(data stored in ACNUC7421 zone)

EMBL: BA000007.CAIA

BA000007.CAIA        Location/Qualifiers
FT   CDS_pept        complement(43651..44793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="ECs_0042"
FT                   /product="crotonobetaine reductase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33465"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33465"
FT                   /db_xref="GOA:P60586"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60586"
FT                   /protein_id="BAB33465.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRRNGKIYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKPGIKVTKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVG
FT                   IAGNHRISRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
     atggatttta atttaaatga tgagcaggaa ctgtttgtcg ccggtatccg cgaactgatg        60
     gccagcgaaa actgggaggc ctattttgcc gagtgcgacc gtgacagcgt ctacccggaa       120
     cgttttgtca aagcactggc ggatatgggt atcgacagtc tgctgatccc tgaagagcac       180
     ggtggtctgg acgcggggtt tgttactctc gccgccgtgt ggatggagct gggacgtctg       240
     ggggcaccaa cctatgtact gtaccagttg ccgggcgggt tcaatacctt cctgcgcgaa       300
     ggcacacaag agcagatcga caagattatg gctttccgcg gcaccggtaa gcagatgtgg       360
     aactcagcga ttaccgaacc gggcgcgggc tccgacgtgg gtagcctgaa aacgacttat       420
     acccgtagaa atggtaagat ttatcttaat ggtagtaagt gttttattac cagtagcgcc       480
     tacaccccgt acatcgtggt gatggcgcgc gacggggctt ctccggacaa acctgtctac       540
     accgaatggt ttgttgatat gagcaaaccg ggcatcaaag tgaccaaact tgagaagctc       600
     ggtctgcgta tggatagctg ctgtgaaatc acctttgacg atgtggaact ggacgagaaa       660
     gacatgttcg gtcgggaagg taacggcttt aaccgcgtca aagaagagtt cgaccatgaa       720
     cgtttcctgg tagccctgac caactacggt acggcgatgt gcgcctttga agatgcggcg       780
     cgctacgcca accagcgcgt gcagtttggc gaggctattg gtcgtttcca gttgattcag       840
     gaaaaattcg cccacatggc gatcaaatta aactccatga aaaacatgct gtatgaagca       900
     gcgtggaaag cagacaacgg caccatcacc tctggcgatg cagcgatgtg caaatacttc       960
     tgcgccaatg cggcatttga agtggtggat agcgcaatgc aggtgctggg cggtgtcggg      1020
     attgcgggca accaccgcat cagccgcttc tggcgtgacc tgcgtgtaga ccgcgtttcc      1080
     ggaggatctg acgaaatgca gatcctgacg ctgggtcgtg cggtgctgaa gcaataccgc      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page