(data stored in ACNUC7421 zone)

EMBL: BA000007.BTUF

BA000007.BTUF        Location/Qualifiers
FT   CDS_pept        complement(181862..182662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="ECs_0162"
FT                   /product="vitamin B12 ABC transporter periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33585"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33585"
FT                   /db_xref="GOA:Q8X8Z0"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X8Z0"
FT                   /protein_id="BAB33585.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATNIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFG
FT                   INPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIP
FT                   KIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD"
     atggctaagt cactgttcag ggcgctggtc gccctgtctt ttcttgcgcc actgtggctc        60
     aacgccgcgc cgcgcgtcat cacgctttct cccgccaaca ctgaacttgc ctttgccgcc       120
     gggatcacgc cggttggggt cagcagctat tccgactatc ctccacaagc gcaaaagatt       180
     gagcaggttt ccacctggca ggggatgaat ctggaacgca ttgtcgcgct gaaacccgat       240
     ctggtgattg cctggcgtgg aggtaatgcc gagcggcagg ttgaccagct ggcttcgctg       300
     ggaataaaag tgatgtgggt cgatgcgaca aacattgaac aaattgccaa tgcgttacgt       360
     caactggctc cctggagtcc gcaaccggat aaggccgaac aagccgcgca atccctgctg       420
     gatcaatacg cgcaattgaa agcgcaatat gctgataaac ctaaaaaacg tgtttttctg       480
     caattcggca ttaatccgcc atttaccagt ggaaaagagt cgattcaaaa ccaggtactc       540
     gaagtttgtg gcggagaaaa catctttaaa gacagccggg ttccctggcc gcaagttagc       600
     cgcgaacagg tgttagcacg ctcgccacag gcgattgtca ttacaggcgg accggaccaa       660
     attcctaaaa tcaaacaata ctggggtgaa cagctcaaaa ttcccgttat tcctctcacg       720
     agtgactggt ttgaacgtgc aagcccacgt attatcctcg ctgcacaaca gctctgtaat       780
     gcgctttcac aggtagatta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page