(data stored in ACNUC7421 zone)

EMBL: BA000007.CUSS

BA000007.CUSS        Location/Qualifiers
FT   CDS_pept        complement(675983..677431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="ECs_0608"
FT                   /product="copper-sensing histidine kinase in two-component
FT                   regulatory system with CusR"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34031"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34031"
FT                   /db_xref="GOA:Q8XBY4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBY4"
FT                   /protein_id="BAB34031.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGA
FT                   PDIREFARDAIPDKDARGGEVFLLSGPTMMMPGHGHGHMEHSNWRMISLPVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   EVGKVFDFFEALAEDRGVELQFVGDECQVAGDPLMLRRALSNLLSNALRYTPPGEAIVV
FT                   RCQTVDHLVQVIVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSNARGTRFVIVLPERG"
     atggtcagta agccatttca gcgcccgttt tcgctggcaa cccgcctgac cttttttatc        60
     agcctggcca ccatcgcggc gtttttcgcc tttgcatgga tcatgatcca ctcagtaaaa       120
     gtgcattttg ccgagcagga tattaatgat ttaaaagaga ttagtgccac ccttgaacgc       180
     gtactaaatc accctgacga aacgcaagcc cgacgcttaa tgacgctgga agatatcgtc       240
     agtggttatt ccaatgtgtt gatttccctg gcagatagcc acggtaaaac ggtgtatcac       300
     tcccccggtg cgcctgatat ccgcgagttt gcgcgcgatg ccatacccga taaagacgcg       360
     cggggcggcg aggtgtttct cctctccggc ccgacgatga tgatgccagg ccacggtcac       420
     gggcatatgg aacacagcaa ctggcggatg atcagtttgc cagttggccc actggttgac       480
     ggcaaaccga tttatacgct ctacatcgcg ctttcgatcg attttcatct tcattacata       540
     aatgatttga tgaataaact tattatgacc gcatcggtca tcagcatcct gatcgtcttt       600
     atcgtgctat tggcggttca taaaggtcac gcgccgatcc gcagcgtcag ccgtcaaatc       660
     cagaatatca cctcgaaaga tctcgacgtc cgccttgacc cgcagaccgt gccgattgag       720
     ctggaacagc tggtactgtc gttcaaccat atgatcgagc gtattgagga tgtctttacc       780
     cgccagtcca atttctcagc ggatatcgcc cacgaaattc gcacaccaat tactaatctc       840
     ataacgcaaa cggaaatcgc cctcagccag tcgcgcagcc agaaggagct ggaagatgtg       900
     ctctactcta atctcgaaga gctgacgcga atggcgaaaa tggtcagcga tatgctgttt       960
     ctcgcccagg ccgataacaa ccagttaatc cccgaaaaga aaatgctcaa cctggcggat      1020
     gaagtcggca aagtgttcga ttttttcgag gctttagcgg aagatcgcgg cgtggagctg      1080
     cagtttgttg gcgacgagtg ccaggttgcg ggcgatccgc tgatgctgcg tcgggcgtta      1140
     agcaacctgc tttcgaacgc cctgcgttat acgccacccg gagaggctat tgtagtgcgc      1200
     tgccagacgg tcgatcatct ggtgcaagtt atcgtcgaaa accccggtac gcccattgcg      1260
     cccgagcact taccgcgatt gtttgaccgt ttctaccgcg ttgacccctc ccgccaacga      1320
     aaaggcgaag gtagcggcat tgggctggcg atagtgaaat caattgttgt cgcgcataaa      1380
     ggcacggttg cggttacgtc aaatgcgcgg gggacaaggt ttgtgattgt gttgccggag      1440
     agggggtga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page