(data stored in ACNUC7421 zone)

EMBL: BA000007.ADK

BA000007.ADK         Location/Qualifiers
FT   CDS_pept        563011..563715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="ECs_0527"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33950"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33950"
FT                   /db_xref="GOA:P69442"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69442"
FT                   /protein_id="BAB33950.2"
FT                   /translation="MVVSFIAFSKNSTHFKGIFAMRIILLGAPGAGKGTQAQFIMEKYG
FT                   IPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLD
FT                   GFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVE
FT                   GKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPV
FT                   AEVRADLEKILG"
     atggtggtat cgtttatcgc tttttcaaaa aattcgacac attttaaggg gattttcgca        60
     atgcgtatca ttctgcttgg cgctccgggc gcggggaaag ggactcaggc tcagttcatc       120
     atggagaaat atggtattcc gcaaatctcc actggcgata tgctgcgtgc tgcggtcaaa       180
     tctggctccg agctgggtaa acaagcaaaa gacattatgg atgctggcaa actggtcacc       240
     gacgaactgg tgatcgcgct ggttaaagag cgcattgctc aggaagactg ccgtaatggt       300
     ttcctgttgg acggcttccc gcgtaccatt ccgcaggcag acgcgatgaa agaagcgggc       360
     atcaatgttg attacgttct ggaattcgac gtaccggacg aactgatcgt tgaccgtatc       420
     gtcggtcgcc gcgttcacgc gccgtctggt cgtgtttatc acgttaaatt caatccgccg       480
     aaagtagaag gtaaagacga cgttaccggt gaagaactga ctacccgtaa agacgatcag       540
     gaagaaaccg tacgtaaacg tctggttgaa taccatcaga tgacagcacc gctgatcggc       600
     tactactcca aagaagcgga agcgggtaac accaaatacg cgaaagttga cggcaccaag       660
     ccggttgctg aagttcgcgc tgatctggaa aaaatcctcg gctaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page