(data stored in ACNUC7421 zone)

EMBL: BA000007.COAE

BA000007.COAE        Location/Qualifiers
FT   CDS_pept        complement(117089..117709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ECs_0107"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33530"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33530"
FT                   /db_xref="GOA:P0A6J0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6J0"
FT                   /protein_id="BAB33530.1"
FT                   /translation="MRYIVALTGGIGSGKSTVANAFADLGINVIDADIIARQVVEPGAP
FT                   ALHAIADHFGANMIAADGTLQRRALRERIFANPEEKNWLNALLHPLIQQETQHQIQQAT
FT                   SPYVLWVVPLLVENSLYKKANRVLVVDVSPETQLKRTMQRDDVTREHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHAHYLQLASQFVSQEKP"
     atgaggtata tagttgcctt aacgggaggc attggcagtg gcaagagtac cgttgccaat        60
     gcgtttgctg atctcggaat taacgtcatt gatgccgata ttattgcgcg tcaggtggtt       120
     gaaccaggtg cacctgcgct acatgccatt gctgatcact ttggcgctaa tatgattgct       180
     gctgatggaa cattgcagcg ccgggccttg cgcgagcgga tcttcgccaa cccggaagag       240
     aaaaactggc ttaacgccct gctgcatccg ctgattcagc aagagacgca acaccagatc       300
     cagcaagcta cttcccccta tgtactgtgg gttgtgccat tgctggtaga aaactcactg       360
     tataaaaaag cgaatcgagt gctggtggtg gatgtcagcc cagaaacgca acttaagcgc       420
     accatgcagc gcgatgatgt aactcgcgag catgtcgaac aaatccttgc tgctcaggca       480
     acgcgcgaag cccgccttgc cgtggcagat gacgtcattg ataataacgg cgcaccggat       540
     gctatcgcat cggatgttgc ccgcctgcac gcacactatt tgcagcttgc gtcgcagttt       600
     gtctcacagg aaaaaccgta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page