(data stored in ACNUC7421 zone)

EMBL: BA000007.CUSB

BA000007.CUSB        Location/Qualifiers
FT   CDS_pept        680015..681238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="ECs_0612"
FT                   /product="membrane fusion protein of copper/silver efflux
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34035"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34035"
FT                   /db_xref="GOA:Q8XEH9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XEH9"
FT                   /protein_id="BAB34035.1"
FT                   /translation="MKKIALIIGSMIAGGIISAAGFTWFAKAEPPAEKTSTAERKILFW
FT                   YDPMYPNTRFDKPGKSPFMDMDLVPKYADEESSASGVRIDPTQTQNLGVKTATVTRGPL
FT                   TFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGAPLLDLTIPDWVEAQS
FT                   EYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFD
FT                   LRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKW
FT                   TLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQR
FT                   VITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMR
FT                   SESATHAH"
     atgaaaaaaa tcgcgcttat tatcggcagc atgatcgcgg gcggtattat ttctgcggca        60
     ggttttacct ggtttgcaaa ggcggaaccg cctgcagaaa aaacgtcgac cgcagaacgt       120
     aaaatcttat tctggtacga cccgatgtat cccaatacgc ggttcgataa accaggtaaa       180
     tcgccgttta tggatatgga tctggtgccg aaatatgccg atgaagagag ttctgcgtct       240
     ggtgtgcgca ttgacccgac tcagacgcag aatctggggg tgaaaacggc taccgtcacg       300
     cgcgggccgc tgacttttgc ccagagtttc ccggcgaatg tcagttacaa cgagtatcag       360
     tatgccattg tgcaggctcg cgccgccggg tttatcgaca aggtgtatcc gcttaccgtg       420
     ggcgataaag tacaaaaggg cgcgccgctt ctcgacctga ccattcccga ctgggtggaa       480
     gcgcagagtg agtatttact gctgcgcgaa accggcggta cggcgaccca gaccgaaggc       540
     attcttgagc ggctgcgact ggcgggaatg ccggaggcgg atattcgccg cctgatcgcc       600
     acgcaaaaaa tccagactcg ctttacgctc aaagcaccca ttgatggcgt gatcaccgcg       660
     tttgatctgc gcgcgggaat gaatatcgcc aaagataacg tggtagcgaa aattcagggt       720
     atggacccgg tgtgggtcac tgctgcgatc ccggagtcca tcgcctggct ggtgaaagat       780
     gcctcgcagt ttacgctcac cgttccggcg cgacctgata aaacactcac catccgcaaa       840
     tggacgctac tacctggcgt ggatgccgcg acccgcacgc tgcagctgcg tctggaagtc       900
     gacaacgccg acgaggcgct aaaaccggga atgaacgcct ggttgcaact caataccgcc       960
     agcgaaccga tgctgctcat tccgtcacag gcgctgattg ataccggcag cgaacagcgg      1020
     gtgattaccg ttgatgccga cgggcgcttt gtaccaaaac gcgttgccgt tttccaggca      1080
     tcgcaaggtg tcaccgcatt acgctctggt ctggcggaag gtgaaaaggt ggtttccagc      1140
     ggcctgttcc tgattgattc cgaagccaat atttctggcg cactggagcg gatgcgctct      1200
     gaaagtgcta cccatgcgca ttga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page