(data stored in ACNUC7421 zone)

EMBL: BA000007.CSTA

BA000007.CSTA        Location/Qualifiers
FT   CDS_pept        711365..713470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="ECs_0637"
FT                   /product="carbon starvation protein involved in peptide
FT                   utilization"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34060"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34060"
FT                   /db_xref="GOA:Q8XBU8"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBU8"
FT                   /protein_id="BAB34060.1"
FT                   /translation="MNKSGKYLVWTVLSVMGAFALGYIALNRGEQINALWIVVASVCIY
FT                   LIAYRFYGLYIAKNVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLALFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAESPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGNLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFAITPDTLNQIASEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKVGFLAIANKFQAMIDSGNIPSQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLALFSIKTALAALKEPKPTAKETPYEPMPENVEEIV
FT                   VQAKGAH"
     atgaacaaat cagggaaata cctcgtctgg acagtgctct ctgtaatggg agcatttgct        60
     ctgggatata ttgctttaaa tcgtggggaa cagatcaacg cgctgtggat tgtggtggcg       120
     tcggtctgta tctatctgat cgcttaccgt ttttatggtc tgtatatcgc caaaaatgtg       180
     ctggcggttg acccgacgcg tatgacgcca gcggtgcgcc ataacgacgg gctggactat       240
     gtgccgacgg acaagaaagt gctgttcggt caccattttg cggccattgc cggagcaggt       300
     ccgttggttg ggccggtact ggcggcgcaa atgggttacc tgccagggat gatctggcta       360
     ctcgccgggg tggttctcgc cggtgcggtg caggatttca tggtgctgtt tgtttctacg       420
     cgccgtgacg gtcgttcgct gggtgagctg gtcaaagaag agatggggcc aaccgccggg       480
     gtgatcgcgc tggtggcctg ctttatgatc atggtcatta tccttgcagt actggcgatg       540
     atcgtggtga aagccctgac tcatagcccg tggggaacgt ataccgttgc gttcaccatt       600
     ccgctggcgc tgttcatggg gatctacctg cgctatctgc gtccggggcg tattggtgaa       660
     gtgtcggtca tcggtctggt attcctgatt ttcgccatta tttctggcgg ctgggtggca       720
     gaaagtccga cctgggcacc gtactttgac tttaccggcg tgcagctgac ctggatgctg       780
     gtgggttacg gttttgtggc ggcggtgctg ccggtatggt tgctgctggc tccgcgtgac       840
     tacctctcta ccttcctgaa aatcgggacg atcgttggtc tggcggtagg cattttgatt       900
     atgcgcccga cgctgaccat gcctgcgttg accaaatttg ttgacggcac tggcccggta       960
     tggaccggta acctgttccc gttcctgttt atcaccatcg cctgtggcgc ggtgtctggc      1020
     ttccatgcgc tgatctcttc cggcaccacg ccgaagatgc tggcgaacga agggcaggct      1080
     tgttttatcg gctacggtgg aatgttaatg gaatccttcg tggcgattat ggcactggtt      1140
     tccgcctgta tcatcgatcc gggcgtgtac ttcgccatga acagcccgat ggcggtgctg      1200
     gctccggcag ggacggcgga tgtggtcgct tctgccgcgc aagtggtgag tagctggggc      1260
     tttgcgatta ctccggatac gctcaaccag attgccagcg aagtgggaga acagtcgatc      1320
     atttcccgtg cgggcggtgc gccgacgttg gcggtgggga tggcctacat tctgcatggc      1380
     gcgctgggcg gcatgatgga tgtggcgttc tggtatcact tcgccattct gtttgaagct      1440
     ctgtttattc tgacggcggt ggatgcaggt acgcgtgctg cgcgctttat gttgcaggat      1500
     ctgctgggcg tggtttctcc gggcctgaaa cggaccgatt cactgcctgc taacctgctg      1560
     gcaacggcgc tgtgcgtgct ggcgtggggc tacttcctgc atcagggtgt ggtcgatccg      1620
     ctgggcggta ttaacactct gtggccgctg tttggtattg ccaaccagat gctggcaggg      1680
     atggcgctga tgctctgtgc cgtggtgttg ttcaagatga aacgtcaacg ttacgcctgg      1740
     gtggcgctgg taccaacggc ctggctgctg atttgtaccc tgaccgcagg ctggcagaaa      1800
     gcgtttagcc cggatgcgaa agtcggcttc ctggccattg ctaataagtt ccaggcaatg      1860
     atcgacagcg gtaatattcc atcgcagtat actgagtcac agctggcgca actggtgttc      1920
     aacaaccgtc tggatgccgg gttaaccatc ttctttatgg tggtcgtggt ggttctggca      1980
     ctgttctcga ttaagacggc acttgcggca ttgaaagagc cgaagccaac ggcgaaagaa      2040
     acgccgtatg agccaatgcc ggaaaatgtc gaggagatcg tggtgcaggc aaaaggcgcg      2100
     cactaa                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page