(data stored in ACNUC7421 zone)

EMBL: BA000007.APAG

BA000007.APAG        Location/Qualifiers
FT   CDS_pept        complement(56205..56582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ECs_0055"
FT                   /product="CO2+/MG2+ efflux protein ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33478"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33478"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62674"
FT                   /protein_id="BAB33478.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDE
FT                   NGVPFSIDIPVFRLAVPTLIH"
     atgatcaatt cgccccgagt gtgtattcag gttcaaagcg tctacattga ggcacaatct        60
     tcacctgata atgaacgtta cgtttttgct tataccgtaa ccatacgcaa tctggggcga       120
     gcgccagtgc agttgttggg gcgttactgg ctgatcacca atggcaatgg ccgtgaaacc       180
     gaagtccagg gcgaaggagt ggttggcgtc cagccactta tcgcgcctgg cgaagagtac       240
     cagtacacca gcggtgcaat cattgaaacc ccgctgggca ccatgcaggg tcactacgaa       300
     atgatcgatg aaaatggcgt ccctttcagc atcgacattc ccgtattccg actcgccgtt       360
     cccacactca ttcattaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page