(data stored in ACNUC7421 zone)

EMBL: BA000007.ACPH

BA000007.ACPH        Location/Qualifiers
FT   CDS_pept        complement(487968..488549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="ECs_0455"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33878"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33878"
FT                   /db_xref="GOA:Q8XE96"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XE96"
FT                   /protein_id="BAB33878.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSW
FT                   YDLDAHYAALETRFWQFYPRMMAQASRKAL"
     atgaattttt tagctcacct gcatttagcc catctcgcgg aaagctcgct ttccggcaat        60
     ttgctggctg atttcgtacg cggaaatcct gaagaaagtt ttccgcccga cgtcgtggct       120
     ggcattcata tgcatcgacg tatcgacgta ttgactgaca atctgccgga agtccgcgaa       180
     gcacgggagt ggtttcgtag tgaaactcgc cgcgttgcgc ctattacgct ggatgtcatg       240
     tgggatcact ttctttcccg tcactggtcg cagctgtcgc cggactttcc gctacaggaa       300
     tttgtttgtt atgcccgcga gcaagtgatg acaattttgc cggactcacc gccacgcttt       360
     atcaacctga acaactactt atggtcagag cagtggctgg tgcgctatcg cgatatggat       420
     ttcatccaga acgtgttaaa cggcatggca agccgtcgcc cacgtctgga tgccctgcgt       480
     gactcctggt acgatttaga cgcccattat gccgccctcg aaacccgctt ctggcagttt       540
     tatccacgga tgatggcgca ggcgtcacgc aaggcgctct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page