(data stored in ACNUC7421 zone)

EMBL: BA000007.CARB

BA000007.CARB        Location/Qualifiers
FT   CDS_pept        35192..38413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="ECs_0036"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33459"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33459"
FT                   /db_xref="GOA:P63737"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63737"
FT                   /protein_id="BAB33459.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNAEFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLAEQGVTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKHGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIK"
     atgccaaaac gtacagatat aaaaagtatc ctgattctgg gtgcgggccc gattgttatc        60
     ggtcaggcgt gtgagtttga ctactctggc gcgcaagcat gtaaagccct gcgcgaagag       120
     ggttaccgcg tcattctggt gaactccaac ccggcgacca tcatgaccga cccggaaatg       180
     gccgatgcga cctacatcga gccgattcac tgggaagtgg tacgtaagat tattgaaaaa       240
     gagcgcccgg acgcggtgct gccaaccatg ggcggtcaga cggcgctgaa ctgcgcgctg       300
     gagctggaac gtcagggcgt gttggaagag ttcggcgtca ccatgattgg tgccactgcc       360
     gatgcgattg ataaagcaga agaccgccgt cgtttcgacg tagcgatgaa gaaaattggt       420
     ctggaaaccg cgcgttccgg tatcgcacat acgatggaag aagcgctggc ggttgccgct       480
     gacgtgggct tcccgtgcat tattcgccca tcctttacca tgggcggtag cggcggcggt       540
     atcgcttata accgcgaaga gtttgaagaa atttgcgccc gcggtctgga tctctctccg       600
     accaaagagt tgctgattga tgagtcgctg atcggctgga aagagtacga gatggaagtg       660
     gtgcgcgata aaaacgacaa ctgcatcatc gtctgctcta tcgaaaactt tgatgcgatg       720
     ggcatccaca ccggtgactc catcactgtc gcgccagccc aaacgctgac cgacaaagaa       780
     tatcaaatca tgcgtaacgc ctcgatggcg gtgctgcgtg aaatcggcgt tgaaaccggt       840
     ggttccaatg tccagtttgc ggtgaacccg aaaaacggtc gcctgattgt tatcgaaatg       900
     aacccacgcg tgtcccgttc ttcggcgctg gcgtcgaaag cgaccggttt cccgattgct       960
     aaagtggcgg cgaaactggc ggtgggttac accctcgatg aactgatgaa cgacatcact      1020
     ggcggacgta ctccggcctc cttcgagccg tccatcgatt acgtggttac caaaattcct      1080
     cgcttcaact tcgaaaaatt cgccggtgct aacgaccgtc tgaccactca gatgaaatcg      1140
     gttggcgaag tgatggcgat tggtcgcacg cagcaggaat ccctgcaaaa agcgctgcgc      1200
     ggcctggaag tcggtgcgac tggattcgac ccgaaagtga gcctggatga cccggaagcg      1260
     ttaaccaaaa tccgtcgcga actgaaagac gcaggcgcag agcgtatctg gtacatcgcc      1320
     gatgctttcc gcgcgggcct gtctgtggac ggcgtcttca acctgactaa cattgaccgc      1380
     tggttcctgg tacagattga agaactggtg cgtctggaag agaaagtggc ggaagtgggc      1440
     atcactggcc tgaacgctga attcctgcgc cagctgaaac gcaaaggctt tgccgatgcg      1500
     cgcttggcaa aactggcggg cgtacgcgaa gcggaaatcc gtaagctgcg tgaccaatat      1560
     gacctgcacc cggtctacaa gcgcgtggat acctgtgcgg cagagtttgc caccgacacc      1620
     gcttacatgt actccactta tgaagaagag tgcgaagcga atccgtctac cgaccgtgaa      1680
     aaaatcatgg tgcttggcgg cggtccaaac cgtatcggtc agggtatcga attcgactac      1740
     tgctgcgtac acgcctcgct ggcgctgcgt gaagacggtt acgaaaccat tatggttaac      1800
     tgtaacccgg aaaccgtctc taccgactac gacacttccg atcgcctcta cttcgagccg      1860
     gtaactctgg aagatgtgct ggaaatcgtg cgtattgaga agccgaaagg cgttatcgtt      1920
     cagtacggcg gtcagacccc gctgaaactg gcgcgtgcac tggaagccgc tggcgtaccg      1980
     gttatcggca ccagcccgga tgctatcgac cgtgcggaag accgtgaacg cttccagcat      2040
     gcggttgacc gtctgaaact gaaacaaccg gcgaacgcca ccgttactgc tattgaaatg      2100
     gcagttgaga aggcaaaaga gattggctac ccgctggtgg tgcgtccgtc ttacgttctc      2160
     ggcggtcggg cgatggaaat cgtctatgac gaagctgacc tgcgtcgcta cttccagacg      2220
     gcggttagcg tgtctaacga tgcgccagtg ttgctggatc atttccttga tgacgcagta      2280
     gaagttgacg tggatgccat ctgcgacggc gaaatggtgc tgattggcgg catcatggag      2340
     cacatcgagc aggcgggcgt gcactccggt gactccgcat gttcgctgcc agcgtacacc      2400
     ttaagtcagg aaattcagga tgtaatgcgc cagcaggtgc agaaactggc cttcgaattg      2460
     caggtgcgcg gcctgatgaa cgtgcagttt gcggtgaaaa acaacgaagt ctacctgatt      2520
     gaagttaacc cgcgtgcggc gcgtaccgtt ccgttcgtct ccaaagccac cggcgtaccg      2580
     ctggcaaaag tggcggcgcg tgtgatggct ggcaaatcgc tggctgagca gggcgtaacc      2640
     aaagaagtta tcccgccgta ctactcggtg aaagaagtgg tgctgccgtt caataaattc      2700
     ccgggcgttg acccgctgtt agggccagaa atgcgttcta ccggggaagt catgggcgtg      2760
     ggccgcacct tcgctgaagc gtttgccaaa gcgcagctgg gcagcaactc caccatgaag      2820
     aaacacggtc gtgcgctgct ttccgtgcgc gaaggcgata aagaacgcgt ggtggacctg      2880
     gcggcaaaac tgctgaaaca gggcttcgag ctggatgcga cccacggcac ggcgattgtg      2940
     ctgggcgaag cgggtatcaa tccgcgtctg gtaaacaagg tgcatgaagg ccgtccgcac      3000
     attcaggacc gtatcaagaa tggcgaatat acctacatca tcaacaccac ctcaggccgt      3060
     cgtgcgattg aagactcccg cgtgatccgt cgcagtgcgc tgcaatataa agtgcattat      3120
     gacaccaccc tgaacggtgg tttcgctacc gcgatggcgc tgaatgccga tgcgactgaa      3180
     aaagtaattt cggtgcagga aatgcacgca cagatcaaat aa                         3222
//

If you have problems or comments...

PBIL Back to PBIL home page