(data stored in ACNUC7421 zone)

EMBL: BA000007.ARFB

BA000007.ARFB        Location/Qualifiers
FT   CDS_pept        218178..218588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arfB"
FT                   /locus_tag="ECs_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33616"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33616"
FT                   /db_xref="GOA:Q8X8W5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W5"
FT                   /protein_id="BAB33616.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRSGRE"
     atgattgtga tttcccgaca tgttgctatt cccgatggtg agcttgagat caccgccatt        60
     cgtgcgcagg gcgcgggcgg gcagcatgtt aataagacct caacggccat tcatctgcgt       120
     tttgacattc gggcatccag cctgccagag tattacaaag agcgtctgct cgccgccagc       180
     catcatttga tcagcagtga tggcgtaatt gtcattaagg cacaggaata ccgcagtcag       240
     gaactgaacc gcgaagcggc gctggcccgg ctggtggcag tgattaaaga tttaacaaca       300
     gaacaaaaag cccgacgacc cacgcggccc acccgtgcat cgaaagagcg caggctggca       360
     tcgaaagcac aaaaatcaag cgtgaaggcg atgcgcagcg gtcgggaata a                411
//

If you have problems or comments...

PBIL Back to PBIL home page