMN
FT                   VPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPE
FT                   MKADQVLQDKLRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQ
FT                   IGLLPNTNWLEGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKA
FT                   SLSAFDYLIRTKTA"
FT   CDS_pept        complement(722794..723222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspG"
FT                   /locus_tag="ECs_0646"
FT                   /product="universal stress protein UP12"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34069"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34069"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBT3"
FT                   /protein_id="BAB34069.1"
FT                   /translation="MYKTIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSAS
FT                   LSLHRFAADVRRFEEHLQHEAEERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEEL
FT                   GADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR"
FT   CDS_pept        723443..724681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdR"
FT                   /locus_tag="ECs_0647"
FT                   /product="Zn-dependent NAD(P)-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34070"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34070"
FT                   /db_xref="GOA:Q8XBT2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBT2"
FT                   /protein_id="BAB34070.1"
FT                   /translation="MKALTYHGPHHVQVENVPDPGIEQADDIILRITATAICGSDLHLY
FT                   RGKIPQVKHGDIFGHEFMGEVVETGKDVKNLQKGDRVVIPFVIACGDCFFCRLQQYAAC
FT                   ENTNAGKGAALNKKQIPAPAALFGYSHLYGGVPGGQAEYVRVPKGNVGPFKVPPLLSDD
FT                   KALFLSDILPTAWQAAKNAQIQQGSSVAVYGAGPVGLLTIACARLLGAEQIFVVDHHPY
FT                   RLRFAADRYGAIPINFDEDSDPAQSIIEQTAGHRGVDAVIDAVGFEAKGSTTETVLTNL
FT                   KLEGSSGKALRQCIAAVRRGGIVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQTHVHAWL
FT                   GELLPLIEKGLLKPEEIVTHYMPFEEAARGYEIFEKREEECRKVILVPGAQSAEAAQKA
FT                   VSGLVNAMPGGTI"
FT   CDS_pept        complement(724912..725322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="ECs_0649"
FT                   /product="nucleoside diphosphate kinase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34072"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34072"
FT                   /db_xref="GOA:P0AFW6"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028625"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AFW6"
FT                   /protein_id="BAB34072.1"
FT                   /translation="MSRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCS
FT                   PEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVG
FT                   DSIHWELPGGVATHLEVLELEYQPEAAGDYLL"
FT   CDS_pept        complement(725552..726358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rna"
FT                   /locus_tag="ECs_0650"
FT                   /product="ribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34073"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34073"
FT                   /db_xref="GOA:A0A0H3JCP7"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="InterPro:IPR039378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCP7"
FT                   /protein_id="BAB34073.1"
FT                   /translation="MKAFWRNAALLAVSLLPFSSANAVALQAKQYGDFDRYVLALSWQT
FT                   GFCQSQHDRNRNERDECRLQTETTNKADFLTVHGLWPGLPKSVAARGVDERRWMRFGCA
FT                   TRPIPNLPEARASRMCSSPETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHGACFGFD
FT                   PDAYFGTMVRLNQEIKESEAGKFLADNYGKTVSRRDFDAAFAKSWGKENVKAVKLTCQG
FT                   NPAYLTEIQVSIKADAINAPLSANSFLPQPHPGNCGKTFVIDKAGY"
FT   CDS_pept        complement(726472..727935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="ECs_0651"
FT                   /product="citrate/succinate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34074"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34074"
FT                   /db_xref="GOA:P0AE75"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AE75"
FT                   /protein_id="BAB34074.1"
FT                   /translation="MSLAKDNIWKLLAPLVVMGVMFLIPVPDGMPPQAWHYFAVFVAMI
FT                   VGMILEPIPATAISFIAVTICVIGSNYLLFDAKELADPAFNAQKQALKWGLAGFSSTTV
FT                   WLVFGAFIFALGYEVSGLGRRIALFLVKFMGKRTLTLGYAIVIIDILLAPFTPSNTART
FT                   GGTVFPVIKNLPPLFKSFPNDPSARRIGGYLMWMMVISTSLSSSMFVTGAAPNVLGLEF
FT                   VSKIAGIQISWLQWFLCFLPVGVILLIIAPWLSYVLYKPEITHSEEVATWAGDELKTMG
FT                   ALTRREWTLIGLVLLSLGLWVFGSEVINATAVGLLAVSLMLALHVVPWKDITRYNSAWN
FT                   TLVNLATLVVMANGLTRSGFIDWFAGTMSTHLEGFSPNATVIVLVLVFYFAHYLFASLS
FT                   AHTATMLPVILAVGKGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSK
FT                   DYWRLGAIFGVIYISMLLLVGWPILAMWN"
FT   CDS_pept        complement(727986..728864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="ECs_0652"
FT                   /product="2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34075"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34075"
FT                   /db_xref="GOA:P58161"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58161"
FT                   /protein_id="BAB34075.1"
FT                   /translation="MSMPATLTKTTKLATSLIDEYALLGWRAMLTEVNLSPKPGLVDRI
FT                   NCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHGLRPIGMACEGDMFR
FT                   ATAGVNTHKGSIFSLGLLCAAIGRLLQLNQLLTPTTVCSTAASFCRGLTDRELRTNNSQ
FT                   LTAGQRLYQQLGLTGARGEAEAGYPLVINHALPHYLTLLDQGLDPELALLDTLLLLMAI
FT                   NGDTNVASRGGEGGLRWLQREAQTLLQKGGIRTPADLDYLRQFDRECIERNLSPGGSAD
FT                   LLILTWFLAQI"
FT   CDS_pept        complement(728839..729390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX"
FT                   /locus_tag="ECs_0653"
FT                   /product="apo-citrate lyase phosphoribosyl-dephospho-CoA
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34076"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34076"
FT                   /db_xref="GOA:P0A6G6"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6G6"
FT                   /protein_id="BAB34076.1"
FT                   /translation="MHLLPELASHHAVSIPELLVSRDERQARQHVWLKRHPVPLVSFTV
FT                   VAPGPIKDSEVTRRIFNHGVTALRALAAKQGWQIQEQAALVSASGPEGMLSIAAPARDL
FT                   KLATIELEHSHPLGRLWDIDVLTPEGEILSRRDYSLPPRRCLLCEQSAAVCARGKTHQL
FT                   TDLLNRMEALLNDVDACNVN"
FT   CDS_pept        complement(729394..730926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="ECs_0654"
FT                   /product="citrate lyase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34077"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34077"
FT                   /db_xref="GOA:A0A0H3JGB8"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JGB8"
FT                   /protein_id="BAB34077.1"
FT                   /translation="MTQKIEQSQRQERVAAWNRRAECDLAAFQNSPKQTYQAEKALDRK
FT                   LCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLILASSSLSDCH
FT                   APLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVA
FT                   FLGVPSCDEFGNANGYTGKACCGSLGYAMVDADNAKQVVMLTEELLPYPHNPASIEQDQ
FT                   VDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGA
FT                   SLAVTLFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARN
FT                   PNHIEISANQYANWGSKGASVDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCD
FT                   TAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVTDHGIAVNPARPELAERLQ
FT                   EAGIKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQVKE"
FT   CDS_pept        complement(730937..731845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="ECs_0655"
FT                   /product="citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34078"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34078"
FT                   /db_xref="GOA:A0A0H3JCJ9"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCJ9"
FT                   /protein_id="BAB34078.2"
FT                   /translation="MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLEE
FT                   SVALREKDTARRMVYHALQHPLYRDIETIVRVNALDSEWGVNDLEAVVRGGADVVRLPK
FT                   TDTAQDVLDIEKEILRIEKACGREPGSTGLLAAIESPLGITRAVEIAHASERLIGIALG
FT                   AEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIK
FT                   QLGFDGKSLINPRQIDLLHNLYAPTQKEVDHARRVVEAAEAAAREGLGVVSLNGKMVDG
FT                   PVIDRARLVLSRAELSGIREE"
FT   CDS_pept        complement(731842..732138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="ECs_0656"
FT                   /product="citrate lyase acyl carrier subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34079"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34079"
FT                   /db_xref="GOA:P69331"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69331"
FT                   /protein_id="BAB34079.1"
FT                   /translation="MKINQPAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGDAI
FT                   RTTILDVLARYNVRGVQLNVDDKGALDCILRARLEALLARASGIPALPWEDCQ"
FT   CDS_pept        complement(732153..733211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="ECs_0657"
FT                   /product="citrate lyase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34080"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34080"
FT                   /db_xref="GOA:Q8XBS1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBS1"
FT                   /protein_id="BAB34080.2"
FT                   /translation="MFGNDIFTRVKRSENKKMAEIAQFLHENDLSVDTTVEVFITVTRD
FT                   EKLIACGGIAGNIIKCVAISESVRGEGLALTLATELINLAYERHSTHLFIYTKTEYEAL
FT                   FRQCGFSTLTSVPGVMVLMENSATRLKRYAESLKKFRHPGNKIGCIAMNANPFTNGHRY
FT                   LIQQAAAQCDWLHLFLVKEDSSRFPYEDRLDLVLKGTADIPRLTVHRGSEYIISRATFP
FT                   CYFIKEQSVINHCYTEIDLKIFRQYLAPALGVTHRFVGTESFCRVTAQYNQDMRYWLET
FT                   PTISAAPIELVEIERLRYQEMPISASRVRQLLAKNDLTAIAPLVPAVTLHYLQNLLEHS
FT                   RQDAAARQKTPA"
FT   CDS_pept        733591..735249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="ECs_0658"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CitB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34081"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34081"
FT                   /db_xref="GOA:Q8XBS0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBS0"
FT                   /protein_id="BAB34081.1"
FT                   /translation="MLQLNENKQFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASF
FT                   EDYLTLHVRDMAMNQAKIIASNDSVISEVKTRDYKRLATIANKLQRDTDFDYVVIGDRH
FT                   SIRLYHPNPEKIGYPMQFTKQGALEKGESYFITGKGSMGMAMRAKTPIFDDDGKVIGVV
FT                   SIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVR
FT                   QQEALFSSVYEGLIAVDPHGYITAINRNARKMLGLSSPGRQWLGKPIAEVVRPADFFTE
FT                   QIDEKRQDVVANFNGLSVIANREAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVE
FT                   SLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGESQAQQQLIDSLREAFADRQVAGLL
FT                   FGKVQRARELGLKMIIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRSDEGNKIV
FT                   ELFLSDEGDDVVIEVADQGCGVPESLRDKIFEQGVSTRADEPGEHGIGLYLIASYVTRC
FT                   GGVITLEDNDPCGTLFSIYIPKVKPNDSSINPIDR"
FT   CDS_pept        735218..735898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citB"
FT                   /locus_tag="ECs_0659"
FT                   /product="response regulator in two-component regulatory
FT                   system with CitA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34082"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34082"
FT                   /db_xref="GOA:P0AEF6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEF6"
FT                   /protein_id="BAB34082.1"
FT                   /translation="MTAPLTLLIVEDETPLAEMHAEYIRHIPGFSQILLAGNLAQARMM
FT                   IERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFTTAASDMETVSEAVRCGVFDY
FT                   LIKPIAYERLGQTLTRFRQRKHMLESIDSASQKQIDEMFNAYARGEPKDELPTGIDPLT
FT                   LNAVRKLFKEPGVQHTAETVAQALTISRTTARRYLEYCASRHLIIAEIVHGKVGRPQRI
FT                   YHSG"
FT   CDS_pept        complement(735939..737324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuC"
FT                   /locus_tag="ECs_0660"
FT                   /product="anaerobic C4-dicarboxylate transport"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34083"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34083"
FT                   /db_xref="GOA:P0ABP4"
FT                   /db_xref="InterPro:IPR004669"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABP4"
FT                   /protein_id="BAB34083.1"
FT                   /translation="MLTFIELLIGVVVIVGVARYIIKGYSATGVLFVGGLLLLIISAIM
FT                   GHKVLPSSQASTGYSATDIVEYVKILLMSRGGDLGMMIMMLCGFAAYMTHIGANDMVVK
FT                   LASKPLQYINSPYLLMIAAYFVACLMSLAVSSATGLGVLLMATLFPVMVNVGISRGAAA
FT                   AICASPAAIILAPTSGDVVLAAQASEMSLIDFAFKTTLPISIAAIIGMAIAHFFWQRYL
FT                   DKKEHISHEMLDVSEITTTAPAFYAILPFTPIIGVLIFDGKWGPQLHIITILVICMLIA
FT                   SILEFLRSFNTQKVFSGLEVAYRGMADAFANVVMLLVAAGVFAQGLSTIGFIQSLISIA
FT                   TSFGSASIILMLVLVILTMLAAVTTGSGNAPFYAFVEMIPKLAHSSGINPAYLTIPMLQ
FT                   ASNLGRTLSPVSGVVVAVAGMAKISPFEVVKRTSVPVLVGLVIVIVATELMVPGTAAAV
FT                   TGK"
FT   CDS_pept        737913..738473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pagP"
FT                   /locus_tag="ECs_0661"
FT                   /product="phospholipid:lipid A palmitoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34084"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34084"
FT                   /db_xref="GOA:Q8XBR9"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBR9"
FT                   /protein_id="BAB34084.1"
FT                   /translation="MNVSKYVAIFSFVFIQLISVGKVFANADEWMTTFRENIVQTWQQP
FT                   EHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWN
FT                   KWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTF
FT                   QMTYIPGTYNNGNVYFAWMRFQF"
FT   CDS_pept        738648..738857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspE"
FT                   /locus_tag="ECs_0662"
FT                   /product="cold shock-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34085"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34085"
FT                   /db_xref="GOA:P0A974"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A974"
FT                   /protein_id="BAB34085.1"
FT                   /translation="MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLA
FT                   EGQRVEFEITNGAKGPSAANVIAL"
FT   CDS_pept        complement(738911..739294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flc"
FT                   /locus_tag="ECs_0663"
FT                   /product="fluoride efflux channel"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34086"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34086"
FT                   /db_xref="GOA:P63861"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63861"
FT                   /protein_id="BAB34086.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
FT   CDS_pept        739387..740175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeM"
FT                   /locus_tag="ECs_0664"
FT                   /product="amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34087"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34087"
FT                   /db_xref="GOA:P58054"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58054"
FT                   /protein_id="BAB34087.1"
FT                   /translation="MLVAAGQFAVTSVWEKNAEICASLMAQAAENDVSLFVLPEALLAR
FT                   DDHDADLSVKSAQLLEGEFLGRLRRESKRNMMTTILTIHVPSTPGRAWNMLVALQAGNI
FT                   VARYAKLHLYDAFAIQESRRVDAGNEIAPLLEVEGMKVGLMTCYDLRFPELALAQALQG
FT                   AEILVLPAAWVRGPLKEHHWSTLLAARALDTTCYMVAAGECGNKNIGQSRIIDPFGVTI
FT                   AAASEMPALIMAEVTPERVRQVRAQLPVLNNRRFAPPQLL"
FT   CDS_pept        740304..740507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatE"
FT                   /locus_tag="ECs_0665"
FT                   /product="TatABCE protein translocation system subunit
FT                   TatE"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34088"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34088"
FT                   /db_xref="GOA:P0A845"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="InterPro:IPR024905"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A845"
FT                   /protein_id="BAB34088.1"
FT                   /translation="MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMND
FT                   DDAAAKKGADVDLQAEKLSHKE"
FT   CDS_pept        complement(740608..741573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="ECs_0666"
FT                   /product="lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34089"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34089"
FT                   /db_xref="GOA:P60718"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60718"
FT                   /protein_id="BAB34089.1"
FT                   /translation="MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKL
FT                   PADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVA
FT                   HGRPVAPDANEPVKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQI
FT                   KIETLVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFK
FT                   EAHPEIPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSP
FT                   DEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK"
FT   CDS_pept        complement(741782..742735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeF"
FT                   /locus_tag="ECs_0667"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34090"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34090"
FT                   /db_xref="GOA:Q8XBQ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBQ3"
FT                   /protein_id="BAB34090.2"
FT                   /translation="MDSNNQIESCLSRKSSEGKPQIFTTLRNIDLNLLTIFEAVYVHKG
FT                   IVNAAKVLNLTPSAISQSIQKLRVIFPDPLFIRKGQGVTPTAFAMHLHEYISQGLESIL
FT                   GALDIEGSYDKQRTITIATTPSVGALVLPVIYRAIKTHYPQLLLRNPPISDAENQLSQF
FT                   QTDLIIDNMFCTNRTVQHHVLFTDNMVLICREGNPLLSLEDDRETIDNAAHVLLLPEGQ
FT                   NFSGLRQRIQEMFPDRQISFTSYNILTIAALVANSDMLAIIPSRFYNLFSRCWPLEKLP
FT                   FPSLNEEQIDFSIHYNKFSLRDPILHGVIDVIRNAF"
FT   CDS_pept        complement(742995..743636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="ECs_0668"
FT                   /product="lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34091"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34091"
FT                   /db_xref="GOA:P60721"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60721"
FT                   /protein_id="BAB34091.2"
FT                   /translation="MYQDKILVRQLGLQPYEPISQAMHEFTDTRDDSTLDEIWLVEHYP
FT                   VFTQGQAGKAEHILMPGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTL
FT                   LEQTVVNTLAELGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPF
FT                   LRINPCGYAGMEMAKISQWKPEATTNNIAPRLLENILALLNNPDFEYITA"
FT   CDS_pept        complement(743737..744000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeD"
FT                   /locus_tag="ECs_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34092"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34092"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8J6"
FT                   /protein_id="BAB34092.1"
FT                   /translation="MKTKLNELLEFPTPFTYKVMGQALPELVDQVVEVVQRHAPGDYTP
FT                   TVKPSSKGNYHSVSITINATHIEQVETLYEELGKIDIVRMVL"
FT   CDS_pept        complement(744110..745321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="ECs_0670"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34093"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34093"
FT                   /db_xref="GOA:P0AEB4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEB4"
FT                   /protein_id="BAB34093.2"
FT                   /translation="MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQID
FT                   AESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDA
FT                   WATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMN
FT                   SYVNALGLKNTHFQTVHGLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGI
FT                   RQLNRNGLLWDNSLNVDGIKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAES
FT                   KKLLTWGFRFFETVNPLKVGKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKAS
FT                   YVLNSSELHAPLQKNQVVGTINFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFH
FT                   HWFG"
FT   CDS_pept        complement(745461..746549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="ECs_0671"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34094"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34094"
FT                   /db_xref="GOA:Q8XBQ1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBQ1"
FT                   /protein_id="BAB34094.1"
FT                   /translation="MRKQWLGICIAAGMLAACTSDDGQQQTVSVPQPAVCNGPIVEISG
FT                   ADPRFEPLNATANQDYQRDGKSYKIVQDPSRFIQAGLAAIYDAEPGSNLTASGEAFDPT
FT                   QLTAAHPTLPIPSYARITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNNTK
FT                   VRIDPIIVAQDGSLSGPGMACTTVAKQTYALPAPPDLSGGAGTSSVSGPQGDILPVSNS
FT                   TLKSEDPTGAPVTSSGFLGAPTTLAPGVLEGSEPTPAPQPVVTAPSTTPATSPAMVTPQ
FT                   AASQSASGNFMVQVGAVSDQARAQQYQQQLGQKFGVPGRVTQNGAVWRIQLGPFANKAE
FT                   ASTLQQRLQTEAQLQSFITTAQ"
FT   CDS_pept        complement(746560..747672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="ECs_0672"
FT                   /product="cell wall shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34095"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34095"
FT                   /db_xref="GOA:P0ABG8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABG8"
FT                   /protein_id="BAB34095.1"
FT                   /translation="MTDNPNKKTFWDKVHLDPTMLLILLALLVYSALVIWSASGQDIGM
FT                   MERKIGQIAMGLVIMVVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRWLD
FT                   LGIVRFQPSEIAKIAVPLMVARFINRDVCPPSLKNTGIALVLIFMPTLLVAAQPDLGTS
FT                   ILVALSGLFVLFLSGLSWRLIGVAVVLVAAFIPILWFFLMHDYQRQRVMMLLDPESDPL
FT                   GAGYHIIQSKIAIGSGGLRGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVGILILL
FT                   ALYILLIMRGLWIAARAQTTFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVS
FT                   YGGSALIVLMAGFGIVMSIHTHRKMLSKSV"
FT   CDS_pept        complement(747675..749576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="ECs_0673"
FT                   /product="penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34096"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34096"
FT                   /db_xref="GOA:P0AD67"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AD67"
FT                   /protein_id="BAB34096.1"
FT                   /translation="MKLQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIV
FT                   RFTDYQTRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDA
FT                   LRSVVDLTDDDIAAFRKERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKR
FT                   RYYPYGSALTHVIGYVSKINDKDVERLNNDGKLANYAATHDIGKLGIERYYEDVLHGQT
FT                   GYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVVVTDPRTG
FT                   GVLALVSTPSYDPNLFVDGISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSA
FT                   LSAGVITRNTTLFDPGWWQLPGSEKRYRDWKKWGHGRLNVTRSLEESADTFFYQVAYDM
FT                   GIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYW
FT                   TATPIQMSKALMILINDGIVKVPHLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWELAKD
FT                   GMYGVANRPNGTAHKYFASAPYKIAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTA
FT                   FAPYNNPQVAVAMILENGGAGPAVGTLMRQILDHIMLGDNNTDLPAENPAVAAAEDH"
FT   CDS_pept        complement(749607..750074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmH"
FT                   /locus_tag="ECs_0674"
FT                   /product="23S rRNA m(3)Psi1915 pseudouridine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34097"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34097"
FT                   /db_xref="GOA:P0A8J0"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8J0"
FT                   /protein_id="BAB34097.1"
FT                   /translation="MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGG
FT                   PEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE"
FT   CDS_pept        complement(750078..750395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsfS"
FT                   /locus_tag="ECs_0675"
FT                   /product="ribosomal silencing factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34098"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34098"
FT                   /db_xref="GOA:Q8XBP2"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBP2"
FT                   /protein_id="BAB34098.2"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
FT   CDS_pept        complement(750655..751266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobC"
FT                   /locus_tag="ECs_0676"
FT                   /product="alpha-ribazole phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34099"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34099"
FT                   /db_xref="GOA:A0A0H3JCK4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCK4"
FT                   /protein_id="BAB34099.1"
FT                   /translation="MRLWLIRHGETQANVDGLYSGHAPTPLTARGIEQAQNLHTLLDDV
FT                   SFDLVLCSELERAQHTARLVLSDRQLPVHIIPELNEMFFGDWEMRHHRDLMQEDAENYS
FT                   AWCNDWQHAIPTNGEGFQAFSQRVERFIARLSEYQHYQNILIVSHQGVLSLLIARLIGM
FT                   PAESMWHFRVDQGCWSAIDINQKFATLRVLNSRAIGVENA"
FT   CDS_pept        complement(751290..751931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="ECs_0677"
FT                   /product="nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34100"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34100"
FT                   /db_xref="GOA:Q8XBP0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBP0"
FT                   /protein_id="BAB34100.1"
FT                   /translation="MKSLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPH
FT                   RPQPEANSVQRKHMLELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAF
FT                   IIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHL
FT                   QPAGKIYLAETPWFNISATIIRERLQNGESCDDLLPEPVLTYINQQGLYR"
FT   CDS_pept        complement(751933..752964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="ECs_0678"
FT                   /product="DNA polymerase III delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34101"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34101"
FT                   /db_xref="GOA:Q8X523"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X523"
FT                   /protein_id="BAB34101.1"
FT                   /translation="MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQ
FT                   GFEEHHTFSIDPNTDWNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLL
FT                   HDDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQLNLELD
FT                   DAANQVLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALL
FT                   MGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQN
FT                   RRGMMGEALNRLSQPQLRQAVQLLTRTELTLKQDYSQSVWAELEGLSLLLCHKPLADVF
FT                   IDG"
FT   CDS_pept        complement(752964..753545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptE"
FT                   /locus_tag="ECs_0679"
FT                   /product="LPS assembly OM complex LptDE lipoprotein
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34102"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34102"
FT                   /db_xref="GOA:Q8XBN9"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBN9"
FT                   /protein_id="BAB34102.1"
FT                   /translation="MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNG
FT                   PLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGAVSISQDTASVFRNGQTAEYQMVMTV
FT                   SASVLIPGRDIYPISTKVFRSFFDNPQMALAKDNEQEMIIKEMYDRAAEQLIRKLPSIR
FT                   AADIRSDEEQTSTTTDTPATPARVSTTLGN"
FT   CDS_pept        complement(753560..756142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="ECs_0680"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34103"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34103"
FT                   /db_xref="GOA:Q8XBN8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBN8"
FT                   /protein_id="BAB34103.1"
FT                   /translation="MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPS
FT                   GRLHMGHVRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDN
FT                   IAYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQ
FT                   TVLANEQVIDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRN
FT                   WIGRSEGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAF
FT                   IDECRNTKVAEAEMATMEKKGVNTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPG
FT                   HDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAI
FT                   ADKLTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDV
FT                   VMDGITSPIKADPQWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPEYKEGMLDSEA
FT                   ANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFYY
FT                   VGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQVMVE
FT                   RYGADTVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKGDVAALNVDAL
FT                   TEDQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPTDGEQDRALMQEA
FT                   LLAVVRMLNPFTPHICFTLWQELKGEGDIDNAPWPVADEKAMVEDSTLVVVQVNGKVRA
FT                   KITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVVG"
FT   CDS_pept        756378..756860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="ECs_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34104"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34104"
FT                   /db_xref="InterPro:IPR009912"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAU1"
FT                   /protein_id="BAB34104.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREV
FT                   FQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP"
FT   CDS_pept        complement(756930..757907)
FT                   /transl_table=11
FT                   /gene="ybeQ"
FT                   /locus_tag="ECs_0682"
FT                   /note="hypothetical protein"
FT                   /pseudogene="unknown"
FT   CDS_pept        758072..758779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECs_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34106"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34106"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X522"
FT                   /protein_id="BAB34106.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTRFFDLSSSW
FT                   GIDDRDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYSNWRQYFA
FT                   GYTFGRQYWQSPEDDNLPLLREFLARKEYDDSGNDMFYQLFASDDAYYATLPWQPLADY
FT                   PTCPETLKDMSDL"
FT   CDS_pept        758776..760203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ECs_0684"
FT                   /product="molecular chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34107"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34107"
FT                   /db_xref="GOA:Q8XBM1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBM1"
FT                   /protein_id="BAB34107.1"
FT                   /translation="MKNCWKILNIEETTDVDIIRRAYLALLPSFHPETDPQGFKQLRQA
FT                   YEEALRIAQSPAKSVWQPEEYEVAEHEILLAFRALLASDSERFLPSAWQRFIQQLNYCS
FT                   MNEIDELRWSLCTIAMNTAHLSFECVVLLAERLRWLQEENVGEIDEEELESFLYAIAKG
FT                   NVFNFQIILHLPVAVQNDTIDFYQMFARIWSSHPEWLTLYLAQHRAVIIPDDAKLHRNL
FT                   LRWYSAGRLGIPELLDYARSWREAEPDNEDARYYEYAQRVYCGEGESLLAELCDYWHEY
FT                   PSTQADALMLQWCRQHRVDYYPLVVMMIEARELVNDQGKPLLYVPGDSARTRFHLYEIL
FT                   SDEKLSALGRSLVEMVLHKGCKPRISLTRDTEHTLWPLYLVAKQLVQASQPTEESLMPI
FT                   VSRLDAENRCPLEALIIRRLLIQAANFTEKQTVEPEPQPQPMPVDDGGPGCLGIIKIIF
FT                   YIFIFAGLIGKILHLFG"
FT   CDS_pept        complement(760213..760767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeT"
FT                   /locus_tag="ECs_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34108"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34108"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBM0"
FT                   /protein_id="BAB34108.1"
FT                   /translation="MNKKLMYIFTIFIVAAITCISQPKKTTLRDKAMVNYAFDYLSSPG
FT                   SLPFTTAATELSAIHGHSTSQYRLGEFYLHGSDGKPLDYTQARYWYEQSAEQENPRAQS
FT                   KLGWIYLKGLGVKPDTRKAILWYKEAAEQGYAHAQYTLGLIYRNGSGINVNHYESQKWL
FT                   KLAAKQHYKNAERLLAGLPAH"
FT   CDS_pept        760869..761576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeU"
FT                   /locus_tag="ECs_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34109"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34109"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X521"
FT                   /protein_id="BAB34109.1"
FT                   /translation="MNKEEQYLLFALSAPMEILNQGCKPAHDSPKMYTGIKEFDLSSSW
FT                   GINNRDDLIQTIYQMTDDGHANDLAGLYLTWHRSSPEEWKALIAGGSERGLIYTQFVAQ
FT                   TAMCCGEGGIKAWDYVRMGFLSRVGVLNKWLTEDESLWLQSRVYERAHHYYHSWMHYFS
FT                   AYSLGRLYWQSSQCEDNASLREALTLYKYDSAGSRMFEELAAGSDRFYATLPWQPLTVQ
FT                   PECPVTLKDVSDL"
FT   CDS_pept        761573..763024
FT                   /transl_table=11
FT                   /gene="djlC"
FT                   /locus_tag="ECs_0687"
FT                   /note="J domain-containing HscC co-chaperone"
FT                   /pseudogene="unknown"
FT   CDS_pept        complement(763084..764754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscC"
FT                   /locus_tag="ECs_0689"
FT                   /product="Hsp70 family chaperone Hsc62"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34112"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34112"
FT                   /db_xref="GOA:A0A0H3JGD7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR042030"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JGD7"
FT                   /protein_id="BAB34112.1"
FT                   /translation="MDNAELAIGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISM
FT                   DENNHILVGKPAVSRRTSHPDKTAALFKRAMGSNTNWRLGSDTFNAPELSSLVLRSLKE
FT                   DAEEFLQRPIKDVVISVPAYFSDEQRKHTRLAAELAGLNAVRLINEPTAAAMAYGLHTQ
FT                   QNTRSLVFDLGGGTFDVTVLEYATPVIEVHASAGDNFLGGEDFTHMLVDEVLKRADVAR
FT                   TTLNESELAALYACVEAAKCSNQSPIHIRWQYQDETRECEFYENELEDLWLPLLNRLRV
FT                   PIEQALRDARLKPSQIDSLVLVGGASQMPLVQRIAVRLFGKLPYQSYDPSTIVALGAAI
FT                   QAACRLRSEDIEEVILTDICPYSLGVEVNRQGVSGIFSPIIERNTTVPVSRVETYSTMH
FT                   PEQDSITVNVYQGENHKVKNNILVESFDVPLKRTGAYQSIDIRFSYDINGLLEVDVLLE
FT                   DGSVKSRVINHSPVTLSAQQIEESRTRLSALKIYPRDMLINRTFKAKLEELWARALGDE
FT                   REEIGRVITDFDAALQSNDMARVDEVRRQASVYLAIEIP"
FT   CDS_pept        complement(764838..765773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihA"
FT                   /locus_tag="ECs_0690"
FT                   /product="ribonucleoside hydrolase 1"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34113"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34113"
FT                   /db_xref="GOA:Q8XBL8"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR022975"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBL8"
FT                   /protein_id="BAB34113.1"
FT                   /translation="MALPILLDCDPGHDDAIAIVLALASPELDVKAITSSAGNQTPEKT
FT                   LRNVLRMLTLLNRTDIPVAGGAVKPLMRELIIADNVHGESGLDGPALPEPTFAPQNCTA
FT                   VELMAKTLRESAEPVTIVSTGPQTNVALLLNSHPELHSKIARIVIMGGAMGLGNWTPAA
FT                   EFNIYVDPEAAEIVFQSGIPVVMAGLDVTHKAQIHVEDTERFRAIGNPVSTIVAELLDF
FT                   FLEYHKDEKWGFVGAPLHDPCTIAWLLKPELFTTVERWVGVETQGKYTQGMTVVDYYYL
FT                   TGNKPNATVMVDVDRQGFVDLLADRLKFYA"
FT   CDS_pept        complement(765891..766616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="ECs_0691"
FT                   /product="ATP-binding protein of glutamate/aspartate
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34114"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34114"
FT                   /db_xref="GOA:P0AAG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAG4"
FT                   /protein_id="BAB34114.1"
FT                   /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDA
FT                   FFDDPKSDRAKDFLAKILH"
FT   CDS_pept        complement(766616..767290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="ECs_0692"
FT                   /product="glutamate/aspartate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34115"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34115"
FT                   /db_xref="GOA:P0AER7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AER7"
FT                   /protein_id="BAB34115.1"
FT                   /translation="MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMR
FT                   LSSFAPVAWFAKAYVNVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAF
FT                   SMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGI
FT                   VLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRR
FT                   TA"
FT   CDS_pept        complement(767290..768030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltJ"
FT                   /locus_tag="ECs_0693"
FT                   /product="glutamate/aspartate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34116"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34116"
FT                   /db_xref="GOA:Q8XBL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBL7"
FT                   /protein_id="BAB34116.1"
FT                   /translation="MSIDWNWGIFLQQAPFGNTTYLGWIWSGFQVTIALSICAWIIAFL
FT                   VGSFFGILRTVPNRFLSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAEL
FT                   DPNIQFFLSSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPN
FT                   AYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQASKLLDYSAHAWESFTAITLAYVFI
FT                   NAFIMLVMTLVERKVRLPGNMGGK"
FT   CDS_pept        complement(768200..769108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /locus_tag="ECs_0694"
FT                   /product="glutamate/aspartate periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34117"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34117"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBL6"
FT                   /protein_id="BAB34117.1"
FT                   /translation="MQLRKPATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVG
FT                   HRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQN
FT                   GTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDIKDFADLKGKAVVVTSGTT
FT                   SEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNW
FT                   DIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNM
FT                   NFELSDEMKALFKEPNDKALN"
FT   CDS_pept        complement(769505..771043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="ECs_0695"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34118"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34118"
FT                   /db_xref="GOA:Q8XBK2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBK2"
FT                   /protein_id="BAB34118.1"
FT                   /translation="MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIISLMGLQ
FT                   ALTFNRRPLQSAAIGFCWGFGLFGSGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLY
FT                   TGLFAGVLSRLWPKTTWLRVAIAAPALWQVTEFLRGWVLTGFPWLQFGYSQIDGPLKGL
FT                   APLMGVEAINFLLMMVSGLLALALVKRNWRPLVVAVVLFALPFPLRYIRWFTPQPEKTI
FT                   QVSMVQGDIPQSLKWDEGQLLNTLKIYYNATAPLMGKSSLIIWPESAITDLEINQQPFL
FT                   KALDGELRDKGSSLVTGIVDARLNKQNRYDTYNTIITLGKGAPYSYESADRYNKNHLVP
FT                   FGEFVPLESILRPLAPFFDLPMSSFSRGPYIQPPLSANGIELTAAICYEIILGEQVRDN
FT                   FRPDTDYLLTISNDAWFGKSIGPWQHFQMARMRALELARPLLRSTNNGITAVIGPQGEI
FT                   QAMIPQFTREVLTTNVTPTTGLTPYARTGNWPLWVLTALFGFAAVLMSLRQRRK"
FT   CDS_pept        complement(771068..771946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeX"
FT                   /locus_tag="ECs_0696"
FT                   /product="ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34119"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34119"
FT                   /db_xref="GOA:P0AE80"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AE80"
FT                   /protein_id="BAB34119.1"
FT                   /translation="MSDDNSHSSDTISNKKGFFSLLLSQLFHGEPKNRDELLALIRDSG
FT                   QNDLIDEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFP
FT                   VISEDKDHIEGILMAKDLLPFMRSDAEAFSMDKVLRQAVVVPESKRVDRMLKEFRSQRY
FT                   HMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIED
FT                   FNEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKI
FT                   PDDSPQPKLDE"
FT   CDS_pept        complement(772036..772503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /locus_tag="ECs_0697"
FT                   /product="16S rRNA maturation RNase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34120"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34120"
FT                   /db_xref="GOA:Q8XBK1"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBK1"
FT                   /protein_id="BAB34120.1"
FT                   /translation="MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRV
FT                   VDTAESHSLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLVICRQMVEKEAQEQGKPL
FT                   EAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPYIAEKE"
FT   CDS_pept        complement(772500..773579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="ECs_0698"
FT                   /product="nucleoside triphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34121"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34121"
FT                   /db_xref="GOA:P0A9K5"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9K5"
FT                   /protein_id="BAB34121.1"
FT                   /translation="MFSFRRHTDKRNGLNIDTREITLEPADNARLLSLCGPFDDNIKQL
FT                   ERRLGIEINRRDNHFKLTGRPICVTAAADILRSLYVDTAPMRGQIQDIEPEQIHLAIKE
FT                   ARVLEQSAESVPEYGKAVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTY
FT                   LAVAAAVDALERQEIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGF
FT                   EKVEKLIERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVIT
FT                   GDVTQIDLPRNTKSGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAE
FT                   QKRKAALAAERKREEQEQK"
FT   CDS_pept        complement(773693..775117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="ECs_0699"
FT                   /product="tRNA-i(6)A37 methylthiotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34122"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34122"
FT                   /db_xref="GOA:P0AEI3"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEI3"
FT                   /protein_id="BAB34122.1"
FT                   /translation="MTKKLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLL
FT                   LNTCSIREKAQEKVFHQLGRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFG
FT                   PQTLHRLPEMINSVRGDRSPVVDISFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCTY
FT                   CVVPYTRGEEVSRPSDDILFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLL
FT                   RLVAAIDGIDRIRFTTSHPIEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTH
FT                   TALEYKAIIRKLRAARPDIQISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSA
FT                   RPGTPAADMVDDVPEEEKKQRLYILQERINQQAMAWSRRMLGTTQRILVEGTSRKSIME
FT                   LSGRTENNRVVNFEGTPDMIGKFVDVEITDVYPNSLRGKVVRTEDEMGLRVAETPESVI
FT                   ARTRKENDLGVGYYQP"
FT   CDS_pept        775263..776438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiF"
FT                   /locus_tag="ECs_0700"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34123"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34123"
FT                   /db_xref="GOA:A0A0H3JE16"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JE16"
FT                   /protein_id="BAB34123.1"
FT                   /translation="MTNQPTEIAIVGGGMVGGALALGLAQHGFTVTVIEHAEPAPFVAD
FT                   SQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPL
FT                   LGYMVENTVLQQALWQALEAHPKVTLRVPTSLIALHRDNDLQELELKGGEVIRAKLVIG
FT                   ADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNW
FT                   ASLVWYDSPARIRQLQNMNMAQLQVEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQP
FT                   GLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMA
FT                   DNFIMQSGMDLFYAGFSNNLPPLRFVRNLGLMAAERAGVLKRQALKYALGL"
FT   tRNA            complement(776592..776666)
FT                   /gene="glnX"
FT                   /locus_tag="ECs_R0031"
FT                   /product="tRNA-Gln"
FT                   /note="anticodon: ctg"
FT   tRNA            complement(776704..776778)
FT                   /gene="glnV"
FT                   /locus_tag="ECs_R0032"
FT                   /product="tRNA-Gln"
FT                   /note="anticodon: ctg"
FT   tRNA            complement(776827..776903)
FT                   /gene="metU"
FT                   /locus_tag="ECs_R0033"
FT                   /product="tRNA-Met"
FT                   /note="anticodon: cat"
FT   tRNA            complement(776919..776993)
FT                   /gene="glnW"
FT                   /locus_tag="ECs_R0034"
FT                   /product="tRNA-Gln"
FT                   /note="anticodon: ttg"
FT   tRNA            complement(777028..777102)
FT                   /gene="glnU"
FT                   /locus_tag="ECs_R0035"
FT                   /product="tRNA-Gln"
FT                   /note="anticodon: ttg"
FT   tRNA            complement(777126..777210)
FT                   /gene="leuW"
FT                   /locus_tag="ECs_R0036"
FT                   /product="tRNA-Leu"
FT                   /note="anticodon: tag"
FT   tRNA            complement(777221..777297)
FT                   /gene="metT"
FT                   /locus_tag="ECs_R0037"
FT                   /product="tRNA-Met"
FT                   /note="anticodon: cat"
FT   CDS_pept        complement(777677..779341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="ECs_0704"
FT                   /product="asparagine synthetase B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34127"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34127"
FT                   /db_xref="GOA:Q8XBJ9"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBJ9"
FT                   /protein_id="BAB34127.1"
FT                   /translation="MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDKAI
FT                   LAHERLSIVDVNAGAQPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVIL
FT                   ALYQEKGPEFLDDLQGMFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMK
FT                   ALVPVCRTIKEFPAGSYLWSQDGEIRSYYHRDWFDFDAVKDNVTDKNELRQALEDSVKS
FT                   HLMSDVPYGVLLSGGLDSSIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDL
FT                   KAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAM
FT                   GIKMVLSGEGSDEVFGGYLYFHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVE
FT                   ARVPFLDKKFLDVAMRINPQDKMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVG
FT                   YSWIDTLKEVAAQQVSDQQLETARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPG
FT                   GPSVACSSAKAIEWDEAFKKMDDPSGRAVGVHQSAYK"
FT   CDS_pept        complement(779598..780350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umpH"
FT                   /locus_tag="ECs_0705"
FT                   /product="UMP phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34128"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34128"
FT                   /db_xref="GOA:P0AF25"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AF25"
FT                   /protein_id="BAB34128.1"
FT                   /translation="MTIKNVICDIDGVLMHDNVAVPGAAEFLHGIMDKGLPLVLLTNYP
FT                   SQTGQDLANRFATAGVDVPDSVFYTSAMATADFLRRQEGKKAYVVGEGALIHELYKAGF
FT                   TITDVNPDFVIVGETRSYNWDMMHKAAYFVANGARFIATNPDTHGRGFYPACGALCAGI
FT                   EKISGRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLS
FT                   GVSSLDDIDSMPFRPSWIYPSVAEIDVI"
FT   CDS_pept        complement(780398..781618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagC"
FT                   /locus_tag="ECs_0706"
FT                   /product="N-acetylglucosamine-inducible nag divergent
FT                   operon transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34129"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34129"
FT                   /db_xref="GOA:P0AF22"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AF22"
FT                   /protein_id="BAB34129.1"
FT                   /translation="MTPGGQAQIGNVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLA
FT                   PASVTKITRQLIERGLIKEVDQQASTGGRRAISIVTETRNFHAIGVRLGRHDATITLFD
FT                   LSSKVLAEEHYPLPERTQQTLEHALLNAIAQFIDSYQRKLRELIAISVILPGLVDPDSG
FT                   KIHYMPHIQVENWGLVEALEERFKVTCFVGHDIRSLALAEHYFGASQDCEDSILVRVHR
FT                   GTGAGIISNGRIFIGRNGNVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLNL
FT                   LKQGYQSRVPLDDCTIKTICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVI
FT                   AGEITEADKVLLPAIESCINTQALKAFRTNLPVVRSELDHRSAIGAFALVKRAMLNGIL
FT                   LQHLLEN"
FT   CDS_pept        complement(781627..782775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="ECs_0707"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34130"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34130"
FT                   /db_xref="GOA:P0AF19"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AF19"
FT                   /protein_id="BAB34130.1"
FT                   /translation="MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRS
FT                   LNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSD
FT                   ELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENA
FT                   DVITKVTLAPEMVPAEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMP
FT                   YITGREPGLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGAN
FT                   IEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPA
FT                   RAIGVEKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ"
FT   CDS_pept        complement(782835..783635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="ECs_0708"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34131"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34131"
FT                   /db_xref="GOA:P0A760"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A760"
FT                   /protein_id="BAB34131.1"
FT                   /translation="MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTP
FT                   MTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENI
FT                   NLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLT
FT                   HDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNH
FT                   MWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL"
FT   CDS_pept        783968..785914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="ECs_0709"
FT                   /product="PTS N-acetylglucosamine EIICBA component"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34132"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34132"
FT                   /db_xref="GOA:A0A0H3JE22"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JE22"
FT                   /protein_id="BAB34132.1"
FT                   /translation="MNILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAG
FT                   GAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIIT
FT                   GLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGG
FT                   EWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINRFYAG
FT                   DGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLE
FT                   FLFMFLAPLLYLLHALLTGISLFVATLLGIHAGFSFSAGAIDYALMYNLPAASQNVWML
FT                   LVMGVVFFAIYFVVFSLVIRMFNLKTPGREDKEDEIVTEEANSNTEEGLNQLATNYIAA
FT                   VGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESI
FT                   GDAMKKVVARGPVAAASAEATPATAAPVAKPQAVPNAVSIAELVSPITGDVVALDQVPD
FT                   EAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVA
FT                   LEGKGFKRLVEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSNIDDFSGLIIKAQGH
FT                   VVAGQTPLYEIKK"
FT   CDS_pept        786117..787781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="ECs_0710"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34133"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34133"
FT                   /db_xref="GOA:Q8X9H8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X9H8"
FT                   /protein_id="BAB34133.1"
FT                   /translation="MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHA
FT                   KSICLNFGIAQDYKGQCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHWSGNVRYSSDYF
FT                   DQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRT
FT                   GGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDAL
FT                   EGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDK
FT                   HVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENA
FT                   PRAMAVIDPVKLVIENYQGEGEMVTMPNHPNKPEMGSRQVPFSGEIWIDRSDFREEANK
FT                   QYKRLVLGKEVRLRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIH
FT                   WVSAAHALPVEIRLYDRLFSVPNPGAADDFLSVINPESLVIKQGFAEPSLKDAVAGKAF
FT                   QFEREGYFCLDSRHSTAEKPVFNRTVGLRDTWAKVGE"
FT   CDS_pept        788360..789765
FT                   /transl_table=11
FT                   /locus_tag="ECs_0711"
FT                   /note="hypothetical protein"
FT                   /pseudogene="unknown"
FT   CDS_pept        789815..790141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chiQ"
FT                   /locus_tag="ECs_0713"
FT                   /product="chitosugar-induced verified lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34136"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34136"
FT                   /db_xref="InterPro:IPR025727"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X9H4"
FT                   /protein_id="BAB34136.1"
FT                   /translation="MKKLILIAMMASGLVACAQSTAPQEDSRLKEAYSACINTAQGSPE
FT                   KIEACQSVLNVLKKEKQHQQFADQESVRVLDYQQCLRATQTGNDQAVKADCDKVWQEIR
FT                   SNNK"
FT   CDS_pept        complement(790225..790671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="ECs_0714"
FT                   /product="ferric iron uptake regulon transcriptional
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34137"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34137"
FT                   /db_xref="GOA:P0A9B1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A9B1"
FT                   /protein_id="BAB34137.1"
FT                   /translation="MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLID
FT                   MGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSD
FT                   DSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK"
FT   CDS_pept        complement(790960..791490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldA"
FT                   /locus_tag="ECs_0715"
FT                   /product="flavodoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34138"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34138"
FT                   /db_xref="GOA:P61951"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61951"
FT                   /protein_id="BAB34138.1"
FT                   /translation="MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLE
FT                   AYDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCDALGT
FT                   IRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQ
FT                   ISEELHLDEILNA"
FT   CDS_pept        complement(791630..791992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="ECs_0716"
FT                   /product="LexA-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34139"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34139"
FT                   /db_xref="GOA:P0AAU8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAU8"
FT                   /protein_id="BAB34139.1"
FT                   /translation="MYYGALSIRAEAWLIVSPEVTKIMAKEQTDRTTLDLFAHERRPGR
FT                   PKTNPLSRDEQLRINKRNQLKRDKVRGLKRVELKLNAEAVEALNELAESRNMSRSELIE
FT                   EMLMQQLAALRSQGIV"
FT   CDS_pept        complement(792063..792827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /locus_tag="ECs_0717"
FT                   /product="acyl-CoA esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34140"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34140"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X9H1"
FT                   /protein_id="BAB34140.1"
FT                   /translation="MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNDHNI
FT                   IQVDMRNHGLSPRDPVMNYPAMAQDLVDTLDAQQIDKATFIAHSMGGKAVMALTALAPD
FT                   RIDKLVAIDIAPVDYHVRRHDEIFSAINAVSESDAQTRQQAAAIMRQHLNEEGVIQFLL
FT                   KSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPYVSEQYRDDLLAQFP
FT                   QARAHVIAGAGHWVHAEKPDAVLRAIRRYLND"
FT   CDS_pept        793012..793557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="seqA"
FT                   /locus_tag="ECs_0718"
FT                   /product="negative modulator of initiation of replication"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34141"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34141"
FT                   /db_xref="GOA:Q8X9G7"
FT                   /db_xref="InterPro:IPR005621"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026577"
FT                   /db_xref="InterPro:IPR033761"
FT                   /db_xref="InterPro:IPR036835"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X9G7"
FT                   /protein_id="BAB34141.1"
FT                   /translation="MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAASQPAAPV
FT                   TKEVRVASPAIVEAKPIKTIKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQ
FT                   AFAEATESLHGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHI
FT                   MQSMQFPAELIEKVCGTI"
FT   CDS_pept        793583..795223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="ECs_0719"
FT                   /product="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34142"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34142"
FT                   /db_xref="GOA:A0A0H3JCR2"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCR2"
FT                   /protein_id="BAB34142.1"
FT                   /translation="MAIHNRAGQPAQQSDLINVAQLTAQYYVLKPEAGNAEHAVKFGTS
FT                   GHRGSAARHSFNEPHILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVLEVLAA
FT                   NGVDVIVQENNGFTPTPAVSNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNPPNGG
FT                   PADTNVTKVVEDRANALMADGLKGVKRISLDEAMASGHVKEQDLVQPFVEGLADIVDMA
FT