(data stored in ACNUC7421 zone)

EMBL: BA000007.CLPP

BA000007.CLPP        Location/Qualifiers
FT   CDS_pept        522730..523353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="ECs_0491"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33914"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33914"
FT                   /db_xref="GOA:P0A6G9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6G9"
FT                   /protein_id="BAB33914.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
     atgtcataca gcggcgaacg agataacttt gcaccccata tggcgctggt gccgatggtc        60
     attgaacaga cctcacgtgg tgagcgctct tttgatatct attctcgtct acttaaggaa       120
     cgcgtcattt ttctgactgg ccaggttgaa gaccatatgg ctaacctgat tgtggctcag       180
     atgctgttcc tggaagcaga aaacccagaa aaagatatct atctgtacat taactcccca       240
     ggcggggtga tcactgccgg gatgtctatc tatgacacca tgcagtttat caagcctgat       300
     gtcagcacca tctgtatggg ccaggcggcc tcgatgggcg ctttcttgct gaccgcaggg       360
     gcaaaaggta aacgtttttg cctgccgaat tcgcgcgtga tgattcacca accgttgggc       420
     ggctaccagg gccaggcgac cgatatcgaa attcatgccc gtgaaattct gaaagttaaa       480
     gggcgtatga atgaacttat ggcgcttcat acgggtcaat cattagaaca gattgaacgt       540
     gataccgagc gcgatcgctt cctttccgcc cctgaagcgg tggaatacgg tctggtcgat       600
     tcgattctga cccatcgtaa ttga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page