(data stored in ACNUC7421 zone)

EMBL: BA000007.AROM

BA000007.AROM        Location/Qualifiers
FT   CDS_pept        467208..467885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="ECs_0440"
FT                   /product="AroM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33863"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33863"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA6"
FT                   /protein_id="BAB33863.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNHLAHVSRRKVERDLQGVVEVLDNQGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEELLTVQAQKWQILQKPPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFNQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
     atgagtgcgt cgttggcgat tctaaccatc ggcattgtac ctatgcagga agttttgccg        60
     ctcctgacag aatacattga cgaagataat atttcccatc atagcctgct ggggaagtta       120
     agccgcgaag aagtgatggc ggagtacgcg ccagaagcag gcgaagacac aattctcaca       180
     ttattaaatg acaaccatct ggcccatgtt tcgcgtcgca aagtagagcg tgacctgcaa       240
     ggtgtggttg aagtgctcga taatcagggc tacgacgtca ttatattaat gagtacggca       300
     aacattagta gtatgactgc gcgtaatacg atctttcttg agccgtcgag gatattgcca       360
     ccgctggttt cctctattgt tgaagatcat caggtggggg ttatcgtacc ggttgaggag       420
     ttgctgaccg ttcaggcgca aaaatggcaa attttgcaga aaccgcctgt attttcattg       480
     ggtaacccca ttcatgattc agaacaaaaa atcattgatg ccgggaaaga attactggcg       540
     aaaggcgcag atgtcatcat gctggattgt ttgggattta accagcgtca tcgcgattta       600
     ctgcaaaaac agctcgatgt tcctgtcttg ctctctaacg tattgattgc acggctggct       660
     gcggaattac tggtgtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page