(data stored in ACNUC7421 zone)

EMBL: BA000007.CUSF

BA000007.CUSF        Location/Qualifiers
FT   CDS_pept        679667..679999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="ECs_0611"
FT                   /product="Cu(I)/Ag(I) efflux system periplasmic protein
FT                   CusF"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34034"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34034"
FT                   /db_xref="GOA:Q8XBY2"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBY2"
FT                   /protein_id="BAB34034.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVK
FT                   GFDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSGIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
     atgaaaaaag cactgcaagt cgcaatgttc agtctgttta ccgttattgg ctttaatgcc        60
     caggctaacg aacatcatca tgaaaccatg agcgaagcac aaccacaggt cattagtgcc       120
     accggcgtgg taaaaggttt tgatctggaa agcaaaaaaa tcaccatcca tcacgatccg       180
     attgctgccg tgaactggcc ggagatgacc atgcgcttta ccatcacccc gcagacgaaa       240
     atgagtggaa ttaaaaccgg cgacaaagtg gcgtttaatt ttgtccagca gggcaacctt       300
     tctttattac aggatattaa agtcagccag taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page