(data stored in ACNUC7421 zone)

EMBL: BA000007.CARA

BA000007.CARA        Location/Qualifiers
FT   CDS_pept        34026..35174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ECs_0035"
FT                   /product="carbamoyl phosphate synthetase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33458"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33458"
FT                   /db_xref="GOA:P0A6F2"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6F2"
FT                   /protein_id="BAB33458.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVT
FT                   TAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQ
FT                   TSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTAK"
     ttgattaagt cagcgctatt ggttctggaa gacggaaccc agtttcacgg tcgggccata        60
     ggggcaacag gttcggcggt tggggaagtc gttttcaata cttcaatgac cggttatcaa       120
     gaaatcctca ctgatccttc ctattctcgt caaatcgtta ctcttactta tccccatatt       180
     ggcaatgtcg gcactaatga cgccgatgaa gaatcttctc aggtacatgc acaaggtctg       240
     gtgattcgcg acctgccgct gattgccagc aacttccgta ataccgaaga cctctcttct       300
     tacctgaagc gccataacat cgtggcgatt gccgatatcg atacccgtaa gctgacgcgt       360
     ttactgcgcg agaaaggcgc acagaatggc tgcattatcg caggcgataa cccggatgcg       420
     gcgctggcgt tagaaaaagc ccgcgcgttc ccaggtctga atggcatgga tctggcaaaa       480
     gaagtgacca ccgcagaagc ctatagctgg acacaaggga gctggacgtt gaccggcggc       540
     ctgccagaag cgaaaaaaga agacgagctg ccgttccacg tcgtggctta tgattttggt       600
     gccaaacgca acatcctgcg gatgctggtg gatagaggct gtcgcctgac catcgttccg       660
     gcgcaaactt ctgcggaaga tgtgctgaaa atgaatccag acggcatctt cctctccaac       720
     ggtcctggcg acccggcccc gtgcgattac gccattaccg ccatccagaa attcctcgaa       780
     accgatattc cggtcttcgg catctgcctc ggtcatcagc tgctggcgct ggcgagcggt       840
     gcgaagactg tcaaaatgaa atttggtcac cacggcggca accatccggt taaagatgtg       900
     gagaaaaacg tggtgatgat caccgcccag aaccacggtt ttgcggtgga tgaagcaaca       960
     ttacctgcaa acctgcgtgt cacgcataaa tccctgttcg acggtacgtt acagggcatt      1020
     catcgcaccg ataaaccggc gttcagcttc cagggtcacc ctgaagccag ccctggtcca      1080
     cacgacgccg cgccgttgtt cgaccacttt atcgagttaa ttgagcagta ccgtaaaacc      1140
     gctaagtaa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page