(data stored in ACNUC7421 zone)

EMBL: BA000007.AFUC

BA000007.AFUC        Location/Qualifiers
FT   CDS_pept        complement(438140..439186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /locus_tag="ECs_0413"
FT                   /product="ferric transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33836"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33836"
FT                   /db_xref="GOA:Q7AH43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AH43"
FT                   /protein_id="BAB33836.2"
FT                   /translation="MSQKNFVELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGK
FT                   TTILRLVAGLEKPSEGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLK
FT                   MLGVSRSEVKQRVKEALAMVDLEGFEDRYVDQISGGQQQRVALARALILKPKVLLFDEP
FT                   LSNLDANLRRSMRDKIRELQKQFNITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQ
FT                   DLYRQPASRFMASFMGDANLFPANFSEEYVDIYGYRLPRAAHFPVQGSGTVGVRPEAIT
FT                   LSNHGEESQRCVIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDIGEHYYLEIHPYG
FT                   MFVLADAA"
     atgagtcaga aaaattttgt ggaactgcgc aacgtcacta aacgattcgg cagtaatacg        60
     gttatcgaca atatcaatct caccatccca caagggcaaa tggtgacgct gcttggccct       120
     tccggctgcg gcaaaaccac cattttgcgt ctggttgccg ggctggaaaa accgagtgaa       180
     gggcaaatct ttattgatgg cgaagatgtc acgcatcgtt ccattcagca gcgcgatatc       240
     tgcatggtgt ttcagtcata cgctctgttc ccgcatatgt cgctgggcga aaacgtcggc       300
     tacgggttaa agatgctcgg cgtgtcgcgt agcgaagtaa agcagcgggt gaaagaggcg       360
     ctggcaatgg tggatctgga agggttcgag gaccgctatg tcgaccagat ttccggtggt       420
     cagcaacagc gcgtggcgct ggcccgcgcg ttgatcctca aaccaaaggt gctgctgttt       480
     gatgagccgt taagtaacct cgatgccaac ctgcgccgca gcatgcgcga taagatccgc       540
     gagctgcaaa agcagtttaa tatcacgtcg ctctacgtga ctcacgatca aagtgaggcc       600
     ttcgcggttt ccgacactgt gctggtgatg aataaaggtc acatcatgca gattggctca       660
     ccgcaggatc tctatcgtca gccagcctcc cgctttatgg caagttttat gggcgacgcc       720
     aacctgttcc cggcgaactt tagcgaagag tatgtcgata tctacggtta tcgcctgccg       780
     cgcgcggcgc atttcccggt gcaaggtagc ggcaccgtcg gcgttcgccc ggaagccatc       840
     accttaagca atcacggcga agagagtcag cgttgtgtta ttcgccatgt cgcctacatg       900
     gggccgcagt acgaagtgac cgtagagtgg catggacagg agattttatt acaagtaaac       960
     gccacccgtt tacagcccga tattggtgag cactattacc tcgaaatcca tccttacggg      1020
     atgtttgttt tagcggatgc ggcataa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page